HHsearch results for GI: 254780674 and protein with PDBid: 3cla_A

>3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A*
Probab=100.00  E-value=7.2e-43  Score=304.98  Aligned_cols=204  Identities=13%  Similarity=0.169  Sum_probs=172.4

Q ss_pred             EEEEECC-CCCCCCCCCCCCCCCCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCC
Q ss_conf             4655111-221101110001232100000122233204678777566555432014665543222101110011000000
Q gi|254780674|r  194 EVIPHDN-IRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEA  272 (423)
Q Consensus       194 ~~vp~s~-irk~ia~~m~~S~~~iPh~~~~~evd~t~l~~~R~~l~~~~~~~~~~~~~kit~~~~l~kA~a~AL~~~P~~  272 (423)
                      +.+.++. .||...+..+.  .+.|||+++.++|+|+|.+++++             .++||+++++||+++||.+||.|
T Consensus         4 ~~id~~~w~Rk~~f~~f~~--~~~P~~~it~~vDvt~l~~~~K~-------------~~~sf~~~~l~a~~~Al~~~p~~   68 (213)
T 3cla_A            4 TKFDVKNWVRREHFEFYRH--RLPCGFSLTSKIDITTLKKSLDD-------------SAYKFYPVMIYLIAQAVNQFDEL   68 (213)
T ss_dssp             EECCCTTCTTHHHHHHHHH--TSCCEEEEEEEEECHHHHHHHHT-------------SSCCHHHHHHHHHHHHHTTCGGG
T ss_pred             EEECCCCCCCHHHHHHHHC--CCCCEEEEEEEEEHHHHHHHHHH-------------CCCCCHHHHHHHHHHHHHHCHHH
T ss_conf             5757566844899999747--99978999989869999999998-------------09985899999999999969586


Q ss_pred             CCCCCCCCCEECCCCCCCEEEEECCCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCC-CCCCCCC-CCEEEEECCCCCC
Q ss_conf             0011234410125566541565146420203414554798999998766654310233-4610037-7238985153214
Q gi|254780674|r  273 NVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRK-LKPEEYQ-GGTTSISNMGMLG  350 (423)
Q Consensus       273 Na~~~~~~i~~~~~vnIgiAv~~~~GL~vPvIk~ad~~~l~~i~~~~~~l~~~ar~~~-l~~~d~~-ggtftiSNlG~~g  350 (423)
                      |++|+++++++++++|+|+||++++||++|+|++++++++.++++++++++++||+++ +.+++.. ++||||||+|.++
T Consensus        69 n~~~~~~~i~~~~~i~igiav~~~~gl~vp~i~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~t~~iS~lg~~~  148 (213)
T 3cla_A           69 RMAIKDDELIVWDSVDPQFTVFHQETETFSALSCPYSSDIDQFMVNYLSVMERYKSDTKLFPQGVTPENHLNISALPWVN  148 (213)
T ss_dssp             SEEEETTEEEEESCCEEEEEEEETTTTEEEEEECCCCSSHHHHHHHHHHHHHHHTTCCSSSTTSSCCSSEEEEEEETTCC
T ss_pred             HEEEECCEEEECCCCCEEEEEECCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCC
T ss_conf             46985998888377475999984898288469348879999999999999999973678886545789889977776756


Q ss_pred             CCCCCCCCCCCC---EEEEEECCCEEEEEEECCEEEEEEEEEEEEEEEECEEEHHHHHHHHHHHHHHHCCHHH
Q ss_conf             221013115887---1689844631235877893789548898985200114028899999999998719889
Q gi|254780674|r  351 INSFCAVINPPQ---STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW  420 (423)
Q Consensus       351 ~~~~~pii~~pq---~aILgvG~~~~~~~~~~~~i~~~~~~~ltls~DHRvidGa~aa~Fl~~~~~~le~P~~  420 (423)
                      .+.+++.++.++   ..|++.|++..    .++    |.+|++||+||||++||+++|+|++.|+++||||.+
T Consensus       149 ft~i~~~~~~~~~~~~Pii~~Gk~~~----~~~----r~~m~lsl~~dHrvvDG~~~a~Fl~~lk~~le~p~k  213 (213)
T 3cla_A          149 FDSFNLNVANFTDYFAPIITMAKYQQ----EGD----RLLLPLSVQVHHAVCDGFHVARFINRLQELCNSKLK  213 (213)
T ss_dssp             CSCCCCCCSCCTTCCSCEEEEECCEE----ETT----EEEEEEEEEEETTTCCHHHHHHHHHHHHHHHTSCCC
T ss_pred             CCCCCCCCCCCCCCEECEEECCCCEE----ECC----EEEEEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             44403577777323427794367488----889----899999999623011729999999999999758379