BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780674|ref|YP_003065087.1| pyruvate dehydrogenase complex
dihydrolipoamide acetyltransferase [Candidatus Liberibacter asiaticus
str. psy62]
         (423 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780674|ref|YP_003065087.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040351|gb|ACT57147.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 423

 Score =  864 bits (2233), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/423 (100%), Positives = 423/423 (100%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI
Sbjct: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP
Sbjct: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI
Sbjct: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
           DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT
Sbjct: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
           LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV
Sbjct: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP
Sbjct: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW
Sbjct: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420

Query: 421 MLM 423
           MLM
Sbjct: 421 MLM 423


>gi|315122215|ref|YP_004062704.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495617|gb|ADR52216.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 428

 Score =  620 bits (1598), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 310/428 (72%), Positives = 359/428 (83%), Gaps = 6/428 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           MI+TITMPSLSPTM  GKLAKW+ ++GDKI PGDI+CEIETDKAIMEFESVDEG++ EIL
Sbjct: 1   MINTITMPSLSPTMKTGKLAKWLVKKGDKIYPGDIICEIETDKAIMEFESVDEGVVHEIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHS--SPVVVREKH--SK 117
              GTENI VNSPILNIL+D     P+P L ++N VE+ +E S    S     EK    +
Sbjct: 61  TSEGTENIKVNSPILNILIDCDGGAPAPILPEKNFVEIEKESSDPAISSFAPTEKKVCGQ 120

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGL-- 175
           + P +SPLARRLA E+GIDLSS+SGSGP GRIVK+DIE LI   T VK  ST QS  +  
Sbjct: 121 DFPASSPLARRLAKENGIDLSSVSGSGPRGRIVKNDIEQLILHNTGVKHASTAQSASIES 180

Query: 176 VDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLRE 235
           ++ S+D +I+ LFA +SYE+IPHDN+RKTIA RLQQSKQTIPHFYVSIDCNIDNLLSLR+
Sbjct: 181 MNSSVDDDIMRLFAPNSYEIIPHDNMRKTIASRLQQSKQTIPHFYVSIDCNIDNLLSLRQ 240

Query: 236 QMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSI 295
           QMN   Q +++E  NKISVND+ILKAF+LAM+QVPEANVSWTTNA+IRHK+IDISVAVSI
Sbjct: 241 QMNLFAQSNKKENINKISVNDVILKAFSLAMLQVPEANVSWTTNALIRHKNIDISVAVSI 300

Query: 296 PGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFC 355
           PGG+VTPI+RQ ++KSI DISLEVKQL QRAKQRKLKP+EYQGGTTS+SNMGM GI++FC
Sbjct: 301 PGGLVTPIVRQVNKKSISDISLEVKQLVQRAKQRKLKPQEYQGGTTSVSNMGMFGISNFC 360

Query: 356 AVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYI 415
           AVINPPQSTILAIGAG +K +FQN  IKV TIMNATLSADHRSVDGA+ASKLLAKFKEYI
Sbjct: 361 AVINPPQSTILAIGAGVQKPIFQNGAIKVVTIMNATLSADHRSVDGAVASKLLAKFKEYI 420

Query: 416 ENPVWMLM 423
           ENP WML+
Sbjct: 421 ENPAWMLL 428


>gi|222148558|ref|YP_002549515.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Agrobacterium vitis S4]
 gi|221735544|gb|ACM36507.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Agrobacterium vitis S4]
          Length = 444

 Score =  448 bits (1153), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 220/444 (49%), Positives = 300/444 (67%), Gaps = 30/444 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG LAKW+ +EGD +  GD++ EIETDKA ME E+VDEG++ +I+V AG
Sbjct: 5   ITMPALSPTMEEGNLAKWLVKEGDTVKSGDVIAEIETDKATMEVEAVDEGVVAKIVVAAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSP----------------- 108
           TE + VN+ I  +  +  ++  +      +     E     +P                 
Sbjct: 65  TEGVKVNALIAILAAEGEDVSAAAAGGGASAPAKAEAPKGEAPKAETPAAKADAPAAAPQ 124

Query: 109 VVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYS 168
                  S +R  +SPLARRLA E G+DL ++SG+GP GR+VKSD+E  +ST       +
Sbjct: 125 AAAPAAASGDRVFSSPLARRLAKEAGLDLKAISGTGPKGRVVKSDVEKAVSTGGAKPAAA 184

Query: 169 T---------IQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
                     + + G+ D+++    L LFA+ SYE++PHD +RKTIA RLQ+SKQTIPHF
Sbjct: 185 PAASGAAPAPVLAKGMSDDAV----LKLFAEGSYELVPHDGMRKTIAKRLQESKQTIPHF 240

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN 279
           YVS+DC +D LL+LR Q+N        +   K+SVND+++KA ALA+  VP+ANVSWT  
Sbjct: 241 YVSVDCELDALLALRAQLNTAAPEKDGKPVYKLSVNDMVIKAMALALRDVPDANVSWTDT 300

Query: 280 AMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
            M++HKH D+ VAVSIPGG++TPIIRQA+ KS+  IS E+K L  RAK RKLKPEEYQGG
Sbjct: 301 NMVKHKHADVGVAVSIPGGLITPIIRQAELKSLSAISNEMKDLGARAKSRKLKPEEYQGG 360

Query: 340 TTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSV 399
           TT++SNMGM+G+ +F AV+NPP +TILA+GAGE++VV +  E+K+A +M  TLS DHR+V
Sbjct: 361 TTAVSNMGMMGVKNFAAVVNPPHATILAVGAGEERVVVKKGEMKIANVMTVTLSTDHRAV 420

Query: 400 DGAIASKLLAKFKEYIENPVWMLM 423
           DGA+ ++LL  FK YIENP+ ML+
Sbjct: 421 DGALGAELLGAFKRYIENPMGMLV 444


>gi|325292762|ref|YP_004278626.1| dihydrolipoamide acetyltransferase [Agrobacterium sp. H13-3]
 gi|325060615|gb|ADY64306.1| dihydrolipoamide acetyltransferase [Agrobacterium sp. H13-3]
          Length = 456

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 225/454 (49%), Positives = 307/454 (67%), Gaps = 38/454 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG LAKW+ +EGDK++PGD++ EIETDKA ME E+VDEG + +++VPAG
Sbjct: 5   ITMPALSPTMEEGNLAKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKLVVPAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPP------------------------LSKENIVEVRE 101
           TE + VN+ I  +  D  ++  +                            KE  V  + 
Sbjct: 65  TEAVKVNALIAILAADGEDVAEAAKGGNAAPAASQAKAEAPKQEAAKAEAPKEEAVPAKA 124

Query: 102 EH-------SHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDI 154
           E        + S+P  V +  S  R  ASPLARRLA E G+DL+++SGSGPHGRIVK+D+
Sbjct: 125 EKPAADQASAPSTPAPVAK--SGERIFASPLARRLAKEAGLDLTAVSGSGPHGRIVKTDV 182

Query: 155 ETLISTKTNVKDYSTIQSFGLVDESI-----DANILNLFAKDSYEVIPHDNIRKTIACRL 209
           E   ++       +   S G    ++     +  +L LF   SYE++PHD +RK IA RL
Sbjct: 183 EKAAASGGAKAAPAAAASAGAPAAALAKGPSEEAVLKLFEPGSYELVPHDGMRKVIAKRL 242

Query: 210 QQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQV 269
            +SKQT+PHFYVS+DC +D LL+LR Q+N        + + K+SVND+++KA ALA+  V
Sbjct: 243 VESKQTVPHFYVSVDCELDTLLALRAQLNAAAPEKDGKPAYKLSVNDMVIKALALALRDV 302

Query: 270 PEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQR 329
           P+ANVSWT + M++HKH D+ VAVSIPGG++TPIIR+A++KS+  IS E+K   +RAK+R
Sbjct: 303 PDANVSWTESNMVKHKHSDVGVAVSIPGGLITPIIRKAEEKSLSTISNEMKDYGKRAKER 362

Query: 330 KLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMN 389
           KLKPEEYQGGTT++SNMGM+G+ SF AVINPP +TILA+GAGE++ V +N EIK+A +M 
Sbjct: 363 KLKPEEYQGGTTAVSNMGMMGVKSFSAVINPPHATILAVGAGEQRAVVKNGEIKIANVMT 422

Query: 390 ATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            TLS DHR VDGA+ ++L+  FK YIENP+ ML+
Sbjct: 423 VTLSTDHRCVDGALGAELIGAFKRYIENPMGMLV 456


>gi|254714201|ref|ZP_05176012.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           ceti M644/93/1]
 gi|254717636|ref|ZP_05179447.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           ceti M13/05/1]
 gi|261219475|ref|ZP_05933756.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella ceti M13/05/1]
 gi|261321971|ref|ZP_05961168.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella ceti M644/93/1]
 gi|260924564|gb|EEX91132.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella ceti M13/05/1]
 gi|261294661|gb|EEX98157.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella ceti M644/93/1]
          Length = 420

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 215/422 (50%), Positives = 299/422 (70%), Gaps = 10/422 (2%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK++PGD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASPL 125
           TE + VN+ I  +  +  ++  +           R E    +P V    +   R  ASPL
Sbjct: 65  TEGVKVNALIAVLAEEGEDVAAA--AKGAGAAPARSEQPAVAPAV----NKGERVFASPL 118

Query: 126 ARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANIL 185
           ARR+A + G+D+S++ GSGPHGR+++ D+E  +++       +  +S        D  IL
Sbjct: 119 ARRIAKDAGVDISAVKGSGPHGRVIQRDVEAALASGGAKAVSAQAESAAAPKPMSDDAIL 178

Query: 186 NLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT---LQ 242
            LF   SYEV+PHD +RKTIA RL +SKQT+PHFY++IDC +D LL+LR Q+N     L+
Sbjct: 179 KLFEDGSYEVVPHDGMRKTIARRLVESKQTVPHFYLTIDCELDALLALRSQINAAAPMLK 238

Query: 243 FHREEI-SNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
             + E+ + K+SVND+++KA ALA+  VPEANVSWT   MI+HK  D+ VAVSIPGG++T
Sbjct: 239 TEKGEVPAYKLSVNDMVIKATALALRDVPEANVSWTEGGMIKHKCSDVGVAVSIPGGLIT 298

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI+R A+ K++  IS E+K +A+RA+ RKLKPEEYQGG+TS+SN+GM G+  F A+INPP
Sbjct: 299 PIVRHAESKTLSVISNEMKDMARRARDRKLKPEEYQGGSTSVSNLGMFGVKDFAAIINPP 358

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
            +TI AIGAGE++ V +  EIKVAT+M+ TLS DHR+VDGA+A++L   FK +IENP+ M
Sbjct: 359 HATIFAIGAGEERAVVKKGEIKVATVMSVTLSTDHRAVDGALAAELAQAFKRHIENPMGM 418

Query: 422 LM 423
           L+
Sbjct: 419 LV 420


>gi|15965200|ref|NP_385553.1| dihydrolipoamide S-acetyltransferase protein [Sinorhizobium
           meliloti 1021]
 gi|307309214|ref|ZP_07588885.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Sinorhizobium meliloti BL225C]
 gi|8474223|sp|Q9R9N3|ODP2_RHIME RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component of pyruvate dehydrogenase complex; AltName:
           Full=Dihydrolipoamide acetyltransferase component of
           pyruvate dehydrogenase complex; AltName: Full=E2
 gi|6164936|gb|AAF04589.1|AF190792_3 dihydrolipoamide acetyltransferase [Sinorhizobium meliloti]
 gi|15074380|emb|CAC46026.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Sinorhizobium meliloti 1021]
 gi|306900360|gb|EFN30976.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Sinorhizobium meliloti BL225C]
          Length = 447

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 221/443 (49%), Positives = 296/443 (66%), Gaps = 25/443 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG LAKW+ +EGDK+  GD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTEIP---------------PSPPLSKENIVEVREEHSHSSPVV 110
           TE + VN+ I  +  +  ++                P P  + E         + +    
Sbjct: 65  TEGVKVNALIAVLAAEGEDVATAAKGGNGAAGAVPAPKPKETAETAPAAAPAPAAAPAPQ 124

Query: 111 VREKHSK-------NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
                S         R  +SPLARRLA E GIDLS+++GSGPHGR+VK D+ET +S    
Sbjct: 125 AAAPASPAPADGEGKRIFSSPLARRLAKEAGIDLSAIAGSGPHGRVVKKDVETAVSGGAA 184

Query: 164 VKDYSTIQSFG---LVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
               +   +     L     +  +L LF   SYE++PHD +RKTIA RL +SKQTIPHFY
Sbjct: 185 KPAGAPAAAPAPATLAKGMSEDAVLKLFEPGSYELVPHDGMRKTIAKRLVESKQTIPHFY 244

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           VS+DC +D L++LR Q+N        +   K+SVND+++KA ALA+  VP+ANVSWT   
Sbjct: 245 VSVDCELDALMALRAQLNAAAPEKDGKPVYKLSVNDMVIKALALALRDVPDANVSWTDQN 304

