HHsearch alignment for GI: 254780674 and conserved domain: TIGR01347

>TIGR01347 sucB 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR006255 These sequences describe the TCA cycle 2-oxoglutarate system E2 component, dihydrolipoamide succinyltransferase. It is closely related to the pyruvate dehydrogenase E2 component, dihydrolipoamide acetyltransferase. Members include the mitochondrial and Gram-negative bacterial forms. Mycobacterial candidates are highly derived, differ in having and extra copy of the lipoyl-binding domain at the N-terminus and are generally excluded from this group of sequences as are all examples of dihydrolipoamide acetyltransferase. ; GO: 0004149 dihydrolipoyllysine-residue succinyltransferase activity, 0006099 tricarboxylic acid cycle, 0045252 oxoglutarate dehydrogenase complex.
Probab=100.00  E-value=0  Score=875.20  Aligned_cols=410  Identities=29%  Similarity=0.456  Sum_probs=349.6

Q ss_pred             EEEECCCCCCCEEEEEEEEEEECCCCEECCCCEEEEEECCCCEEEEECCCCCEEEEEEECCCCCEEECCCEEEEEECCCC
Q ss_conf             47867887887217999999816897852798599995265312453687868999992488604035855999970754
Q gi|254780674|r    4 HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNILMDST   83 (423)
Q Consensus         4 ~~i~mP~lGe~m~egtI~~Wl~k~GD~V~~gd~l~eVETDKa~~ev~S~~~G~l~~i~v~eG~e~v~VG~~i~~i~~~~~   83 (423)
T Consensus         1 ~~ikvP~LaESvtegTva~W~KkvGD~V~~DE~iveiETDKV~lEV~Sp~dGvl~~~~~~eG-~TV~~g~~La~~~EG~~   79 (435)
T TIGR01347         1 IEIKVPELAESVTEGTVAEWHKKVGDTVKRDELIVEIETDKVVLEVPSPADGVLQEILEKEG-DTVTSGQVLAVLEEGSG   79 (435)
T ss_pred             CCCCCCCCCCCCCCCHHHHHCCCCCCEEECCCEEEEEECCCEEEEEECCCCCHHHHHHCCCC-CEECCCEEEEEEECCCC
T ss_conf             96447887653553305541068887112277689752074467882885302174306898-88505507788823876


Q ss_pred             CC-----CCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCC----------CCCCCCCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             21-----11112221000111112222233322---222222----------2222343221011110000011012344
Q gi|254780674|r   84 EI-----PPSPPLSKENIVEVREEHSHSSPVVV---REKHSK----------NRPIASPLARRLAGEHGIDLSSLSGSGP  145 (423)
Q Consensus        84 ~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~----------~~~~aSP~aRklA~e~giDl~~V~GTG~  145 (423)
T Consensus        80 nasken~~~~~~~~~a~~~-~~k~~~~~~~~~~~~~~~~~~~~~eieyllkdnh~~~~P~ar~~a~e~~~~~~~~~~~~~  158 (435)
T TIGR01347        80 NASKENSSAATAAAPAKSK-EAKEETAAASAAAVEEAPTAAANREIEYLLKDNHPPLSPAARRLAKENGIDLSAVPGTGK  158 (435)
T ss_pred             CCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHCCCCHHHCCCCCC
T ss_conf             3110246788645663346-788743246411133102110002456575527876774688774112788535467788


Q ss_pred             CCCCCC-CHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHCCCCC
Q ss_conf             332221-0024443200010001112211124444455546543456624655111221101110001232100000122
Q gi|254780674|r  146 HGRIVK-SDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID  224 (423)
Q Consensus       146 ~GRItk-~DV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vp~s~irk~ia~~m~~S~~~iPh~~~~~e  224 (423)
T Consensus       159 ~g~vtK~~D~~k~~~~~~-~~a~~~a~~~----~~~~~~~~~~~~~r~e~RvKMtRlRqriAeRL~EaqN~~AMLTTFNE  233 (435)
T TIGR01347       159 TGRVTKKEDIVKKEEAPA-ASAAAPAAAA----AAKAPANEKESGTRVEERVKMTRLRQRIAERLLEAQNSTAMLTTFNE  233 (435)
T ss_pred             CCCCCCHHHHHHHHHCCC-CCCCCCCCHH----HHHHHHHCCCCCCCCEEECCCCHHHHHHHHHHHHHHCCHHHCCCCCH
T ss_conf             876454110245873875-4676666034----43214415223796336247772679999988876314000122331


