HHsearch alignment for GI: 254780674 and conserved domain: pfam02817

>pfam02817 E3_binding e3 binding domain. This family represents a small domain of the E2 subunit of 2-oxo-acid dehydrogenases responsible for the binding of the E3 subunit.
Probab=98.91  E-value=2e-10  Score=89.52  Aligned_cols=39  Identities=56%  Similarity=0.897  Sum_probs=36.4

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCHHHH
Q ss_conf             222234322101111000001101234433222100244
Q gi|254780674|r  118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIET  156 (423)
Q Consensus       118 ~~~~aSP~aRklA~e~giDl~~V~GTG~~GRItk~DV~~  156 (423)
T Consensus         1 g~i~asP~arkla~e~gidl~~i~GTG~~GrI~k~Dv~a   39 (39)
T pfam02817         1 GRVFASPAARKLAAEKGIDLSQVKGTGPGGRITKEDVLA   39 (39)
T ss_pred             CCCCCCHHHHHHHHHCCCCHHHCCCCCCCCCEEHHHHCC
T ss_conf             973248999999999099886767769998584865059