HHsearch alignment for GI: 254780674 and conserved domain: TIGR02927

>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR014276 This entry represents the mainly actinobacterial clade of the E2 component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle. These proteins have multiple domains including the catalytic domain (IPR001078 from INTERPRO), one or two biotin domains (IPR000089 from INTERPRO) and an E3-component binding domain (IPR004167 from INTERPRO)..
Probab=100.00  E-value=0  Score=828.46  Aligned_cols=412  Identities=27%  Similarity=0.402  Sum_probs=339.8

Q ss_pred             CCEEEECCCCCCCEEEEEEEEEEECCCCEECCCCEEEEEECCCCEEEEECCCCCEEEEEEECCCCCEEECCCEEEEEECC
Q ss_conf             63478678878872179999998168978527985999952653124536878689999924886040358559999707
Q gi|254780674|r    2 MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNILMD   81 (423)
Q Consensus         2 m~~~i~mP~lGe~m~egtI~~Wl~k~GD~V~~gd~l~eVETDKa~~ev~S~~~G~l~~i~v~eG~e~v~VG~~i~~i~~~   81 (423)
T Consensus       134 ~aT~v~MPeLGESVTEGTvt~WLKaVGD~vEvDEPllEVsTDKVDTEiPSPvaGtlleI~a~E-DdtVeVG~vlA~IGDa  212 (607)
T TIGR02927       134 EATEVEMPELGESVTEGTVTRWLKAVGDTVEVDEPLLEVSTDKVDTEIPSPVAGTLLEILAEE-DDTVEVGAVLAKIGDA  212 (607)
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHCCCEEEECCCEEEEECCCCCCCCCCCCCCEEEEEEECC-CCEEECCCEEEEECCC
T ss_conf             656331644676202313787886339877633763564257206666887143688898177-8864315066542376


Q ss_pred             CCC----CC-----CCC--------------CC-CCCCCCCCCCCC-------CCCCCCC--------CCCCCCCCCCCC
Q ss_conf             542----11-----111--------------22-210001111122-------2223332--------222222222223
Q gi|254780674|r   82 STE----IP-----PSP--------------PL-SKENIVEVREEH-------SHSSPVV--------VREKHSKNRPIA  122 (423)
Q Consensus        82 ~~~----~~-----~~~--------------~~-~~~~~~~~~~~~-------~~~~~~~--------~~~~~~~~~~~a  122 (423)
T Consensus       213 n~A~A~~~P~~E~~P~PkaeP~~ea~~ep~P~~k~~p~a~p~p~p~P~p~ae~papaa~aA~~~~~~aaPvssGd~~pYV  292 (607)
T TIGR02927       213 NDAGAEDEPKEEEKPEPKAEPKSEAKSEPAPEAKAKPKAKPKPEPKPKPKAEEPAPAAKAATEKTAAAAPVSSGDSSPYV  292 (607)
T ss_pred             CCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             55650106787787777677678755677788887887887767886326646788876554564324751246888610


Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCC-----CC--CCCCCCCCCCCEE
Q ss_conf             4322101111000001101234433222100244432000100011122111244444-----55--5465434566246
Q gi|254780674|r  123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI-----DA--NILNLFAKDSYEV  195 (423)
Q Consensus       123 SP~aRklA~e~giDl~~V~GTG~~GRItk~DV~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~--~~~~~~~~~~~~~  195 (423)
T Consensus       293 TPlVRKLA~~~GvDLssVkGTGvGGRIRKQDVlAAA~~a~ea~~A~Aa~aaaAapaapAaAa~~~sakp~p~~a~LRGtT  372 (607)
T TIGR02927       293 TPLVRKLAKEKGVDLSSVKGTGVGGRIRKQDVLAAAKAAEEAKEAAAAEAAAAAPAAPAAAAKKASAKPEPEKAKLRGTT  372 (607)
T ss_pred             HHHHHHHHHHCCCCCCCCEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCCCHHHHCCCCCH
T ss_conf             03468777626831034111134552005669998675346773002575020031077750110367762210257740


Q ss_pred             EEECCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             55111221101110001232100000122233204678777566555432014665543222101110011000000001
Q gi|254780674|r  196 IPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVS  275 (423)
Q Consensus       196 vp~s~irk~ia~~m~~S~~~iPh~~~~~evd~t~l~~~R~~l~~~~~~~~~~~~~kit~~~~l~kA~a~AL~~~P~~Na~  275 (423)
T Consensus       373 ~K~nRiRqi~A~k~~esLQ~sAQLT~~~EVD~TrvaaLRaraK~~F~---ek~Gv~LTfLPFfv~Av~eALkaHP~vNAS  449 (607)
T TIGR02927       373 QKVNRIRQITAKKTVESLQISAQLTQVHEVDMTRVAALRARAKAEFL---EKEGVNLTFLPFFVKAVVEALKAHPNVNAS  449 (607)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEHHHHHHHHHHCCHHHH---HHCCCCCCHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             45678899998888998864342060168502348888640155778---716873001578999999998618862133


Q ss_pred             C--CCCCCEECCCCCCCEEEEECCCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCCCCCCC
Q ss_conf             1--23441012556654156514642020341455479899999876665431023346100377238985153214221
Q gi|254780674|r  276 W--TTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS  353 (423)
Q Consensus       276 ~--~~~~i~~~~~vnIgiAv~~~~GL~vPvIk~ad~~~l~~i~~~~~~l~~~ar~~~l~~~d~~ggtftiSNlG~~g~~~  353 (423)
T Consensus       450 yN~etKe~TYhd~eh~giAVDTp~GLL~PVi~NAgDLslpglAkaI~DlAaRaR~nklkPdeLsGgTFTITNiGS~GALf  529 (607)
T TIGR02927       450 YNEETKEVTYHDAEHLGIAVDTPRGLLVPVIHNAGDLSLPGLAKAIADLAARARDNKLKPDELSGGTFTITNIGSEGALF  529 (607)
T ss_pred             CCCCCCEEEEEEEEEEEEEEECCCCCCCCCEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCCCC
T ss_conf             04687503134310201465478886346231256577367999998899875347878540258732564006774011


Q ss_pred             CCCCCCCCCEEEEEECCCEEEEEEEC-----CEEEEEEEEEEEEEEEECEEEHHHHHHHHHHHHHHHCC
Q ss_conf             01311588716898446312358778-----93789548898985200114028899999999998719
Q gi|254780674|r  354 FCAVINPPQSTILAIGAGEKKVVFQN-----EEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN  417 (423)
Q Consensus       354 ~~pii~~pq~aILgvG~~~~~~~~~~-----~~i~~~~~~~ltls~DHRvidGa~aa~Fl~~~~~~le~  417 (423)
T Consensus       530 DTPIl~pP~aaiLG~GAIvkrPrVI~DedG~esIaiRsvcyLpLtYDHrlvDGADAgRfl~TiK~RLEe  598 (607)
T TIGR02927       530 DTPILVPPQAAILGTGAIVKRPRVIKDEDGGESIAIRSVCYLPLTYDHRLVDGADAGRFLTTIKKRLEE  598 (607)
T ss_pred             CCCCCCCCCHHHHCCCCEEECCEEEEECCCCCEEEEEEEEECCCCCCCEEEECCCHHHHHHHHHHHHHC
T ss_conf             577236754232126543107767885789815765112220454464034000045689898776514