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           M++HKH D+ VAVSIPGG++TPI+RQA+ KS+  IS E+K L +RAK+RKLKPEEYQGGT
Sbjct: 305 MVKHKHADVGVAVSIPGGLITPIVRQAELKSLSAISNEMKDLGKRAKERKLKPEEYQGGT 364

Query: 341 TSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVD 400
           T++SNMGM+G+  F AV+NPP +TILA+GAGE +VV +N+E+ +A +M  TLS DHR VD
Sbjct: 365 TAVSNMGMMGVKDFAAVVNPPHATILAVGAGEDRVVVRNKEMVIANVMTVTLSTDHRCVD 424

Query: 401 GAIASKLLAKFKEYIENPVWMLM 423
           GA+ ++LLA FK YIENP+ ML+
Sbjct: 425 GALGAELLAAFKRYIENPMGMLV 447


>gi|110633980|ref|YP_674188.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Mesorhizobium sp. BNC1]
 gi|110284964|gb|ABG63023.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Chelativorans sp. BNC1]
          Length = 452

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 224/449 (49%), Positives = 300/449 (66%), Gaps = 32/449 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG LAKW+ +EGD +SPGD++ EIETDKA ME E+VDEG + +I+VP G
Sbjct: 5   ITMPALSPTMEEGNLAKWLVKEGDSVSPGDVIAEIETDKATMEVEAVDEGTVAKIVVPEG 64

Query: 66  TENIAVNSPILNILMDSTE----------------IPPSPPLSKENI----------VEV 99
           T+ + VN+ ++ IL    E                 P   P +K              E 
Sbjct: 65  TQGVKVNA-LIAILAGEGEDAAQAAKASGNGGAAAAPEPKPEAKPEATPSASKQPEEAEN 123

Query: 100 REEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
           R   +              R  ASPLARR+A + GIDLS++SGSGP GR+V++D+E  IS
Sbjct: 124 RPAPAAKPAAPQPSADKDGRVFASPLARRIAKDAGIDLSAISGSGPRGRVVRADVEAAIS 183

Query: 160 TKTNVKDYSTIQSFGLVDESI-DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPH 218
             T     +  +      + + D  +L LF + SYE++PHD +RKTIA RL ++K TIPH
Sbjct: 184 GGTAKPAAAAPEGPAPAPKPMSDEAVLKLFEEGSYELVPHDGMRKTIARRLVEAKSTIPH 243

Query: 219 FYVSIDCNIDNLLSLREQMNRTLQFHREEISN----KISVNDIILKAFALAMIQVPEANV 274
           FY+++DC ID LL+LR+Q+N      + E       K+SVND+I+KA+ALA+  VPEAN 
Sbjct: 244 FYLTLDCEIDALLALRKQLNDAAPMVKAEAGEKPAYKLSVNDLIIKAWALALKAVPEANA 303

Query: 275 SWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPE 334
           SWT +AMI+HKH D+ VAVSIPGG++TPI+++AD+K++  IS E+K LA RA+ RKLKPE
Sbjct: 304 SWTESAMIKHKHADVGVAVSIPGGLITPIVKRADEKTLSVISNEMKDLAARARNRKLKPE 363

Query: 335 EYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSA 394
           EYQGGT++ISN+GM GI  F AVINPP +TILAIGAGE++ V +N EIK+AT+M+ TLS 
Sbjct: 364 EYQGGTSAISNLGMFGIKDFAAVINPPHATILAIGAGEERPVVRNGEIKIATVMSVTLST 423

Query: 395 DHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           DHR+VDGA+ ++LL  FK  IENP  ML+
Sbjct: 424 DHRAVDGALGAELLTAFKRLIENPFGMLV 452


>gi|319783390|ref|YP_004142866.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169278|gb|ADV12816.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 471

 Score =  438 bits (1127), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 223/476 (46%), Positives = 309/476 (64%), Gaps = 67/476 (14%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK+SPGD++ EIETDKA ME E+VDEG + +++VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVSPGDVIAEIETDKATMEVEAVDEGTVAKLVVPAG 64

Query: 66  TENIAVNS--------------------------------------PILNILMDSTE--- 84
           TE + VN+                                      P+  +   STE   
Sbjct: 65  TEGVKVNALIAVLAAEGEDAGAAAKSGGDAAPAKAEAKQDKAPVPPPVGEMSTKSTEGGA 124

Query: 85  IPPS-----PPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSS 139
           +PPS     PP     I   R E S S          + R  ASPLARR+A E G+D+S+
Sbjct: 125 VPPSSQRETPPSGLPAISPTRGEISQSP---------EGRTFASPLARRIAKEAGVDVSA 175

Query: 140 LSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI--------DANILNLFAKD 191
           ++G+GPHGR+VK+D++  I+        +     G+   +         D  +L LF + 
Sbjct: 176 VTGTGPHGRVVKADVDAAIAGGGAQAAPAAKAPAGVPAAAPAAPVKAMSDDQVLKLFEQG 235

Query: 192 SYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISN- 250
           SY+++PHDN+RKTIA RL ++K TIPHFY+++DC +D LL+LR Q+N      + +  + 
Sbjct: 236 SYDLVPHDNMRKTIARRLVEAKTTIPHFYLTLDCELDALLALRTQINAAAPVKKTDKGDA 295

Query: 251 ---KISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQA 307
              K+SVND+++KA A+A+  VP+AN SWT +AM++HKH D+ VAVSIPGG++TPIIR+A
Sbjct: 296 PAYKLSVNDMVIKAMAMALKAVPDANASWTESAMVKHKHADVGVAVSIPGGLITPIIRKA 355

Query: 308 DQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILA 367
           D+K++  IS E+K LA RA+ RKLKPEEYQGGTT++SN+GM GI  F AVINPP +TILA
Sbjct: 356 DEKTLSTISNEMKDLASRARSRKLKPEEYQGGTTAVSNLGMFGIKDFAAVINPPHATILA 415

Query: 368 IGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           +GAGE++ V +N EIK+AT+M+ TLS DHR+VDGA+ ++LL  FK  IENP+ ML+
Sbjct: 416 VGAGEERAVVKNGEIKIATVMSVTLSTDHRAVDGALGAELLVAFKRLIENPMGMLV 471


>gi|227821849|ref|YP_002825819.1| dihydrolipoyllysine-residue acetyltransferase component of
           pyruvatedehydrogenase complex [Sinorhizobium fredii
           NGR234]
 gi|227340848|gb|ACP25066.1| dihydrolipoyllysine-residue acetyltransferase component of
           pyruvatedehydrogenase complex [Sinorhizobium fredii
           NGR234]
          Length = 447

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 218/450 (48%), Positives = 299/450 (66%), Gaps = 39/450 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG LAKW+ +EGDK+  GD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKEN-----------------------IVEVREE 102
           TE + VN+ I  +  D  ++  +   +K N                              
Sbjct: 65  TEGVKVNALIAVLAADGEDVATA---AKGNGAAAPASAAKAEAPAPAAPAAAPAPAAAPT 121

Query: 103 HSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKT 162
              ++           R  +SPLARRLA E GIDLS+++G+GP+GR+VK D+E+ +S   
Sbjct: 122 APAAASAPAAAGGDGKRVFSSPLARRLAKEAGIDLSAVAGTGPYGRVVKKDVESAVSGGA 181

Query: 163 NVKDYSTIQSF---------GLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSK 213
                +   +          G+ ++++    L LF   SYE++PHD +RKTIA RLQ+SK
Sbjct: 182 AKPAAAPAAAQAPAAAPLAKGMSEDAV----LKLFEPGSYELVPHDGMRKTIAKRLQESK 237

Query: 214 QTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEAN 273
           QTIPHFYVS+DC +D LL+LR Q+N        +   K+SVND+++KA ALA+  VP+AN
Sbjct: 238 QTIPHFYVSLDCQLDALLALRAQLNAAAPEKDGKPVYKLSVNDMVIKALALALRDVPDAN 297

Query: 274 VSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKP 333
           VSWT   M++HKH D+ VAVSIPGG++TPIIRQA+ KS+  IS E+K   +RAK+RKLKP
Sbjct: 298 VSWTDTNMVKHKHADVGVAVSIPGGLITPIIRQAELKSLSAISNEMKDYGKRAKERKLKP 357

Query: 334 EEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLS 393
           EEYQGGTT++SNMGM+G+ +F AV+NPP +TILA+GAGE++V+ +N+E+ VA +M  TLS
Sbjct: 358 EEYQGGTTAVSNMGMMGVKNFAAVVNPPHATILAVGAGEERVIVKNKEMVVANMMTVTLS 417

Query: 394 ADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            DHR VDGA+ ++LL  FK YIENP+ ML+
Sbjct: 418 TDHRCVDGALGAELLGAFKRYIENPMGMLV 447


>gi|239832016|ref|ZP_04680345.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Ochrobactrum intermedium LMG 3301]
 gi|239824283|gb|EEQ95851.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Ochrobactrum intermedium LMG 3301]
          Length = 444

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 216/445 (48%), Positives = 303/445 (68%), Gaps = 32/445 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDKI+PGD++ EIETDKA ME E+VDEG I +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKIAPGDVIAEIETDKATMEVEAVDEGTIAKIVVPAG 64

Query: 66  TENIAVNSPILNILMD--------------------STEIPPSPPLSKENIVEVREEHSH 105
           +E + VN+ ++ IL +                      E P   P      V        
Sbjct: 65  SEGVKVNA-LIAILAEEGEDVAAAAKGAASAPKAEAKAETPKEEPKPTAAPVAATAPARA 123

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST---KT 162
             P      +  +R  ASPLARR+A E G+D++++ G+GPHGR+V+ D+E  +++   K 
Sbjct: 124 EQPAAA---NKGDRVFASPLARRIAKESGVDITAVKGTGPHGRVVQRDVEAALASGGVKA 180

Query: 163 NVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVS 222
                  +        S DA +L LF + +YE++PHD +RKTIA RL +SKQT+PHFY++
Sbjct: 181 AAPKAEAVSPAAPKPMSDDA-VLKLFEEGTYEIVPHDGMRKTIARRLVESKQTVPHFYLT 239

Query: 223 IDCNIDNLLSLREQMNRT---LQFHREEI-SNKISVNDIILKAFALAMIQVPEANVSWTT 278
           IDC +D LL+LR Q+N     ++  + E+ + K+SVND+++KA ALA+  +PEANVSWT 
Sbjct: 240 IDCELDALLALRSQINAAAPMIKTEKGEVPAYKLSVNDLVIKAVALALRDIPEANVSWTE 299

Query: 279 NAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQG 338
             M++HK  D+ VAVSIPGG++TPI+RQ++ K++  IS E+K LA+RA+ RKLKPEEYQG
Sbjct: 300 GGMVKHKRADVGVAVSIPGGLITPIVRQSESKTLSAISNEMKDLAKRARDRKLKPEEYQG 359

Query: 339 GTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRS 398
           G+TS+SN+GM G+  F A+INPP +TI AIGAGE++ V +N EIKVAT+M+ TLS DHR+
Sbjct: 360 GSTSVSNLGMFGVKDFAAIINPPHATIFAIGAGEQRAVVKNGEIKVATVMSVTLSTDHRA 419

Query: 399 VDGAIASKLLAKFKEYIENPVWMLM 423
           VDGA+A++L   FK +IENP+ ML+
Sbjct: 420 VDGALAAELAQAFKRHIENPMGMLV 444


>gi|306843992|ref|ZP_07476587.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella sp. BO1]
 gi|306275747|gb|EFM57471.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella sp. BO1]
          Length = 447

 Score =  437 bits (1123), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 216/448 (48%), Positives = 299/448 (66%), Gaps = 35/448 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK++PGD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTE--------------------------IPPSPPLSKENIVEV 99
           TE + VN+ ++ +L +  E                                         
Sbjct: 65  TEGVKVNA-LIAVLAEEGEDVAAAAKGAGAAPKAEAPKEEPKPAEAKKEAAAPAAAPAPA 123

Query: 100 REEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
           R E   ++P      +   R  ASPLARR+A + G+D+S++ GSGPHGR+V+ D+E  ++
Sbjct: 124 RSEQPAAAPAA----NKGERVFASPLARRIAKDAGVDISAVKGSGPHGRVVQRDVEAALA 179

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
           +       +  +S        D  IL LF   SYEV+PHD +RKTIA RL +SKQT+PHF
Sbjct: 180 SGGTKAVSAQAESAAAPKPMSDDAILKLFEDGSYEVVPHDGMRKTIARRLVESKQTVPHF 239

Query: 220 YVSIDCNIDNLLSLREQMNRT---LQFHREEI-SNKISVNDIILKAFALAMIQVPEANVS 275
           Y++IDC +D LL+LR Q+N     L+  + E+ + K+SVND+++KA ALA+  VPEANVS
Sbjct: 240 YLTIDCELDALLALRSQINAAAPMLKTEKGEVPAYKLSVNDMVIKATALALRDVPEANVS 299

