HHsearch results for GI: 254780674 and protein with PDBid: 1dpb_A

>1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A
Probab=100.00  E-value=0  Score=536.25  Aligned_cols=232  Identities=27%  Similarity=0.463  Sum_probs=221.8

Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             34566246551112211011100012321000001222332046787775665554320146655432221011100110
Q gi|254780674|r  188 FAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMI  267 (423)
Q Consensus       188 ~~~~~~~~vp~s~irk~ia~~m~~S~~~iPh~~~~~evd~t~l~~~R~~l~~~~~~~~~~~~~kit~~~~l~kA~a~AL~  267 (423)
                      ...+..+++|+++|||+||++|++||+++||||++.|+|+++|+++|++++...    ++.+.|+|+++||+||++.||+
T Consensus        10 ~~~g~~e~v~ls~~rk~ia~~m~~S~~~iPh~~~~~evd~t~l~~~r~~l~~~~----~~~~~klt~~~~likA~a~aL~   85 (243)
T 1dpb_A           10 AKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVA----EKAGVKLTVLPLLLKACAYLLK   85 (243)
T ss_dssp             GGSSCCCCCCCCHHHHHHHHHHHHHHHHSCEEEEEEEEECHHHHHHHHHTHHHH----HHTTCCCCSHHHHHHHHHHHHH
T ss_pred             CCCCCCEEEECCHHHHHHHHHHHHHHHCCCEEEEEEEEECHHHHHHHHHHHHCC----CCCCCCCCHHHHHHHHHHHHHH
T ss_conf             358971798883999999999998720698799999997556899876542001----1358634389999999999986


Q ss_pred             HCCCCCCCCCCC--CCEECCCCCCCEEEEECCCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEC
Q ss_conf             000000011234--410125566541565146420203414554798999998766654310233461003772389851
Q gi|254780674|r  268 QVPEANVSWTTN--AMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN  345 (423)
Q Consensus       268 ~~P~~Na~~~~~--~i~~~~~vnIgiAv~~~~GL~vPvIk~ad~~~l~~i~~~~~~l~~~ar~~~l~~~d~~ggtftiSN  345 (423)
                      +||.+|++|+++  .+.+++++||||||++++||+||||||||++|+.+|++++++|++|||+|+|+++|++||||||||
T Consensus        86 ~~P~~Na~~~~~~~~~~~~~~inigiAv~~~~GL~vPVIk~a~~~sl~eia~~i~~l~~~ar~~~l~~~d~~ggTfTisN  165 (243)
T 1dpb_A           86 ELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISS  165 (243)
T ss_dssp             HSGGGGEEECTTSSCEEECSSCCEEECEEETTEEECCEETTGGGSCHHHHHHHHHHHHHHHHTTCCCGGGGSCCSEEEEE
T ss_pred             HCHHHHCEECCCCCEEEEECCEEEEEECCCCCCCCCCEECCHHHCCHHHHHHHHHHHHHHHHCCCCCHHHCCCCEEEEEC
T ss_conf             48463231758998999963445774023678840564756222799999999999999987389885442895697445


Q ss_pred             CCCCCCCCCCCCCCCCCEEEEEECCCEEEEEEECCEEEEEEEEEEEEEEEECEEEHHHHHHHHHHHHHHHCCHHHHHC
Q ss_conf             532142210131158871689844631235877893789548898985200114028899999999998719889719
Q gi|254780674|r  346 MGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM  423 (423)
Q Consensus       346 lG~~g~~~~~pii~~pq~aILgvG~~~~~~~~~~~~i~~~~~~~ltls~DHRvidGa~aa~Fl~~~~~~le~P~~ll~  423 (423)
                      +|+||+.+|+|||||||+||||+|+++++|++++|++++|++|+||||||||+|||++||+||++|+++||||++|||
T Consensus       166 lG~~G~~~~tpiInppq~aILgvG~i~~~pv~~~g~i~~r~~m~ltls~DHRvidGa~aa~FL~~l~~~lE~P~~lll  243 (243)
T 1dpb_A          166 LGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDCRVINGAAAARFTKRLGDLLADIRAILL  243 (243)
T ss_dssp             CTTTCCSCCCCCCCTTSSEEEEECCCEEEEEECSSSEEEEEEEEEEEEEETTTSCHHHHHHHHHHHHHHHHCGGGGGC
T ss_pred             CCCCCCEEEEEEECCCCCEEEECCCCEEEEEEECCEEEEEEEEEEEEEEECCHHCHHHHHHHHHHHHHHHHCHHHHHC
T ss_conf             888763368841218862021126747888998999899889999998164040589999999999999869997759