HHsearch results for GI: 254780674 and protein with PDBid: 2kcc_A

>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens}
Probab=95.52  E-value=0.011  Score=36.31  Aligned_cols=42  Identities=17%  Similarity=0.227  Sum_probs=35.2

Q ss_pred             ECCCCEEEEECCCCCEEEEEEECCCCCEEECCCEEEEEECCCCCC
Q ss_conf             526531245368786899999248860403585599997075421
Q gi|254780674|r   41 ETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNILMDSTEI   85 (423)
Q Consensus        41 ETDKa~~ev~S~~~G~l~~i~v~eG~e~v~VG~~i~~i~~~~~~~   85 (423)
                      |.|.  ..+.||..|+|.+|++++| |.|..|++|+.++..+...
T Consensus         2 e~dp--~~v~ap~~G~i~~~~V~~G-d~V~~G~~l~~iEa~K~~~   43 (84)
T 2kcc_A            2 ENDP--TVLRSPSAGKLTQYTVEDG-GHVEAGSSYAEMEVMKMIM   43 (84)
T ss_dssp             CCCT--TEECCSSSCCEEEESSCTT-EEECTTCEEEEEECSSCEE
T ss_pred             CCCC--CEEECCCCEEEEEEEECCC-CEECCCCEEEEEECCCEEE
T ss_conf             8899--8798898859999995798-9991798699998474478