HHsearch results for GI: 254780674 and protein with PDBid: 3hgb_A

>3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A
Probab=97.27  E-value=0.00033  Score=46.43  Aligned_cols=42  Identities=17%  Similarity=0.374  Sum_probs=36.9

Q ss_pred             EEEEEEECCCCEECCCCEEEEEECCCCEEEEECCCCCEEEEEE
Q ss_conf             9999981689785279859999526531245368786899999
Q gi|254780674|r   19 KLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL   61 (423)
Q Consensus        19 tI~~Wl~k~GD~V~~gd~l~eVETDKa~~ev~S~~~G~l~~i~   61 (423)
                      .-++ +..+|+.|++||+++.||+.|++.++.||.+|+|.++-
T Consensus        62 ~~v~-lp~~g~~v~~gd~~~~vEs~K~~~~i~sPvsG~Vv~vN  103 (155)
T 3hgb_A           62 VFVQ-LPVIGTAVTAGETFGEVESTKSVSDLYAPISGKVSEVN  103 (155)
T ss_dssp             EEEE-CCCTTCEECTTCEEEEEEESSCEEEEECSSSEEEEEEC
T ss_pred             EEEE-ECCCCCEEECCCEEEEEEECCEEECCCCCCCCEEEEEC
T ss_conf             9998-15799676079768999983402010278363578852