HHsearch alignment for GI: 254780674 and conserved domain: pfam00364

>pfam00364 Biotin_lipoyl Biotin-requiring enzyme. This family covers two Prosite entries, the conserved lysine residue binds biotin in one group and lipoic acid in the other. Note that the model may not recognize the Glycine cleavage system H proteins.
Probab=99.78  E-value=5.9e-19  Score=146.50  Aligned_cols=73  Identities=36%  Similarity=0.725  Sum_probs=70.0

Q ss_pred             EEEECCCCCCCEEEEEEEEEEECCCCEECCCCEEEEEECCCCEEEEECCCCCEEEEEEECCCCCEEECCCEEEEE
Q ss_conf             478678878872179999998168978527985999952653124536878689999924886040358559999
Q gi|254780674|r    4 HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNI   78 (423)
Q Consensus         4 ~~i~mP~lGe~m~egtI~~Wl~k~GD~V~~gd~l~eVETDKa~~ev~S~~~G~l~~i~v~eG~e~v~VG~~i~~i   78 (423)
T Consensus         1 tei~~P~lG~~~~~~~-~~w~v~~Gd~V~~g~~l~~iEt~K~~~~v~a~~~G~i~~i~v~~G-~~V~~G~~l~~I   73 (73)
T pfam00364         1 TEIKSPMIGESVKEGT-AEWLVKVGDKVKAGQVLCEVEAMKMEMEIPAPVAGVVKEILVKEG-DTVEVGDPLAKI   73 (73)
T ss_pred             CCEECCCCCCCCEECC-EEEEECCCCEECCCCEEEEEEECCCCCEECCCCCEEEEEEEECCC-CEECCCCEEEEC
T ss_conf             9347789879737234-848658989992899899999665352250898889999997998-998999999979