HHsearch alignment for GI: 254780674 and conserved domain: cd06850

>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase. This domain functions in transferring CO2 from one subsite to another, allowing carboxylation, decarboxylation, or transcarboxylation. During this process, biotin is covalently attached to a specific lysine.
Probab=99.39  E-value=1.7e-12  Score=103.33  Aligned_cols=61  Identities=30%  Similarity=0.480  Sum_probs=58.4

Q ss_pred             EEEEEEEEECCCCEECCCCEEEEEECCCCEEEEECCCCCEEEEEEECCCCCEEECCCEEEEE
Q ss_conf             79999998168978527985999952653124536878689999924886040358559999
Q gi|254780674|r   17 EGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNI   78 (423)
Q Consensus        17 egtI~~Wl~k~GD~V~~gd~l~eVETDKa~~ev~S~~~G~l~~i~v~eG~e~v~VG~~i~~i   78 (423)
T Consensus         7 ~G~v~~~~V~~Gd~V~~G~~l~~iE~mK~~~~i~a~~~G~v~~i~~~~G-~~V~~G~~L~~i   67 (67)
T cd06850           7 PGTVVKVLVKEGDKVEAGQPLAVLEAMKMENEVTAPVAGVVKEILVKEG-DQVEAGQLLVVI   67 (67)
T ss_pred             CEEEEEEEECCCCEECCCCEEEEEEECCCEEEEEECCCEEEEEEEECCC-CEECCCCEEEEC
T ss_conf             8899999957999997899999999366119999689999999997898-998999999979