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           WT   MI+HK  D+ VAVSIPGG++TPI+R A+ K++  IS E+K +A+RA+ RKLKPEE
Sbjct: 300 WTEGGMIKHKRSDVGVAVSIPGGLITPIVRHAESKTLSAISNEMKDMARRARDRKLKPEE 359

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSAD 395
           YQGG+TS+SN+GM G+  F A+INPP +TI AIGAGE++ V +  EIKVAT+M+ TLS D
Sbjct: 360 YQGGSTSVSNLGMFGVKDFAAIINPPHATIFAIGAGEERAVVKKGEIKVATVMSVTLSTD 419

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR+VDGA+A++L   FK +IENP+ ML+
Sbjct: 420 HRAVDGALAAELAQAFKRHIENPMGMLV 447


>gi|306841853|ref|ZP_07474535.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella sp. BO2]
 gi|306288080|gb|EFM59477.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella sp. BO2]
          Length = 447

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 216/448 (48%), Positives = 299/448 (66%), Gaps = 35/448 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK++PGD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTE--------------------------IPPSPPLSKENIVEV 99
           TE + VN+ ++ +L +  E                                         
Sbjct: 65  TEGVKVNA-LIAVLAEEGEDVAAAAKGAGAAPKAEAPKEEPKPAEAKKEAAAPAAAPAPA 123

Query: 100 REEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
           R E   ++P      +   R  ASPLARR+A + G+D+S++ GSGPHGR+V+ D+E  ++
Sbjct: 124 RSEQPAAAPAA----NKGERVFASPLARRIAKDAGVDISAVKGSGPHGRVVQRDVEAALA 179

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
           +       +  +S        D  IL LF   SYEV+PHD +RKTIA RL +SKQT+PHF
Sbjct: 180 SGGAKAVSAQAESAAAPKPMSDDAILKLFEDGSYEVVPHDGMRKTIARRLVESKQTVPHF 239

Query: 220 YVSIDCNIDNLLSLREQMNRT---LQFHREEI-SNKISVNDIILKAFALAMIQVPEANVS 275
           Y++IDC +D LL+LR Q+N     L+  + E+ + K+SVND+++KA ALA+  VPEANVS
Sbjct: 240 YLTIDCELDALLALRSQINAAAPMLKTEKGEVPAYKLSVNDMVIKATALALRDVPEANVS 299

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           WT   MI+HK  D+ VAVSIPGG++TPI+R A+ K++  IS E+K +A+RA+ RKLKPEE
Sbjct: 300 WTEGGMIKHKRSDVGVAVSIPGGLITPIVRHAESKTLSAISNEMKDMARRARDRKLKPEE 359

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSAD 395
           YQGG+TS+SN+GM G+  F A+INPP +TI AIGAGE++ V +  EIKVAT+M+ TLS D
Sbjct: 360 YQGGSTSVSNLGMFGVKDFAAIINPPHATIFAIGAGEERAVVKKGEIKVATVMSVTLSTD 419

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR+VDGA+A++L   FK +IENP+ ML+
Sbjct: 420 HRAVDGALAAELAQAFKRHIENPMGMLV 447


>gi|86357556|ref|YP_469448.1| dihydrolipoamide acetyltransferase protein [Rhizobium etli CFN 42]
 gi|86281658|gb|ABC90721.1| dihydrolipoamide acetyltransferase protein [Rhizobium etli CFN 42]
          Length = 450

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 217/446 (48%), Positives = 293/446 (65%), Gaps = 28/446 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG LAKW+ +EGDK+  GD++ EIETDKA ME E+VDEG + +++V AG
Sbjct: 5   ITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKLVVAAG 64

Query: 66  TENIAVNSPILNILMDSTEI-------------------PPSPPLSKENIVEVREEHSHS 106
           TE + VN+ I  +  D  ++                    P    +              
Sbjct: 65  TEGVKVNALIAVLAADGEDVAAAASGAGSAAPAKAEAASAPKADAAPAKAEAAPAAAPAP 124

Query: 107 SPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKD 166
           +          NR  +SPLARRLA E GIDLS+++GSGPHGR++KSDIE  ++       
Sbjct: 125 TAAPAAVSAGGNRTFSSPLARRLAKEAGIDLSAVAGSGPHGRVIKSDIEAALAGGAKPAP 184

Query: 167 YSTIQSFGLVDESI---------DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIP 217
                S                 D  +L LF   SYE++PHD +RKTIA RL +SKQTIP
Sbjct: 185 APAAASAPQAVAPAPAAAPKGASDDAVLKLFEPGSYELVPHDGMRKTIARRLVESKQTIP 244

Query: 218 HFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWT 277
           HFYVS+DC +D L++LR Q+N          + K+SVND+++KA ALA+  VP+ANVSWT
Sbjct: 245 HFYVSVDCELDALMALRAQLNDAAPRKENAPAYKLSVNDMVIKAMALALRDVPDANVSWT 304

Query: 278 TNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQ 337
            + M++HKH D+ VAVSIPGG++TPIIR+A+QK++  IS E++ L +RAK RKLKPEEYQ
Sbjct: 305 DSNMVKHKHADVGVAVSIPGGLITPIIRKAEQKTLSAISNEMRDLGKRAKDRKLKPEEYQ 364

Query: 338 GGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHR 397
           GGT+S+SNMGM+G+ +F AV+NPP +TILA+GAGE++VV +N E+ +AT+M+ TLS DHR
Sbjct: 365 GGTSSVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVVVKNGEMAIATVMSVTLSTDHR 424

Query: 398 SVDGAIASKLLAKFKEYIENPVWMLM 423
            VDGA+ ++LL  FK YIENP+ ML+
Sbjct: 425 CVDGALGAELLQAFKGYIENPMGMLV 450


>gi|260459500|ref|ZP_05807755.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Mesorhizobium opportunistum WSM2075]
 gi|259035054|gb|EEW36310.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Mesorhizobium opportunistum WSM2075]
          Length = 473

 Score =  434 bits (1117), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 222/472 (47%), Positives = 307/472 (65%), Gaps = 57/472 (12%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK+SPGD++ EIETDKA ME E+VDEG + +++VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVSPGDVIAEIETDKATMEVEAVDEGTVAKLVVPAG 64

Query: 66  TENIAVNSPILNILMDST----------------------EIPPSPPLSKENIVEVREEH 103
           TE + VN+ ++ +L                          E P SPP+ + +      E 
Sbjct: 65  TEGVKVNA-LIAVLAAEGEDAGAAAKSGGAAAAKAEAKRDEAPISPPVGEMSAKPT--EG 121

Query: 104 SHSSPVVVRE----------------------KHSKNRPIASPLARRLAGEHGIDLSSLS 141
               P   RE                      +  + R  ASPLARR+A E G+D+S+++
Sbjct: 122 GAVPPSSQREAPPPGLPSLPPLGISPTGGEIRQSPEGRTFASPLARRIAKEAGVDVSAVT 181

Query: 142 GSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI------DANILNLFAKDSYEV 195
           G+GPHGR+VK+D++  I+        +     G    +       D  +L LF + SYE+
Sbjct: 182 GTGPHGRVVKADVDAAIAGGGAKAAPAAKAPAGAPAAAPAVKAMSDEQVLKLFEEGSYEL 241

Query: 196 IPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHR----EEISNK 251
           +PHDN+RKTIA RL ++K TIPHFY+++DC +D LL+LR Q+N      +    E  + K
Sbjct: 242 VPHDNMRKTIARRLVEAKTTIPHFYLTLDCELDALLALRTQINAAAPVKKTDKGEAPAYK 301

Query: 252 ISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKS 311
           +SVND+++KA ALA+  VP+AN SWT +AM++HKH D+ VAVSIPGG++TPIIR AD+K+
Sbjct: 302 LSVNDMVIKAMALALKAVPDANASWTESAMVKHKHADVGVAVSIPGGLITPIIRHADEKT 361

Query: 312 ILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAG 371
           +  IS E+K LA RA+ RKLKPEEYQGGTT++SN+GM GI  F AVINPP +TILA+GAG
Sbjct: 362 LSTISNEMKDLASRARSRKLKPEEYQGGTTAVSNLGMFGIKDFAAVINPPHATILAVGAG 421

Query: 372 EKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           E++ V +N EIK+AT+M+ TLS DHR+VDGA+ ++LL  FK  IENP+ ML+
Sbjct: 422 EERAVVKNGEIKIATVMSVTLSTDHRAVDGALGAELLVAFKRLIENPMGMLV 473


>gi|114704547|ref|ZP_01437455.1| dihydrolipoamide acetyltransferase [Fulvimarina pelagi HTCC2506]
 gi|114539332|gb|EAU42452.1| dihydrolipoamide acetyltransferase [Fulvimarina pelagi HTCC2506]
          Length = 479

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 224/479 (46%), Positives = 308/479 (64%), Gaps = 65/479 (13%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           +TMP+LSPTM EG LAKW+  EGD +S GDI+ EIETDKA ME E+VDEG + +ILVP G
Sbjct: 5   VTMPALSPTMEEGNLAKWLIAEGDSVSAGDIIAEIETDKATMEVEAVDEGTLAKILVPGG 64

Query: 66  TENIAVNSPILNILMDSTEIP----------PSP-------------------------- 89
           TE + VN  I  +  +  ++           P+P                          
Sbjct: 65  TEGVKVNDVIAILAAEGEDVEEAAKSGGGSDPAPSGDDKGGAMMANAEADNAAEGSEEDA 124

Query: 90  ----------PLSKENIVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSS 139
                     P       E++E    + P    E    +R  +SPLARRLA E GIDL+ 
Sbjct: 125 KDASKRGYARPEGGIGSGEIKEATESAGPAPKAE--DGDRVFSSPLARRLAKEAGIDLAQ 182

Query: 140 LSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI-----------DANILNLF 188
           + GSGPHGR+VK+D+ET  +T+  V   +         ++            D  IL +F
Sbjct: 183 VKGSGPHGRVVKADVET--ATENGVGKAAAADKPKDAAKADAAPAPAAKGPSDDAILKMF 240

Query: 189 AKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMN----RTLQFH 244
            + SYE IPHD +RKTIA RL +SKQT+PHFY+S+DC +D LL+LR+Q+N    +T    
Sbjct: 241 EEGSYEKIPHDGMRKTIAKRLVESKQTVPHFYLSVDCELDALLALRKQLNDAAPKTKSDD 300

Query: 245 REEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPII 304
            E+ + K+SVND+++KA ALA+  VP ANVSWT  AM++HKH D+ VAVSI GG++TPII
Sbjct: 301 GEKPAYKLSVNDMVIKAMALALKTVPTANVSWTDTAMLKHKHADVGVAVSIDGGLITPII 360

Query: 305 RQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQST 364
           ++A++K++  IS E+K LA+RA+ RKL+P+EYQGGTT++SN+GM GIN+F AVINPP +T
Sbjct: 361 KRAEEKTLSTISNEMKDLAKRARARKLQPQEYQGGTTAVSNLGMFGINNFSAVINPPHAT 420

Query: 365 ILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           ILA+GAGE++ + +N E+KVAT+M  TLS DHR+VDGA+ ++L+A FK+YIENP+ ML+
Sbjct: 421 ILAVGAGEERAIVKNGEVKVATLMTVTLSTDHRAVDGALGAELIAAFKQYIENPMGMLV 479


>gi|148559087|ref|YP_001259048.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           ovis ATCC 25840]
 gi|148370344|gb|ABQ60323.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella ovis ATCC 25840]
          Length = 447

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 216/448 (48%), Positives = 299/448 (66%), Gaps = 35/448 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK++PGD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTE--------------------------IPPSPPLSKENIVEV 99
           TE + VN+ ++ +L +  E                                         
Sbjct: 65  TEGVKVNA-LIAVLAEEGEDVAAAAKGAGAAPKAEAPKEEPKPAEAKKEAAAPAAAPAPA 123

Query: 100 REEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
           R E    +P V    +   R  ASPLARR+A + G+D+S++ GSGPHGR+++ D+E  ++
Sbjct: 124 RSEQPAVAPAV----NKGERVFASPLARRIAKDAGVDISAVKGSGPHGRVIQCDVEAALA 179

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
           +       +  +S        D  IL LF   SYEV+PHD +RKTIA RL +SKQT+PHF
Sbjct: 180 SGGAKAVSAQAESAAAPKPMSDDAILKLFEDGSYEVVPHDGMRKTIARRLVESKQTVPHF 239

Query: 220 YVSIDCNIDNLLSLREQMNRT---LQFHREEI-SNKISVNDIILKAFALAMIQVPEANVS 275
           Y++IDC +D LL+LR Q+N     L+  + E+ + K+SVND+++KA ALA+  VPEANVS
Sbjct: 240 YLTIDCELDALLALRSQINAAAPMLKTEKGEVPAYKLSVNDMVIKATALALCDVPEANVS 299