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCC-CCCCCCCCCCHHHHHHHHHHCCCCCCCCCC--CCCEECCCCCCCEEEEECCCCCC
Q ss_conf             233204678777566555432014-665543222101110011000000001123--44101255665415651464202
Q gi|254780674|r  225 CNIDNLLSLREQMNRTLQFHREEI-SNKISVNDIILKAFALAMIQVPEANVSWTT--NAMIRHKHIDISVAVSIPGGIVT  301 (423)
Q Consensus       225 vd~t~l~~~R~~l~~~~~~~~~~~-~~kit~~~~l~kA~a~AL~~~P~~Na~~~~--~~i~~~~~vnIgiAv~~~~GL~v  301 (423)
T Consensus       234 VdM~~vmeLRK~yke~F~---K~HdGvKLGFMSFFvKA~~~ALK~~P~VNA~IDGtt~divy~~Y~DIsvAVsTd~GLVv  310 (435)
T TIGR01347       234 VDMSAVMELRKRYKEEFE---KKHDGVKLGFMSFFVKAVVEALKRFPEVNAEIDGTTDDIVYKDYYDISVAVSTDRGLVV  310 (435)
T ss_pred             HHHHHHHHHHHHHHHHHH---HHCCCCEECCCCCHHHHHHHHHHHCCCCCCEECCCCCEEEEECCEEEEEEEECCCCCEE
T ss_conf             003689999986334676---53088224211007899999987244233121574332787545579999875998334


Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCEEEEEECCCEEEEEEEC-C
Q ss_conf             034145547989999987666543102334610037723898515321422101311588716898446312358778-9
Q gi|254780674|r  302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQN-E  380 (423)
Q Consensus       302 PvIk~ad~~~l~~i~~~~~~l~~~ar~~~l~~~d~~ggtftiSNlG~~g~~~~~pii~~pq~aILgvG~~~~~~~~~~-~  380 (423)
T Consensus       311 PVvRnad~l~~AdIE~~I~~L~~KAR~gKL~ledm~GGtFTItNGGVFGSL~STPIiNpPQ~AILGMH~I~eRPvavn~G  390 (435)
T TIGR01347       311 PVVRNADALSFADIEKEIKELGKKARDGKLTLEDMTGGTFTITNGGVFGSLMSTPIINPPQSAILGMHGIKERPVAVNEG  390 (435)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHCCCCCHHHCCCCCEEEECCCEEECCCCCCCCCCCCCCCCCCCCEEECCEEECCC
T ss_conf             22725665786777799898888753067314232788479976715302355775276510110378413357786387


Q ss_pred             EEEEEEEEEEEEEEEECEEEHHHHHHHHHHHHHHHCCHHHHHC
Q ss_conf             3789548898985200114028899999999998719889719
Q gi|254780674|r  381 EIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM  423 (423)
Q Consensus       381 ~i~~~~~~~ltls~DHRvidGa~aa~Fl~~~~~~le~P~~ll~  423 (423)
T Consensus       391 ~ieirPMMYlALSYDHRliDGkEAV~FLv~iKe~lEDP~~LLL  433 (435)
T TIGR01347       391 QIEIRPMMYLALSYDHRLIDGKEAVTFLVTIKELLEDPERLLL  433 (435)
T ss_pred             EEEECCCCHHHHCCCCEEEECCHHHHHHHHHHHHHCCHHHHHC
T ss_conf             2487972022323110023041231789999986138257621