HHsearch results for GI: 254780674 and protein with PDBid: 1zko_A

>1zko_A Glycine cleavage system H protein; TM0212, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A
Probab=97.25  E-value=0.00036  Score=46.19  Aligned_cols=44  Identities=20%  Similarity=0.294  Sum_probs=37.4

Q ss_pred             EEEEEEECCCCEECCCCEEEEEECCCCEEEEECCCCCEEEEEEEC
Q ss_conf             999998168978527985999952653124536878689999924
Q gi|254780674|r   19 KLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP   63 (423)
Q Consensus        19 tI~~Wl~k~GD~V~~gd~l~eVETDKa~~ev~S~~~G~l~~i~v~   63 (423)
                      .-++ +.++|+.|++|++++.||+.|++.++-||++|+|.++--.
T Consensus        48 ~~v~-lp~~G~~v~~g~~~~~iEs~K~~~~i~sPvsG~Vv~vN~~   91 (136)
T 1zko_A           48 VYVD-LPEVGREVKKGEVVASIESVKAAADVYAPLSGKIVEVNEK   91 (136)
T ss_dssp             EEEE-CCCTTCEECTTCEEEEEEESSCEEEEECSSCEEEEEECGG
T ss_pred             EEEE-CCCCCCEEECCCEEEEEEECCCEEEEECCCCEEEEEEHHH
T ss_conf             7997-7999988655976899998661577750354599986564