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           WT   MI+HK  D+ VAVSIPGG++TPI+R A+ K++  IS E+K +A+RA+ RKLKPEE
Sbjct: 300 WTEGGMIKHKCSDVGVAVSIPGGLITPIVRHAESKTLSVISNEMKDMARRARDRKLKPEE 359

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSAD 395
           YQGG+TS+SN+GM G+  F A+INPP +TI AIGAGE++ V +  EIKVAT+M+ TLS D
Sbjct: 360 YQGGSTSVSNLGMFGVKDFAAIINPPHATIFAIGAGEERAVVKKGEIKVATVMSVTLSTD 419

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR+VDGA+A++L   FK +IENP+ ML+
Sbjct: 420 HRAVDGALAAELAQAFKRHIENPMGMLV 447


>gi|294852465|ref|ZP_06793138.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella sp. NVSL 07-0026]
 gi|294821054|gb|EFG38053.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella sp. NVSL 07-0026]
          Length = 447

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 216/448 (48%), Positives = 299/448 (66%), Gaps = 35/448 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK++PGD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTE--------------------------IPPSPPLSKENIVEV 99
           TE + VN+ ++ +L +  E                                         
Sbjct: 65  TEGVKVNA-LIAVLAEEGEDVAAAAKGAGAAPKAEAPKEEPKPAEAKKEAAAPAAAPAPA 123

Query: 100 REEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
           R E    +P V    +   R  ASPLARR+A + G+D+S++ GSGPHGR+++ D+E  ++
Sbjct: 124 RSEQPAVAPAV----NKGERVFASPLARRIAKDAGVDISAVKGSGPHGRVIQRDVEAALA 179

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
           +       +  +S        D  IL LF   SYEV+PHD +RKTIA RL +SKQT+PHF
Sbjct: 180 SGGAKAVSAQAESAAAPKPMSDDAILKLFEDGSYEVVPHDGMRKTIARRLVESKQTVPHF 239

Query: 220 YVSIDCNIDNLLSLREQMNRT---LQFHREEI-SNKISVNDIILKAFALAMIQVPEANVS 275
           Y++IDC +D LL+LR Q+N     L+  + E+ + K+SVND+++KA ALA+  VPEANVS
Sbjct: 240 YLTIDCELDALLALRSQINAAAPMLKTEKGEVRAYKLSVNDMVIKATALALRDVPEANVS 299

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           WT   MI+HK  D+ VAVSIPGG++TPI+R A+ K++  IS E+K +A+RA+ RKLKPEE
Sbjct: 300 WTEGGMIKHKCSDVGVAVSIPGGLITPIVRHAESKTLSVISNEMKDMARRARDRKLKPEE 359

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSAD 395
           YQGG+TS+SN+GM G+  F A+INPP +TI AIGAGE++ V +  EIKVAT+M+ TLS D
Sbjct: 360 YQGGSTSVSNLGMFGVKDFAAIINPPHATIFAIGAGEERAVVKKGEIKVATVMSVTLSTD 419

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR+VDGA+A++L   FK +IENP+ ML+
Sbjct: 420 HRAVDGALAAELAQAFKRHIENPMGMLV 447


>gi|254693837|ref|ZP_05155665.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           abortus bv. 3 str. Tulya]
 gi|261214121|ref|ZP_05928402.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus bv. 3 str. Tulya]
 gi|260915728|gb|EEX82589.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus bv. 3 str. Tulya]
          Length = 447

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 215/447 (48%), Positives = 301/447 (67%), Gaps = 33/447 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK++PGD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEV-------------------------R 100
           TE + VN+ I  +  +  ++  +   +  +                             R
Sbjct: 65  TEGVKVNALIAVLAEEGEDVAAAAKGAGASPKAEAPKEEPKPAEAKKEAAAPAAAPAPAR 124

Query: 101 EEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST 160
            E    +P V    +   R  ASPLARR+A + G+D+S++ GSGPHGR+++ D+E  +++
Sbjct: 125 SEQPAVAPAV----NKGERVFASPLARRIAKDAGVDISAVKGSGPHGRVIQRDVEAALAS 180

Query: 161 KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
                  +  +S        D  IL LF   SYEV+PHD +RKTIA RL +SKQT+PHFY
Sbjct: 181 GGAKAVSAQAESAAAPKPMSDDAILKLFEDGSYEVVPHDGMRKTIARRLVESKQTVPHFY 240

Query: 221 VSIDCNIDNLLSLREQMNRT---LQFHREEI-SNKISVNDIILKAFALAMIQVPEANVSW 276
           ++IDC +D LL+LR Q+N     L+  + E+ + K+SVND+++KA ALA+  VPEANVSW
Sbjct: 241 LTIDCELDALLALRSQINAAAPMLKTEKGEVPAYKLSVNDMVIKATALALRDVPEANVSW 300

Query: 277 TTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEY 336
           T   MI+HK  D+ VAVSIPGG++TPI+R A+ K++  IS E+K +A+RA+ RKLKPEEY
Sbjct: 301 TEGGMIKHKCSDVGVAVSIPGGLITPIVRHAESKTLSVISNEMKDMARRARDRKLKPEEY 360

Query: 337 QGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADH 396
           QGG+TS+SN+GM G+  F A+INPP +TI AIGAGE++ V +  EIKVAT+M+ TLS DH
Sbjct: 361 QGGSTSVSNLGMFGVKDFAAIINPPHATIFAIGAGEERAVVKKGEIKVATVMSVTLSTDH 420

Query: 397 RSVDGAIASKLLAKFKEYIENPVWMLM 423
           R+VDGA+A++L   FK +IENP+ ML+
Sbjct: 421 RAVDGALAAELAQAFKRHIENPMGMLV 447


>gi|17987139|ref|NP_539773.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           melitensis bv. 1 str. 16M]
 gi|256044784|ref|ZP_05447688.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|260565613|ref|ZP_05836097.1| AceF protein [Brucella melitensis bv. 1 str. 16M]
 gi|265991208|ref|ZP_06103765.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|17982803|gb|AAL52037.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex [Brucella melitensis bv. 1 str.
           16M]
 gi|260151681|gb|EEW86775.1| AceF protein [Brucella melitensis bv. 1 str. 16M]
 gi|263001992|gb|EEZ14567.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella melitensis bv. 1 str. Rev.1]
          Length = 447

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 217/448 (48%), Positives = 301/448 (67%), Gaps = 35/448 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK++PGD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTE-------------IPPSPP-------------LSKENIVEV 99
           TE + VN+ ++ +L +  E                +P                       
Sbjct: 65  TEGVKVNA-LIAVLAEEGEDVAAAAKGAGAAPKAEAPKDEPKPAEAKKEAAAPAAAPAPA 123

Query: 100 REEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
           R E    +P V    +   R  ASPLARR+A + G+D+S++ GSGPHGR+++ D+E  ++
Sbjct: 124 RSEQPAVAPAV----NKGERVFASPLARRIAKDAGVDISAVKGSGPHGRVIQRDVEAALA 179

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
           +       +  +S        D  IL LF   SYEV+PHD +RKTIA RL +SKQT+PHF
Sbjct: 180 SGGAKAVSAQAESAAAPKPMSDDAILKLFEDGSYEVVPHDGMRKTIARRLVESKQTVPHF 239

Query: 220 YVSIDCNIDNLLSLREQMNRT---LQFHREEI-SNKISVNDIILKAFALAMIQVPEANVS 275
           Y++IDC +D LL+LR Q+N     L+  + E+ + K+SVND+++KA ALA+  VPEANVS
Sbjct: 240 YLTIDCELDALLALRSQINAAAPMLKTEKGEVPAYKLSVNDMVIKATALALRDVPEANVS 299

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           WT   MI+HK  D+ VAVSIPGG++TPI+R A+ K++  IS E+K +A+RA+ RKLKPEE
Sbjct: 300 WTEGGMIKHKCSDVGVAVSIPGGLITPIVRHAESKTLSVISNEMKDMARRARDRKLKPEE 359

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSAD 395
           YQGG+TS+SN+GM G+  F A+INPP +TI AIGAGE++ V +  EIKVAT+M+ TLS D
Sbjct: 360 YQGGSTSVSNLGMFGVKDFAAIINPPHATIFAIGAGEERAVVKKGEIKVATVMSVTLSTD 419

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR+VDGA+A++L   FK +IENP+ ML+
Sbjct: 420 HRAVDGALAAELAQAFKRHIENPMGMLV 447


>gi|23502005|ref|NP_698132.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           suis 1330]
 gi|161619079|ref|YP_001592966.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           canis ATCC 23365]
 gi|163843394|ref|YP_001627798.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           suis ATCC 23445]
 gi|254701870|ref|ZP_05163698.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           suis bv. 5 str. 513]
 gi|254704416|ref|ZP_05166244.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           suis bv. 3 str. 686]
 gi|254706688|ref|ZP_05168516.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           pinnipedialis M163/99/10]
 gi|254710204|ref|ZP_05172015.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           pinnipedialis B2/94]
 gi|256031698|ref|ZP_05445312.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           pinnipedialis M292/94/1]
 gi|260566337|ref|ZP_05836807.1| AceF protein [Brucella suis bv. 4 str. 40]
 gi|261314149|ref|ZP_05953346.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella pinnipedialis M163/99/10]
 gi|261317762|ref|ZP_05956959.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella pinnipedialis B2/94]
 gi|261752433|ref|ZP_05996142.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella suis bv. 5 str. 513]
 gi|261755093|ref|ZP_05998802.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella suis bv. 3 str. 686]
 gi|265988793|ref|ZP_06101350.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella pinnipedialis M292/94/1]
 gi|23347956|gb|AAN30047.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Brucella suis 1330]
 gi|161335890|gb|ABX62195.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella canis ATCC 23365]
 gi|163674117|gb|ABY38228.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella suis ATCC 23445]
 gi|260155855|gb|EEW90935.1| AceF protein [Brucella suis bv. 4 str. 40]
 gi|261296985|gb|EEY00482.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella pinnipedialis B2/94]
 gi|261303175|gb|EEY06672.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella pinnipedialis M163/99/10]
 gi|261742186|gb|EEY30112.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella suis bv. 5 str. 513]
 gi|261744846|gb|EEY32772.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella suis bv. 3 str. 686]
 gi|264660990|gb|EEZ31251.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella pinnipedialis M292/94/1]
          Length = 447

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 216/448 (48%), Positives = 299/448 (66%), Gaps = 35/448 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK++PGD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTE--------------------------IPPSPPLSKENIVEV 99
           TE + VN+ ++ +L +  E                                         
Sbjct: 65  TEGVKVNA-LIAVLAEEGEDVAAAAKGAGAAPKAEAPKEEPKPAEAKKEAAAPAAAPAPA 123

Query: 100 REEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
           R E    +P V    +   R  ASPLARR+A + G+D+S++ GSGPHGR+++ D+E  ++
Sbjct: 124 RSEQPAVAPAV----NKGERVFASPLARRIAKDAGVDISAVKGSGPHGRVIQRDVEAALA 179

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
           +       +  +S        D  IL LF   SYEV+PHD +RKTIA RL +SKQT+PHF
Sbjct: 180 SGGAKAVSAQAESAAAPKPMSDDAILKLFEDGSYEVVPHDGMRKTIARRLVESKQTVPHF 239

Query: 220 YVSIDCNIDNLLSLREQMNRT---LQFHREEI-SNKISVNDIILKAFALAMIQVPEANVS 275
           Y++IDC +D LL+LR Q+N     L+  + E+ + K+SVND+++KA ALA+  VPEANVS
Sbjct: 240 YLTIDCELDALLALRSQINAAAPMLKTEKGEVPAYKLSVNDMVIKATALALRDVPEANVS 299

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           WT   MI+HK  D+ VAVSIPGG++TPI+R A+ K++  IS E+K +A+RA+ RKLKPEE
Sbjct: 300 WTEGGMIKHKCSDVGVAVSIPGGLITPIVRHAESKTLSVISNEMKDMARRARDRKLKPEE 359

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSAD 395
           YQGG+TS+SN+GM G+  F A+INPP +TI AIGAGE++ V +  EIKVAT+M+ TLS D
Sbjct: 360 YQGGSTSVSNLGMFGVKDFAAIINPPHATIFAIGAGEERAVVKKGEIKVATVMSVTLSTD 419

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR+VDGA+A++L   FK +IENP+ ML+
Sbjct: 420 HRAVDGALAAELAQAFKRHIENPMGMLV 447


