HHsearch alignment for GI: 254780674 and conserved domain: TIGR01108

>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776 This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea . The oxaloacetate decarboxylase Na+ pump is the paradigm of the family of Na+ transport decarboxylases that present in bacteria and archaea. It a multi subunit enzyme consisting of a peripheral alpha-subunit and integral membrane subunits beta and gamma. The energy released by the decarboxylation reaction of oxaloacetate is coupled to Na+ ion pumping across the membrane.; GO: 0008948 oxaloacetate decarboxylase activity, 0006814 sodium ion transport.
Probab=98.76  E-value=9.6e-09  Score=78.19  Aligned_cols=57  Identities=30%  Similarity=0.559  Sum_probs=54.9

Q ss_pred             EEEEEEEECCCCEECCCCEEEEEECCCCEEEEECCCCCEEEEEEECCCCCEEECCCEE
Q ss_conf             9999998168978527985999952653124536878689999924886040358559
Q gi|254780674|r   18 GKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPI   75 (423)
Q Consensus        18 gtI~~Wl~k~GD~V~~gd~l~eVETDKa~~ev~S~~~G~l~~i~v~eG~e~v~VG~~i   75 (423)
T Consensus       560 G~i~~~~V~~G~~V~~G~vlL~~EAMKME~Ei~A~~aG~V~~i~v~~G-d~V~~gqVL  616 (616)
T TIGR01108       560 GSIVKITVSEGDEVKEGEVLLVVEAMKMETEIKAAAAGIVEEILVKKG-DKVSPGQVL  616 (616)
T ss_pred             CCEEEEEECCCCEECCCCEEEEEECCCCCHHHCCCCCCCEEEEEECCC-CEECCCCCC
T ss_conf             736999835787431577588531001112200543570112344578-750886679