BLAST/PSIBLAST alignment of GI: 254780674 and GI: 15965200 at iteration 1
>gi|15965200|ref|NP_385553.1| dihydrolipoamide S-acetyltransferase protein [Sinorhizobium meliloti 1021] Length = 447
>gi|307309214|ref|ZP_07588885.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase [Sinorhizobium meliloti BL225C] Length = 447
>gi|8474223|sp|Q9R9N3|ODP2_RHIME RecName: Full=Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex; AltName: Full=Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; AltName: Full=E2 Length = 447
>gi|6164936|gb|AAF04589.1|AF190792_3 dihydrolipoamide acetyltransferase [Sinorhizobium meliloti] Length = 447
>gi|15074380|emb|CAC46026.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [Sinorhizobium meliloti 1021] Length = 447
>gi|306900360|gb|EFN30976.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase [Sinorhizobium meliloti BL225C] Length = 447
 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 221/443 (49%), Positives = 296/443 (66%), Gaps = 25/443 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG LAKW+ +EGDK+  GD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTEIP---------------PSPPLSKENIVEVREEHSHSSPVV 110
           TE + VN+ I  +  +  ++                P P  + E         + +    
Sbjct: 65  TEGVKVNALIAVLAAEGEDVATAAKGGNGAAGAVPAPKPKETAETAPAAAPAPAAAPAPQ 124

Query: 111 VREKHSK-------NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
                S         R  +SPLARRLA E GIDLS+++GSGPHGR+VK D+ET +S    
Sbjct: 125 AAAPASPAPADGEGKRIFSSPLARRLAKEAGIDLSAIAGSGPHGRVVKKDVETAVSGGAA 184

Query: 164 VKDYSTIQSFG---LVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
               +   +     L     +  +L LF   SYE++PHD +RKTIA RL +SKQTIPHFY
Sbjct: 185 KPAGAPAAAPAPATLAKGMSEDAVLKLFEPGSYELVPHDGMRKTIAKRLVESKQTIPHFY 244

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           VS+DC +D L++LR Q+N        +   K+SVND+++KA ALA+  VP+ANVSWT   
Sbjct: 245 VSVDCELDALMALRAQLNAAAPEKDGKPVYKLSVNDMVIKALALALRDVPDANVSWTDQN 304

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           M++HKH D+ VAVSIPGG++TPI+RQA+ KS+  IS E+K L +RAK+RKLKPEEYQGGT
Sbjct: 305 MVKHKHADVGVAVSIPGGLITPIVRQAELKSLSAISNEMKDLGKRAKERKLKPEEYQGGT 364

Que