>gi|62290040|ref|YP_221833.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           abortus bv. 1 str. 9-941]
 gi|82699967|ref|YP_414541.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           melitensis biovar Abortus 2308]
 gi|189024281|ref|YP_001935049.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           abortus S19]
 gi|237815550|ref|ZP_04594547.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus str. 2308 A]
 gi|254689353|ref|ZP_05152607.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           abortus bv. 6 str. 870]
 gi|254697486|ref|ZP_05159314.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|254730383|ref|ZP_05188961.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           abortus bv. 4 str. 292]
 gi|256257599|ref|ZP_05463135.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           abortus bv. 9 str. C68]
 gi|260546593|ref|ZP_05822332.1| AceF protein [Brucella abortus NCTC 8038]
 gi|260754870|ref|ZP_05867218.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus bv. 6 str. 870]
 gi|260758087|ref|ZP_05870435.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus bv. 4 str. 292]
 gi|260761911|ref|ZP_05874254.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883882|ref|ZP_05895496.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus bv. 9 str. C68]
 gi|297248441|ref|ZP_06932159.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus bv. 5 str. B3196]
 gi|62196172|gb|AAX74472.1| AceF, pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamide acetyltransferase [Brucella abortus bv.
           1 str. 9-941]
 gi|82616068|emb|CAJ11106.1| Biotin/lipoyl attachment:Antifreeze protein, type I:Catalytic
           domain of components of various dehydrogenase
           complexes:2-oxo a [Brucella melitensis biovar Abortus
           2308]
 gi|189019853|gb|ACD72575.1| AceF, pyruvate dehydrogenase complex, E2 component [Brucella
           abortus S19]
 gi|237788848|gb|EEP63059.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus str. 2308 A]
 gi|260095643|gb|EEW79520.1| AceF protein [Brucella abortus NCTC 8038]
 gi|260668405|gb|EEX55345.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus bv. 4 str. 292]
 gi|260672343|gb|EEX59164.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674978|gb|EEX61799.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus bv. 6 str. 870]
 gi|260873410|gb|EEX80479.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus bv. 9 str. C68]
 gi|297175610|gb|EFH34957.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus bv. 5 str. B3196]
          Length = 447

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 216/448 (48%), Positives = 299/448 (66%), Gaps = 35/448 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK++PGD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTE--------------------------IPPSPPLSKENIVEV 99
           TE + VN+ ++ +L +  E                                         
Sbjct: 65  TEGVKVNA-LIAVLAEEGEDLAAAAKGAGAAPKAEAPKEEPKPAEAKKEAAAPAAAPAPA 123

Query: 100 REEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
           R E    +P V    +   R  ASPLARR+A + G+D+S++ GSGPHGR+++ D+E  ++
Sbjct: 124 RSEQPAVAPAV----NKGERVFASPLARRIAKDAGVDISAVKGSGPHGRVIQRDVEAALA 179

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
           +       +  +S        D  IL LF   SYEV+PHD +RKTIA RL +SKQT+PHF
Sbjct: 180 SGGAKAVSAQAESAAAPKPMSDDAILKLFEDGSYEVVPHDGMRKTIARRLVESKQTVPHF 239

Query: 220 YVSIDCNIDNLLSLREQMNRT---LQFHREEI-SNKISVNDIILKAFALAMIQVPEANVS 275
           Y++IDC +D LL+LR Q+N     L+  + E+ + K+SVND+++KA ALA+  VPEANVS
Sbjct: 240 YLTIDCELDALLALRSQINAAAPMLKTEKGEVPAYKLSVNDMVIKATALALRDVPEANVS 299

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           WT   MI+HK  D+ VAVSIPGG++TPI+R A+ K++  IS E+K +A+RA+ RKLKPEE
Sbjct: 300 WTEGGMIKHKCSDVGVAVSIPGGLITPIVRHAESKTLSVISNEMKDMARRARDRKLKPEE 359

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSAD 395
           YQGG+TS+SN+GM G+  F A+INPP +TI AIGAGE++ V +  EIKVAT+M+ TLS D
Sbjct: 360 YQGGSTSVSNLGMFGVKDFAAIINPPHATIFAIGAGEERAVVKKGEIKVATVMSVTLSTD 419

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR+VDGA+A++L   FK +IENP+ ML+
Sbjct: 420 HRAVDGALAAELAQAFKRHIENPMGMLV 447


>gi|254719191|ref|ZP_05181002.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           sp. 83/13]
 gi|265984188|ref|ZP_06096923.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella sp. 83/13]
 gi|306838184|ref|ZP_07471040.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella sp. NF 2653]
 gi|264662780|gb|EEZ33041.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella sp. 83/13]
 gi|306406774|gb|EFM62997.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella sp. NF 2653]
          Length = 447

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 215/448 (47%), Positives = 299/448 (66%), Gaps = 35/448 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK++PGD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTE--------------------------IPPSPPLSKENIVEV 99
           TE + VN+ ++ +L +  E                                         
Sbjct: 65  TEGVKVNA-LIAVLAEEGEDVAAAAKGAGAAPKAEAPKEEPKPAEAKKEAAAPAAAPAPA 123

Query: 100 REEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
           R E   ++P      +   R  ASPLARR+A + G+D+S++ GSGPHGR+V+ D+E  ++
Sbjct: 124 RSEQPAAAPAA----NKGERVFASPLARRIAKDAGVDISAVKGSGPHGRVVQRDVEAALA 179

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
           +       +  +S        D  IL LF + SYEV+PHD +RKTIA RL +SKQT+PHF
Sbjct: 180 SGGAKAVSAQAESAAAPKPMSDDAILKLFEEGSYEVVPHDGMRKTIARRLVESKQTVPHF 239

Query: 220 YVSIDCNIDNLLSLREQMNRT---LQFHREEI-SNKISVNDIILKAFALAMIQVPEANVS 275
           Y++IDC +D LL+LR Q+N     L+  + E+ + K+SVND+++KA ALA+  VPEANVS
Sbjct: 240 YLTIDCELDALLALRSQINAAAPMLKTEKGEVPAYKLSVNDMVIKATALALRDVPEANVS 299

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           WT   MI+HK  D+ VAVSIPGG++TPI+R A+ K++  IS E+K +A+RA+  KLKPEE
Sbjct: 300 WTEGGMIKHKRSDVGVAVSIPGGLITPIVRHAESKTLSAISNEMKDMARRARDCKLKPEE 359

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSAD 395
           YQGG+TS+SN+GM G+  F A+INPP +TI AIGAGE++ V +  EIKVAT+M+ TLS D
Sbjct: 360 YQGGSTSVSNLGMFGVKDFAAIINPPHATIFAIGAGEERAVVKKGEIKVATVMSVTLSTD 419

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR+VDGA+A++L   FK +IENP+ ML+
Sbjct: 420 HRAVDGALAAELAQAFKRHIENPMGMLV 447


>gi|222085878|ref|YP_002544409.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Agrobacterium radiobacter K84]
 gi|221723326|gb|ACM26482.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Agrobacterium radiobacter K84]
          Length = 445

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 219/442 (49%), Positives = 299/442 (67%), Gaps = 25/442 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG LAKW+ +EGDK+  GD++ EIETDKA ME E+VDEG + +ILVPAG
Sbjct: 5   ITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKILVPAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK-------- 117
           TE + VN+ I  +  +  ++  +   +        +  +    V      +         
Sbjct: 65  TEGVKVNALIAVLAGEGEDVAAAASGAGAAPAAAPKAEAAPVAVAPAATPAPVASAAPAV 124

Query: 118 ---------NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYS 168
                     R  ASPLARRLA + GIDL++L GSGPHGR++K DIE   +     K   
Sbjct: 125 ASAPVATDGQRTFASPLARRLAKDAGIDLTALVGSGPHGRVIKKDIEAAAAGGGVAKAAP 184

Query: 169 TIQSFGLV------DESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVS 222
             Q            +S DA +L LF   SYE++PHD +RKTIA RLQ+SKQTIPHFYV+
Sbjct: 185 AAQPAAAPAPALAKGQSDDA-VLKLFEPGSYELVPHDGMRKTIAKRLQESKQTIPHFYVT 243

Query: 223 IDCNIDNLLSLREQMNRTLQFHREEI-SNKISVNDIILKAFALAMIQVPEANVSWTTNAM 281
           +DC +D LL+LR Q+N      ++ + + K+SVND+++KA ALA+  VP+ANVSWT + M
Sbjct: 244 VDCELDALLALRTQLNDAAPKSKDGVPAYKLSVNDMVIKALALALRDVPDANVSWTDSNM 303

Query: 282 IRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTT 341
           ++HKH D+ VAVSIPGG++TPIIR A+ K++  IS E+K   +RAK+RKLKPEEYQGGTT
Sbjct: 304 VKHKHADVGVAVSIPGGLITPIIRSAELKTLSAISNEMKDYGKRAKERKLKPEEYQGGTT 363

Query: 342 SISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDG 401
           ++SNMGM+G+ +F AV+NPP +TILA+GAGE++V+ +  E+ VAT+M+ TLS DHR+VDG
Sbjct: 364 AVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVIVRKGEMVVATVMSVTLSTDHRAVDG 423

Query: 402 AIASKLLAKFKEYIENPVWMLM 423
           A+ ++LL  FK YIENP+ ML+
Sbjct: 424 ALGAELLGAFKGYIENPMGMLV 445


>gi|13470621|ref|NP_102190.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Mesorhizobium loti MAFF303099]
 gi|14021363|dbj|BAB47976.1| dihydrolipoamide acetyltransferase [Mesorhizobium loti MAFF303099]
          Length = 453

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 212/449 (47%), Positives = 295/449 (65%), Gaps = 31/449 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK+SPGD++ EIETDKA ME E+VDEG + +++VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVSPGDVIAEIETDKATMEVEAVDEGTVAKLVVPAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHS------------------- 106
           TE + VN+ I  +  +  +   +            E                        
Sbjct: 65  TEGVKVNALIAVLAAEGEDASAAAKSGGGAAPAKAEAPKADAPKAEAPKAEPAAAAAPKA 124

Query: 107 -SPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE-------TLI 158
               V     +  R  ASPLARR+A E G+D+S+++G+GPHGR+VK+D++          
Sbjct: 125 EPAPVANGHAAGERTFASPLARRIAKEAGVDVSAVTGTGPHGRVVKADVDAAIAGGGAKA 184

Query: 159 STKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPH 218
           +        +       V    D  +L LF + SYE++PHDN+RKTIA RL ++K TIPH
Sbjct: 185 ALAAKAPAGAPAAPAPAVKPMSDDQVLKLFEQGSYELVPHDNMRKTIARRLVEAKSTIPH 244

Query: 219 FYVSIDCNIDNLLSLREQMNRTLQFHREEISN----KISVNDIILKAFALAMIQVPEANV 274
           FY+++DC +D LL+LR Q+N      + E  +    K+SVND+++KA A+A+  VP+AN 
Sbjct: 245 FYLTLDCELDALLALRTQINAAAPMKKTEKGDVPAYKLSVNDMVIKAMAMALKAVPDANA 304

Query: 275 SWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPE 334
           SWT  AM++HKH D+ VAVSIPGG++TPIIR+AD+K++  IS E+K LA RA+ RKLKPE
Sbjct: 305 SWTETAMVKHKHADVGVAVSIPGGLITPIIRKADEKTLSTISNEMKDLASRARSRKLKPE 364

Query: 335 EYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSA 394
           EYQGGTT++SN+GM GI  F AVINPP +TILA+GAGE++ V +N E+K+AT+M+ TLS 
Sbjct: 365 EYQGGTTAVSNLGMFGIKDFAAVINPPHATILAVGAGEERAVVKNGELKIATVMSVTLST 424

Query: 395 DHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           DHR+VDGA+ ++LL  FK  IENP+ ML+
Sbjct: 425 DHRAVDGALGAELLVAFKRLIENPMGMLV 453


>gi|240850263|ref|YP_002971656.1| dihydrolipoamide acetyltransferase [Bartonella grahamii as4aup]
 gi|240267386|gb|ACS50974.1| dihydrolipoamide acetyltransferase [Bartonella grahamii as4aup]
          Length = 447

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 215/443 (48%), Positives = 301/443 (67%), Gaps = 25/443 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L KW  +EGDK+S GD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLTKWNIKEGDKVSSGDVIAEIETDKATMEVEAVDEGRVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREE---------------------HS 104
           T+ + VN+ I+ +  +  ++  +  +S+E     R+E                     H 
Sbjct: 65  TQGVKVNALIVVLAEEGEDLAEAAKVSEEISSSTRQEPEGVKQTDTLKQTDSKGTKMSHE 124

Query: 105 HSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNV 164
            S+  ++++     R  ASPLARRLA + G+DLS +SGSGPHGRI+K D+E  +S+  + 
Sbjct: 125 SSAQQLIQQDKKVARLFASPLARRLASQDGLDLSLISGSGPHGRIIKRDVEKAVSSDISK 184

Query: 165 KDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
             YS+     +   + D  IL LF +D Y   PH+N+RKTIA RL +SKQ +PHFYV++D
Sbjct: 185 VSYSSQIGELVATGASDKQILKLFKEDEYTFAPHNNMRKTIATRLMESKQRVPHFYVTVD 244

Query: 225 CNIDNLLSLREQMNRTLQF--HREEI--SNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           C +D LL+LR Q+N        +EE   + K+SVND+++KA AL++  VP+ANVSW    
Sbjct: 245 CELDALLALRTQLNAAAPMIKGQEETQPTYKLSVNDMVIKAVALSLKAVPDANVSWLEGG 304

