HHsearch results for GI: 254780674 and protein with PDBid: 1w85_I

>1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C*
Probab=99.11  E-value=8.4e-12  Score=97.20  Aligned_cols=46  Identities=35%  Similarity=0.692  Sum_probs=42.3

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHC
Q ss_conf             2222223432210111100000110123443322210024443200
Q gi|254780674|r  116 SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTK  161 (423)
Q Consensus       116 ~~~~~~aSP~aRklA~e~giDl~~V~GTG~~GRItk~DV~~~~~~~  161 (423)
                      ++.++++||+||++|+|+||||++|.|||++|||+|+||++|+++.
T Consensus         3 p~~~v~asP~arkla~e~gidl~~i~GTG~~GrItk~Dv~~~~~~~   48 (49)
T 1w85_I            3 PNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAGG   48 (49)
T ss_dssp             ---CCCCCHHHHHHHHHTTCCTTTSCCCSGGGCCCHHHHHHHHCC-
T ss_pred             CCCCEECCHHHHHHHHHCCCCHHHCCCCCCCCCEEHHHHHHHHHCC
T ss_conf             9986101999999999949988887566999948199999999756