HHsearch results for GI: 254780674 and protein with PDBid: 2d5d_A

>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, domain, BCCP, X-RAY diffraction, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii OT3} PDB: 2ejf_C* 2ejg_C* 2evb_A
Probab=99.48  E-value=9.3e-14  Score=110.30  Aligned_cols=60  Identities=28%  Similarity=0.518  Sum_probs=58.5

Q ss_pred             EEEEEEEECCCCEECCCCEEEEEECCCCEEEEECCCCCEEEEEEECCCCCEEECCCEEEEE
Q ss_conf             9999998168978527985999952653124536878689999924886040358559999
Q gi|254780674|r   18 GKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNI   78 (423)
Q Consensus        18 gtI~~Wl~k~GD~V~~gd~l~eVETDKa~~ev~S~~~G~l~~i~v~eG~e~v~VG~~i~~i   78 (423)
                      |+|.+|++++||.|++||+||+|||||+.++++||.+|+|.++++++| |.+.+|++|+.|
T Consensus        14 G~v~~~~v~~Gd~V~~g~~l~~iE~~K~~~~i~ap~~G~I~~i~v~~G-~~V~~G~~L~~I   73 (74)
T 2d5d_A           14 GKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEG-EAVDTGQPLIEL   73 (74)
T ss_dssp             EEEEEECCCTTCEECTTCEEEEEEETTEEEEEECSSSEEEEEECCCTT-CEECTTCEEEEE
T ss_pred             CEEEEEECCCCCEEECCCEEEEEEECCCEEEEECCCCEEEEEEEECCC-CEECCCCEEEEE
T ss_conf             799999948999993898899999356126998799989989994895-998999999993