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           M+ HKH D+ VAVSIP G++TPIIR A++K +  IS E+K  A+RA++ KLK EEYQGGT
Sbjct: 305 MLHHKHCDVGVAVSIPNGLITPIIRHAEEKPLSLISKEMKDFAKRAREGKLKMEEYQGGT 364

Query: 341 TSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVD 400
           T++SNMGM GI SF A++NPP +TI AIGAGE++ V +N  + VAT+M+ T+SADHR+VD
Sbjct: 365 TAVSNMGMYGIKSFSAILNPPHATIFAIGAGEERAVVKNGALVVATVMSVTISADHRAVD 424

Query: 401 GAIASKLLAKFKEYIENPVWMLM 423
           GA+A++L   FK+ IENP+ ML+
Sbjct: 425 GALAAELARAFKKMIENPLAMLV 447


>gi|118589904|ref|ZP_01547308.1| dihydrolipoamide acetyltransferase protein [Stappia aggregata IAM
           12614]
 gi|118437401|gb|EAV44038.1| dihydrolipoamide acetyltransferase protein [Stappia aggregata IAM
           12614]
          Length = 434

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 219/434 (50%), Positives = 293/434 (67%), Gaps = 25/434 (5%)

Query: 15  MTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSP 74
           M EG LAKW+ +EGD++S GD++ EIETDKA ME E+VDEG + +I+VPAGT  + VN  
Sbjct: 1   MEEGNLAKWLVKEGDQVSAGDVIAEIETDKATMEVEAVDEGTVGKIVVPAGTAGVKVNEL 60

Query: 75  ILNILMDSTEI---------PPSPPLSKENIVEVREEHSH--------SSPVVVREKHSK 117
           I  +L D  +           P+     + +  V E  S         + PV   +    
Sbjct: 61  IAVLLEDGEDASAIDTSGGSAPAEKSGGDKVPAVPESSSAIEVGAKAATDPVPAPKNADG 120

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
           +R  +SPLARRLA  +G+DL +LSGSGPHGRIVK DIE  ++  T     +  ++     
Sbjct: 121 DRIFSSPLARRLAKLNGLDLKALSGSGPHGRIVKRDIEEALAAGTGKAAPAAAEAPKAAA 180

Query: 178 ESIDA-------NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNL 230
            +           +L LF KDSYE++PHD +RKTIA RL +SKQTIPHFYVS+DC +D L
Sbjct: 181 AASAPAAGPSADQVLKLFDKDSYELVPHDGMRKTIAKRLTESKQTIPHFYVSVDCELDAL 240

Query: 231 LSLREQMNRTLQFHRE-EISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDI 289
           L+LR Q+N      +E + + K+SVND+ +KA ALA+  VP ANVSWT   M+ HKH D+
Sbjct: 241 LALRTQLNDAAAKDKEGKPAYKLSVNDMTIKALALALRDVPNANVSWTDENMVMHKHADV 300

Query: 290 SVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGML 349
            VAVSIPGG++TPIIR+A++K +  IS E+K   +RAK+RKLKPEEYQGGTT++SNMGM+
Sbjct: 301 GVAVSIPGGLITPIIRRAEEKPLSVISNEMKDYGKRAKERKLKPEEYQGGTTAVSNMGMM 360

Query: 350 GINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLA 409
           G+ +F AV+NPP +TILA+GAGEK+ V +N E+ VAT+M+ TLS DHR VDGA+ ++LLA
Sbjct: 361 GVKNFSAVVNPPHATILAVGAGEKRPVVKNGELAVATVMSVTLSTDHRCVDGALGAELLA 420

Query: 410 KFKEYIENPVWMLM 423
            FK YIENP+ ML+
Sbjct: 421 AFKGYIENPMSMLV 434


>gi|153009391|ref|YP_001370606.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Ochrobactrum anthropi ATCC 49188]
 gi|151561279|gb|ABS14777.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Ochrobactrum anthropi ATCC 49188]
          Length = 444

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 213/441 (48%), Positives = 307/441 (69%), Gaps = 24/441 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDKI+PGD++ EIETDKA ME E+VDEG I +++VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKIAPGDVIAEIETDKATMEVEAVDEGTIAKLVVPAG 64

Query: 66  TENIAVNSPILNILMDSTE-------IPPSPPLSKENIVEVREEHSHSSPVVVRE----- 113
           +E + VN+ ++ IL +  E          S P ++  +   +EE   ++           
Sbjct: 65  SEGVKVNA-LIAILAEEGEDVAAAAKGAASAPNTEAKVEAPKEEPKPAAAPAAVPAPAKA 123

Query: 114 -----KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYS 168
                 +  +R  ASPLARR+A E G+D++++ G+GPHGR+V+ D+E  +++        
Sbjct: 124 EQPAAANKGDRVFASPLARRIAKESGVDIAAVKGTGPHGRVVQRDVEAALASGGAKAAAP 183

Query: 169 TIQSFGLVDESI--DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
             ++          D  +L LF + +YE++PHD +RKTIA RL +SKQT+PHFY++IDC 
Sbjct: 184 KAEAASAAAPKPMSDEAVLKLFEEGTYEIVPHDGMRKTIARRLVESKQTVPHFYLTIDCE 243

Query: 227 IDNLLSLREQMNRT---LQFHREEI-SNKISVNDIILKAFALAMIQVPEANVSWTTNAMI 282
           +D LL+LR Q+N     ++  + E+ + K+SVND+++KA ALA+  +PEANVSWT   M+
Sbjct: 244 LDALLALRSQINAAAPMIKTEKGEVPAYKLSVNDLVIKAVALALRDIPEANVSWTEGGMV 303

Query: 283 RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTS 342
           +HK  D+ VAVSIPGG++TPI+RQ+D K++  IS E+K LA+RA+ RKLKPEEYQGG+TS
Sbjct: 304 KHKRADVGVAVSIPGGLITPIVRQSDSKTLSAISNEMKDLAKRARDRKLKPEEYQGGSTS 363

Query: 343 ISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGA 402
           +SN+GM G+  F A+INPP +TI AIGAGE++ V +N EIKVAT+M+ TLS DHR+VDGA
Sbjct: 364 VSNLGMFGVKDFAAIINPPHATIFAIGAGEQRAVVKNGEIKVATVMSVTLSTDHRAVDGA 423

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           +A++L   FK +IENP+ ML+
Sbjct: 424 LAAELAQAFKRHIENPMGMLV 444


>gi|225852627|ref|YP_002732860.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           melitensis ATCC 23457]
 gi|256263880|ref|ZP_05466412.1| AceF [Brucella melitensis bv. 2 str. 63/9]
 gi|225640992|gb|ACO00906.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella melitensis ATCC 23457]
 gi|263094011|gb|EEZ17945.1| AceF [Brucella melitensis bv. 2 str. 63/9]
 gi|326409146|gb|ADZ66211.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           melitensis M28]
 gi|326538854|gb|ADZ87069.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella melitensis M5-90]
          Length = 447

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 215/448 (47%), Positives = 298/448 (66%), Gaps = 35/448 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK++PGD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTE--------------------------IPPSPPLSKENIVEV 99
           TE + VN+ ++ +L +  E                                         
Sbjct: 65  TEGVKVNA-LIAVLAEEGEDVAAAAKGAGAAPKAEAPKEEPKPAEAKKEAAAPAAAPAPA 123

Query: 100 REEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
           R E    +P V    +   R  ASPLARR+A + G+D+S++ GSGPHG +++ D+E  ++
Sbjct: 124 RSEQPAVAPAV----NKGERVFASPLARRIAKDAGVDISAVKGSGPHGHVIQRDVEAALA 179

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
           +       +  +S        D  IL LF   SYEV+PHD +RKTIA RL +SKQT+PHF
Sbjct: 180 SGGAKAVSAQAESAAAPKPMSDDAILKLFEDGSYEVVPHDGMRKTIARRLVESKQTVPHF 239

Query: 220 YVSIDCNIDNLLSLREQMNRT---LQFHREEI-SNKISVNDIILKAFALAMIQVPEANVS 275
           Y++IDC +D LL+LR Q+N     L+  + E+ + K+SVND+++KA ALA+  VPEANVS
Sbjct: 240 YLTIDCELDALLALRSQINAAAPMLKTEKGEVPAYKLSVNDMVIKATALALRDVPEANVS 299

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           WT   MI+HK  D+ VAVSIPGG++TPI+R A+ K++  IS E+K +A+RA+ RKLKPEE
Sbjct: 300 WTEGGMIKHKCSDVGVAVSIPGGLITPIVRHAESKTLSVISNEMKDMARRARDRKLKPEE 359

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSAD 395
           YQGG+TS+SN+GM G+  F A+INPP +TI AIGAGE++ V +  EIKVAT+M+ TLS D
Sbjct: 360 YQGGSTSVSNLGMFGVKDFAAIINPPHATIFAIGAGEERAVVKKGEIKVATVMSVTLSTD 419

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR+VDGA+A++L   FK +IENP+ ML+
Sbjct: 420 HRAVDGALAAELAQAFKRHIENPMGMLV 447


>gi|256061210|ref|ZP_05451362.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           neotomae 5K33]
 gi|261325218|ref|ZP_05964415.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella neotomae 5K33]
 gi|261301198|gb|EEY04695.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella neotomae 5K33]
          Length = 447

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 215/448 (47%), Positives = 298/448 (66%), Gaps = 35/448 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK++PGD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTE--------------------------IPPSPPLSKENIVEV 99
           TE + VN+ ++ +L +  E                                         
Sbjct: 65  TEGVKVNA-LIAVLAEEGEDVAAAAKGAGAAPKAEAPKEEPKPAEAKKEAAAPAAAPAPA 123

Query: 100 REEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
           R E    +P V    +   R  ASPLARR+A + G+D+S++ GSGPHGR+++ D+E  ++
Sbjct: 124 RSEQPAVAPAV----NKGERVFASPLARRIAKDAGVDISAVKGSGPHGRVIQRDVEAALA 179

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
           +       +  +S        D  IL LF   SYEV+PHD +RKTIA RL +SKQT+PHF
Sbjct: 180 SGGAKAVSAQAESAAAPKPMSDDAILKLFEDGSYEVVPHDGMRKTIARRLVESKQTVPHF 239

Query: 220 YVSIDCNIDNLLSLREQMNRT---LQFHREEI-SNKISVNDIILKAFALAMIQVPEANVS 275
           Y++IDC +D LL+LR Q+N     L+  + E+ + K+SVND+++KA ALA+  VPEANVS
Sbjct: 240 YLTIDCELDALLALRSQINAAAPMLKTEKGEVPAYKLSVNDMVIKATALALRDVPEANVS 299

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           WT   MI+HK  D+  AVSIPGG++TPI+R A+ K++  IS E+K +A+RA+ RKLKPEE
Sbjct: 300 WTEGGMIKHKCSDVGGAVSIPGGLITPIVRHAESKTLSVISNEMKDMARRARDRKLKPEE 359

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSAD 395
           YQGG+TS+SN+GM G+  F A+INPP +TI AIGAGE++ V +  EIKVAT+M+ TLS D
Sbjct: 360 YQGGSTSVSNLGMFGVKDFAAIINPPHATIFAIGAGEERAVVKKGEIKVATVMSVTLSTD 419

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR+VDGA+A++L   FK +IENP+ ML+
Sbjct: 420 HRAVDGALAAELAQAFKRHIENPMGMLV 447


>gi|241204526|ref|YP_002975622.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858416|gb|ACS56083.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 454

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 213/450 (47%), Positives = 298/450 (66%), Gaps = 32/450 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK+  GD++ EIETDKA ME E+VDEG + +++V AG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKLVVAAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKN------- 118
           TE + VN+ I  +  D  ++  +   +       + + + +         +++       
Sbjct: 65  TEGVKVNALIAVLAADGEDVSAAASSAGSAAPAPKADGAAAPKAEAAPAPAQSTPAAAPV 124

Query: 119 -------------RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
                        R  +SPLARRLA E GIDLS+++GSGPHGR+VKSDIE  ++      
Sbjct: 125 AAAAPASVSSDGSRAFSSPLARRLAKEAGIDLSAVAGSGPHGRVVKSDIEAALAGGGAKA 184

Query: 166 DYSTIQSFGLVDESI------------DANILNLFAKDSYEVIPHDNIRKTIACRLQQSK 213
                 +      +             +  +L LF   SYE++PHD +RKTIA RL +SK
Sbjct: 185 AAPAAAASAPQASAAPAPAAAAPKGASEEAVLKLFEPGSYELVPHDGMRKTIARRLVESK 244

Query: 214 QTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEAN 273
           QTIPHFYVS+DC +D LL+LR Q+N          + K+SVND+++KA AL++  VP+AN
Sbjct: 245 QTIPHFYVSVDCELDALLALRAQLNDAAPRKDNAPAYKLSVNDMVIKAMALSLRDVPDAN 304

Query: 274 VSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKP 333
           VSWT N MI+HKH D+ VAVSIPGG++TPIIR+A++K++  IS E++ L +RAK RKLKP
Sbjct: 305 VSWTDNNMIKHKHADVGVAVSIPGGLITPIIRKAEEKTLSTISNEMRDLGKRAKDRKLKP 364

Query: 334 EEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLS 393
           EEYQGGT+S+SNMGM+G+ +F AV+NPP +TILA+GAGE++VV +  E+ +AT+M+ TLS
Sbjct: 365 EEYQGGTSSVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVVVKKGEMAIATVMSVTLS 424

Query: 394 ADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            DHR VDGA+ ++LL  FK YIENP+ ML+
Sbjct: 425 TDHRCVDGALGAELLQAFKGYIENPMGMLV 454


>gi|209549204|ref|YP_002281121.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534960|gb|ACI54895.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 446

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 215/443 (48%), Positives = 295/443 (66%), Gaps = 26/443 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGD +  GD++ EIETDKA ME E+VDEG + +++V AG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDTVKSGDVIAEIETDKATMEVEAVDEGTVAKLVVAAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVRE------------ 113
           TE + VN+ I  +  D  ++  +   +        E                        
Sbjct: 65  TEGVKVNALIAVLAADGEDVAAAASGAGSAAPAKAEAAPAPKAEAAPAPAAAPAPAAAPA 124

Query: 114 --KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
               + NR  +SPLARRLA E GIDLS+++GSGPHGR++KSD+E  ++        +   
Sbjct: 125 AVSSNGNRSFSSPLARRLAKEAGIDLSAVAGSGPHGRVIKSDVEAAVAGGGAKPAAAPAA 184

Query: 172 SFGLVDE-----------SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
           +                 S DA +L LF   SYE++PHD +RKTIA RL +SKQTIPHFY
Sbjct: 185 AAPQAAAAPAPAAAPKGASEDA-VLKLFEPGSYELVPHDGMRKTIARRLVESKQTIPHFY 243

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           VS+DC +D L++LR Q+N          + K+SVND+++KA ALA+  VP+ANVSWT   
Sbjct: 244 VSVDCELDALMALRAQLNDAAPRKDNAPAYKLSVNDMVIKAMALALRDVPDANVSWTDTN 303

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           M++HKH D+ VAVSIPGG++TPIIR+A+QK++  IS E++ L +RAK RKLKPEEYQGGT
Sbjct: 304 MVKHKHADVGVAVSIPGGLITPIIRKAEQKTLSVISNEMRDLGKRAKDRKLKPEEYQGGT 363

Query: 341 TSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVD 400
           +S+SNMGM+G+ +F AV+NPP +TILA+GAGE++VV +N E+ +AT+M+ TLS DHR VD
Sbjct: 364 SSVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVVVKNGEMAIATVMSVTLSTDHRCVD 423

Query: 401 GAIASKLLAKFKEYIENPVWMLM 423
           GA+ ++LL  FK YIENP+ ML+
Sbjct: 424 GALGAELLQAFKGYIENPMGMLV 446


>gi|190891629|ref|YP_001978171.1| dihydrolipoamide S-acetyltransferase [Rhizobium etli CIAT 652]
 gi|190696908|gb|ACE90993.1| dihydrolipoamide S-acetyltransferase protein [Rhizobium etli CIAT
           652]
          Length = 450

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 218/447 (48%), Positives = 295/447 (65%), Gaps = 30/447 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG LAKW+ +EGD +  GD++ EIETDKA ME E+VDEG + +++V AG
Sbjct: 5   ITMPALSPTMEEGNLAKWLVKEGDTVKSGDVIAEIETDKATMEVEAVDEGTVAKLVVAAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKH---------- 115
           TE + VN+ I  +  D  ++  +   +        E            K           
Sbjct: 65  TEGVKVNALIAVLAADGEDVAAAAGGAGSPAPAKAEAAPAPKAEAAPAKAEAAPAAAPAA 124

Query: 116 -------SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYS 168
                    NR  +SPLARRLA E GIDLS+++GSGPHGR+VKSD+E  ++        +
Sbjct: 125 ASAAVSAGGNRTFSSPLARRLAREAGIDLSAVAGSGPHGRVVKSDVEAAVAGGGAKAAAA 184

Query: 169 TIQSFGLVDE------------SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTI 216
              +                  S DA +L LF   SYE++PHD +RKTIA RL +SKQTI
Sbjct: 185 PAAAAPQAAAAPAPAAAAPKGASEDA-VLKLFEPGSYELVPHDGMRKTIARRLVESKQTI 243

Query: 217 PHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSW 276
           PHFYVS+DC +D L++LR Q+N          + K+SVND+++KA ALA+  VP+ANVSW
Sbjct: 244 PHFYVSVDCELDALMALRAQLNDAAPRKDGAPAYKLSVNDMVIKAMALALRDVPDANVSW 303

Query: 277 TTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEY 336
           T   M++HKH D+ VAVSIPGG++TPIIR+A+QK++  IS E++ L +RAK RKLKPEEY
Sbjct: 304 TETNMVKHKHADVGVAVSIPGGLITPIIRKAEQKTLSVISNEMRDLGKRAKDRKLKPEEY 363

Query: 337 QGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADH 396
           QGGT+S+SNMGM+G+ +F AV+NPP +TILA+GAGE++VV +N E+ +AT+M+ TLS DH
Sbjct: 364 QGGTSSVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVVVKNGEMAIATVMSVTLSTDH 423

Query: 397 RSVDGAIASKLLAKFKEYIENPVWMLM 423
           R VDGA+ ++LL  FK YIENP+ ML+
Sbjct: 424 RCVDGALGAELLQAFKGYIENPMGMLV 450


>gi|256113683|ref|ZP_05454494.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           melitensis bv. 3 str. Ether]
 gi|265995044|ref|ZP_06107601.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella melitensis bv. 3 str. Ether]
 gi|262766157|gb|EEZ11946.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella melitensis bv. 3 str. Ether]
          Length = 447

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 214/448 (47%), Positives = 298/448 (66%), Gaps = 35/448 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK++PGD++ EIETDKA ME E+VD+G + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDQGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTE--------------------------IPPSPPLSKENIVEV 99
           TE + VN+ ++ +L +  E                                         
Sbjct: 65  TEGVKVNA-LIAVLAEEGEDVAAAAKGAGAAPKAEAPKEEPKPAEAKKEAAAPAAAPAPA 123

Query: 100 REEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
           R E    +P V    +   R  ASPLARR+A + G+D+S++ GSGPHGR+++ D+E  ++
Sbjct: 124 RSEQPAVAPAV----NKGERVFASPLARRIAKDAGVDISAVKGSGPHGRVIQRDVEAALA 179

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
           +       +  +S        D  IL LF   SYEV+PHD +RKTIA RL +SKQT+PHF
Sbjct: 180 SGGAKAVSAQAESAAAPKPMSDDAILKLFEDGSYEVVPHDGMRKTIARRLVESKQTVPHF 239

Query: 220 YVSIDCNIDNLLSLREQMNRT---LQFHREEI-SNKISVNDIILKAFALAMIQVPEANVS 275
           Y++IDC +D LL+LR Q+N     L+  + E+ + K+SVND+++KA ALA+  VPEANVS
Sbjct: 240 YLTIDCELDALLALRSQINAAAPMLKTEKGEVPAYKLSVNDMVIKATALALRDVPEANVS 299

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           WT   MI+HK  D+ VAVSIPGG++TPI+R A+ K++  IS E+K +A+RA+ RKLKPEE
Sbjct: 300 WTEGGMIKHKCSDVGVAVSIPGGLITPIVRHAESKTLSVISNEMKDMARRARDRKLKPEE 359

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSAD 395
           YQGG+TS+SN+GM G+  F A+INPP +TI AIGAGE++ V +  EIKVAT+M+ TLS D
Sbjct: 360 YQGGSTSVSNLGMFGVKDFAAIINPPHATIFAIGAGEERAVVKKGEIKVATVMSVTLSTD 419

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR+VDGA+A++L   FK +IEN + ML+
Sbjct: 420 HRAVDGALAAELAQAFKRHIENSMGMLV 447


>gi|225627597|ref|ZP_03785634.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella ceti str. Cudo]
 gi|260168830|ref|ZP_05755641.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           sp. F5/99]
 gi|261758318|ref|ZP_06002027.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide
           acyltransferase [Brucella sp. F5/99]
 gi|225617602|gb|EEH14647.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella ceti str. Cudo]
 gi|261738302|gb|EEY26298.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide
           acyltransferase [Brucella sp. F5/99]
          Length = 447

 Score =  428 bits (1100), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 214/448 (47%), Positives = 298/448 (66%), Gaps = 35/448 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK++PGD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTE--------------------------IPPSPPLSKENIVEV 99
           TE + VN+ ++ +L +  E                                         
Sbjct: 65  TEGVKVNA-LIAVLAEEGEDVAAAAKGAGAAPKAEAPKEEPKPAEAKKEAAAPAAAPAPA 123

Query: 100 REEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
           R E    +P V    +   R  ASPLARR+A + G+D+S++ GSGPHGR+++ D+E  ++
Sbjct: 124 RSEQPAVAPAV----NKGERVFASPLARRIAKDAGVDISAVKGSGPHGRVIQRDVEAALA 179

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
           +       +  +S        D  IL LF   S EV+PHD +RKTIA RL +SKQT+PHF
Sbjct: 180 SGGAKAVSAQAESAAAPKPMSDDAILKLFEDGSCEVVPHDGMRKTIARRLVESKQTVPHF 239

Query: 220 YVSIDCNIDNLLSLREQMNRT---LQFHREEI-SNKISVNDIILKAFALAMIQVPEANVS 275
           Y++IDC +D LL+LR Q+N     L+  + E+ + K+SVND+++KA ALA+  VPEANVS
Sbjct: 240 YLTIDCELDALLALRSQINAAAPMLKTEKGEVPAYKLSVNDMVIKATALALRDVPEANVS 299

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           WT   MI+HK  D+ VAVSIPGG++TPI+R A+ K++  IS E+K +A+RA+ RKL+PEE
Sbjct: 300 WTEGGMIKHKCSDVGVAVSIPGGLITPIVRHAESKTLSVISNEMKDMARRARDRKLRPEE 359

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSAD 395
           YQGG+TS+SN+GM G+  F A+INPP +TI AIGAGE++ V +  EIKVAT+M+ TLS D
Sbjct: 360 YQGGSTSVSNLGMFGVKDFAAIINPPHATIFAIGAGEERAVVKKGEIKVATVMSVTLSTD 419

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR+VDGA+A++L   FK +IENP+ ML+
Sbjct: 420 HRAVDGALAAELAQAFKRHIENPMGMLV 447


>gi|256159853|ref|ZP_05457586.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           ceti M490/95/1]
 gi|256255099|ref|ZP_05460635.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           ceti B1/94]
 gi|261222294|ref|ZP_05936575.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella ceti B1/94]
 gi|265998258|ref|ZP_06110815.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella ceti M490/95/1]
 gi|260920878|gb|EEX87531.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella ceti B1/94]
 gi|262552726|gb|EEZ08716.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella ceti M490/95/1]
          Length = 447

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 214/448 (47%), Positives = 298/448 (66%), Gaps = 35/448 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK++PGD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTE--------------------------IPPSPPLSKENIVEV 99
           TE + VN+ ++ +L +  E                                         
Sbjct: 65  TEGVKVNA-LIAVLAEEGEDVAAAAKGAGAAPKAEAPKEEPKPAEAKKEAAAPAAAPAPA 123

Query: 100 REEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
           R E    +P V    +   R  ASPLARR+A + G+D+S++ GSGPHGR+++ D+E  ++
Sbjct: 124 RSEQPAVAPAV----NKGERVFASPLARRIAKDAGVDISAVKGSGPHGRVIQRDVEAALA 179

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
           +       +  +S        D  IL LF   S EV+PHD +RKTIA RL +SKQT+PHF
Sbjct: 180 SGGAKAVSAQAESAAAPKPMSDDAILKLFEDGSCEVVPHDGMRKTIAHRLVESKQTVPHF 239

Query: 220 YVSIDCNIDNLLSLREQMNRT---LQFHREEI-SNKISVNDIILKAFALAMIQVPEANVS 275
           Y++IDC +D LL+LR Q+N     L+  + E+ + K+SVND+++KA ALA+  VPEANVS
Sbjct: 240 YLTIDCELDALLALRSQINAAAPMLKTEKGEVPAYKLSVNDMVIKATALALRDVPEANVS 299

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           WT   MI+HK  D+ VAVSIPGG++TPI+R A+ K++  IS E+K +A+RA+ RKL+PEE
Sbjct: 300 WTEGGMIKHKCSDVGVAVSIPGGLITPIVRHAESKTLSVISNEMKDMARRARDRKLRPEE 359

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSAD 395
           YQGG+TS+SN+GM G+  F A+INPP +TI AIGAGE++ V +  EIKVAT+M+ TLS D
Sbjct: 360 YQGGSTSVSNLGMFGVKDFAAIINPPHATIFAIGAGEERAVVKKGEIKVATVMSVTLSTD 419

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR+VDGA+A++L   FK +IENP+ ML+
Sbjct: 420 HRAVDGALAAELAQAFKRHIENPMGMLV 447


>gi|116251999|ref|YP_767837.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115256647|emb|CAK07735.1| putative dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 451

 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 211/447 (47%), Positives = 297/447 (66%), Gaps = 29/447 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW+ +EGDK+  GD++ EIETDKA ME E+VDEG + +++V AG
Sbjct: 5   ITMPALSPTMEEGNLSKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKLVVAAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK-------- 117
           TE + VN+ I  +  D  ++  +   +       + + + +         ++        
Sbjct: 65  TEGVKVNALIAVLAADGEDVAAAASAAGSAAPAPKADGAAAPKAEAAPAPAQSTPAAAPA 124

Query: 118 ------------NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE---------T 156
                       NR  +SPLARRLA E GIDLS+++G+GPHGR+VKSDIE          
Sbjct: 125 PAAAPASVSADGNRTFSSPLARRLAKEAGIDLSAVAGTGPHGRVVKSDIEAAVAGGAAKA 184

Query: 157 LISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTI 216
                      ++         + +  +L LF   SYE++PHD +RKTIA RL +SKQTI
Sbjct: 185 AAPAAAASAPQASAAPAAAPKGASEEAVLKLFEPGSYELVPHDGMRKTIARRLVESKQTI 244

Query: 217 PHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSW 276
           PHFYVS+DC +D LL+LR Q+N          + K+SVND+++KA AL++  VP+ANVSW
Sbjct: 245 PHFYVSVDCELDALLALRAQLNDAAPRKDNAPAYKLSVNDMVIKAMALSLRDVPDANVSW 304

Query: 277 TTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEY 336
           T + M++HKH D+ VAVSIPGG++TPIIR+A++K++  IS E++ L +RAK RKLKPEEY
Sbjct: 305 TDSNMVKHKHADVGVAVSIPGGLITPIIRKAEEKTLSTISNEMRDLGKRAKDRKLKPEEY 364

Query: 337 QGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADH 396
           QGGT+S+SNMGM+G+ +F AV+NPP +TILA+GAGE++VV +  E+ +AT+M+ TLS DH
Sbjct: 365 QGGTSSVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVVVKKGEMAIATVMSVTLSTDH 424

Query: 397 RSVDGAIASKLLAKFKEYIENPVWMLM 423
           R VDGA+ ++LL  FK YIENP+ ML+
Sbjct: 425 RCVDGALGAELLQAFKGYIENPMGMLV 451


>gi|254504964|ref|ZP_05117115.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Labrenzia alexandrii DFL-11]
 gi|222441035|gb|EEE47714.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Labrenzia alexandrii DFL-11]
          Length = 441

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 214/442 (48%), Positives = 297/442 (67%), Gaps = 27/442 (6%)

Query: 8   MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTE 67
           MP+LSPTM EG LAKW+ +EGD +S GD++ EIETDKA ME E+VDEG + +I+V AGTE
Sbjct: 1   MPALSPTMEEGNLAKWLVKEGDTVSAGDVIAEIETDKATMEVEAVDEGTVGKIVVEAGTE 60

Query: 68  NIAVNSPILNILMDSTEIPP------------------SPPLSKENIVEVREEHSHSSPV 109
            + VN  I  +L D  +                     +     + ++ V  E + + P+
Sbjct: 61  GVKVNDLIAVLLEDGEDASAIDTSGAAAPAAPAQSPAPAADAGAKEVIPVGAEAA-TDPI 119

Query: 110 VVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYST 169
              +     R  ASPLARRLA  +G+DL +LSGSGPHGRIVK DIE  ++  T+    + 
Sbjct: 120 PAPKAADGGRIFASPLARRLAQINGLDLKALSGSGPHGRIVKKDIEAAVAAGTSKAAAAP 179

Query: 170 IQSFGLVDESIDA-------NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVS 222
             +      +           +L LF + SYE++PHD +RKTIA RL +SKQTIPHFYVS
Sbjct: 180 AAAEAPKAAAATPAAGPSSDQVLKLFEEGSYELVPHDGMRKTIAKRLTESKQTIPHFYVS 239

Query: 223 IDCNIDNLLSLREQMNRTLQFHRE-EISNKISVNDIILKAFALAMIQVPEANVSWTTNAM 281
           +DC +D LL+LR Q+N      +E + + K+SVND+ +KA ALA+  VP+ANVSWT + M
Sbjct: 240 VDCELDALLALRSQLNGAASTDKEGKPAYKLSVNDMTIKALALALRDVPDANVSWTDDNM 299

Query: 282 IRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTT 341
           ++HKH D+ VAVSIPGG++TPIIR+A++K +  IS E+K +  RAK +KL+P+EYQGGTT
Sbjct: 300 VKHKHADVGVAVSIPGGLITPIIRRAEEKPLSVISNEMKDMGARAKSKKLQPQEYQGGTT 359

Query: 342 SISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDG 401
           ++SNMGM+G+  F AV+NPP +TILA+GAGE++ V ++  + +AT+M+ TLS DHR VDG
Sbjct: 360 AVSNMGMMGVKDFSAVVNPPHATILAVGAGEQRPVVKDGALAIATVMSVTLSTDHRCVDG 419

Query: 402 AIASKLLAKFKEYIENPVWMLM 423
           A+ ++LLA FK YIENP+ ML+
Sbjct: 420 ALGAELLAAFKGYIENPMSMLV 441


>gi|163868060|ref|YP_001609264.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Bartonella
           tribocorum CIP 105476]
 gi|161017711|emb|CAK01269.1| dihydrolipoamide acetyltransferase [Bartonella tribocorum CIP
           105476]
          Length = 445

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 215/445 (48%), Positives = 301/445 (67%), Gaps = 31/445 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L KW  +EGDK+S GD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLTKWNIKEGDKVSSGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREE---------------------HS 104
           T+ + VNS I+ +  +  E+  +  + +E     R+E                     H 
Sbjct: 65  TQGVKVNSLIVVLAEEGEELAEAAKVVEETSSSTRQESEGIKQPDSLKPTDAKGAKMSHE 124

Query: 105 HSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNV 164
            S+  ++++   + R  ASPLARRLA + G+DLS +SGSGPHGRI+K D+E  +    + 
Sbjct: 125 SSAQQLIQQDKKRTRLFASPLARRLASQAGLDLSLISGSGPHGRIIKCDVEKAMGGDIS- 183

Query: 165 KDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
           +D S +        S D  IL LF +D Y   PH+N+RKTIA RL +SKQ +PHFYV++D
Sbjct: 184 QDSSRVGEAAAAGVS-DKQILQLFKEDEYIFAPHNNMRKTIATRLVESKQRVPHFYVTVD 242

Query: 225 CNIDNLLSLREQMN------RTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTT 278
           C +D LL+LR Q+N      +TL+  +   + K+SVND+++KA AL++  VP+ANVSW  
Sbjct: 243 CELDALLALRTQLNAAAPMVKTLEEAKP--TYKLSVNDMVIKAVALSLKAVPDANVSWLE 300

Query: 279 NAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQG 338
             M+ HKH D+ VAVS+P G++TPIIR A++K +  IS E+K  A+RA++RKLK EEYQG
Sbjct: 301 GGMLYHKHCDVGVAVSVPNGLITPIIRHAEEKPLSLISKEMKDFAKRARERKLKMEEYQG 360

Query: 339 GTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRS 398
           GTT++SNMGM G+ SF A++NPP +TI AIGAGE++ V +N  + VAT+M+ TLS DHR+
Sbjct: 361 GTTAVSNMGMYGVKSFSAILNPPHATIFAIGAGEQRAVVKNGALAVATVMSVTLSVDHRA 420

Query: 399 VDGAIASKLLAKFKEYIENPVWMLM 423
           VDGA+A++L   FK+ IENP+ ML+
Sbjct: 421 VDGALAAELAQTFKKMIENPLAMLV 445


>gi|90419625|ref|ZP_01227535.1| dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336562|gb|EAS50303.1| dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 467

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 219/467 (46%), Positives = 299/467 (64%), Gaps = 53/467 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           +TMP+LSPTM EG LAKW+  EGD +S GDI+ EIETDKA ME E+VDEG + +I+V AG
Sbjct: 5   VTMPALSPTMEEGNLAKWLVAEGDTVSAGDIIAEIETDKATMEVEAVDEGKVAKIVVAAG 64

Query: 66  TENIAVNSPILNILMDSTEI-----------------------PPSPPLSKENIVEVR-- 100
           TE + VN+ I  +  D   I                       P +      +  + R  
Sbjct: 65  TEGVKVNAVIAILAADGENIEDAAKGGGSAEGSDDKGGAMVADPKADAAVTGSEADARDA 124

Query: 101 EEHSHSSPVV------VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDI 154
           E+   S P             S +R  ASPLARRLA + G+DL ++ GSGPHGRIVK+DI
Sbjct: 125 EKRGDSRPTADAKSGSSGHGGSGDRVFASPLARRLAKDAGLDLGAVQGSGPHGRIVKADI 184

Query: 155 ETLISTKTNVKDYSTIQSF--------------GLVDESIDANILNLFAKDSYEVIPHDN 200
           E+  ++    K      +               G  DE++    L LF + SYE IPHD 
Sbjct: 185 ESAKASGGARKAADAPAAKSEAASAPAAAPVARGTSDEAV----LKLFEEGSYEKIPHDG 240

Query: 201 IRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNK----ISVND 256
           +RKTIA RL ++K T+PHFY+++DC +D LL+LR+Q+N      + +  +K    +SVND
Sbjct: 241 MRKTIAKRLVEAKSTVPHFYLTLDCELDALLALRKQLNEAAPMIKTDAGDKPAYKLSVND 300

Query: 257 IILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDIS 316
           +I+KA ALA+  VP ANVSWT +AM++HKH D+ VAVSI GG++TPIIR+A++K++  +S
Sbjct: 301 MIIKAMALALKAVPTANVSWTESAMLQHKHADVGVAVSIEGGLITPIIRRAEEKTLSAVS 360

Query: 317 LEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVV 376
            E+K LA+RA+ RKLKPEEYQGGTT++SN+GM GI  F AVINPP +TILA+GAGE++ V
Sbjct: 361 NEMKDLAKRARARKLKPEEYQGGTTAVSNLGMFGIKDFAAVINPPHATILAVGAGEQRAV 420

Query: 377 FQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            +N  + VAT+M+ TLS DHR+VDGA+ ++L   FK+ IENP+ ML+
Sbjct: 421 VKNGAVTVATMMSVTLSTDHRAVDGALGAELAVAFKQLIENPMSMLV 467


>gi|85716520|ref|ZP_01047491.1| dihydrolipoamide acetyltransferase, long form [Nitrobacter sp.
           Nb-311A]
 gi|85696709|gb|EAQ34596.1| dihydrolipoamide acetyltransferase, long form [Nitrobacter sp.
           Nb-311A]
          Length = 450

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 213/446 (47%), Positives = 292/446 (65%), Gaps = 28/446 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM +G LA+W+K+EGD +  GD++ EIETDKA ME E+VDEGII +ILVP G
Sbjct: 5   ILMPALSPTMEKGNLARWLKKEGDAVKSGDVIAEIETDKATMEVEAVDEGIIAKILVPEG 64

Query: 66  TENIAVNSPILNILMDSTEIP---------PSPPLSKENIVEVREEHSHSS--------- 107
           T+++ VN+ I  +  D  ++          P      E+ VE +  +  ++         
Sbjct: 65  TQDVPVNNVIAVLAGDGEDVKAAASGATSEPRNAAKAESRVEAKAGNGGTARASDASSSM 124

Query: 108 ---------PVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI 158
                        R  +   R  +SPLARRLAGE GI+L+ + GSGPHGRIV  D+E   
Sbjct: 125 SASKPPSPESAAPRSANGHTRIFSSPLARRLAGEAGIELARIEGSGPHGRIVARDVEQAK 184

Query: 159 STKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPH 218
           S K      +   +  +     D  IL+LF   SYE +PHDN+R+TIA RL  S QTIPH
Sbjct: 185 SGKGLKAPAAPAGAPAIAPSMSDKQILSLFEDGSYERVPHDNMRRTIAQRLTASIQTIPH 244

Query: 219 FYVSIDCNIDNLLSLREQMNRTLQFHREEIS-NKISVNDIILKAFALAMIQVPEANVSWT 277
           FY+++DC+I  LLS RE +N +    +E+ S  K+SVND ++KA A+A+ +VP ANVSWT
Sbjct: 245 FYLTMDCDIGRLLSAREDINASAPKDKEKKSLYKLSVNDFVIKAMAVALQRVPNANVSWT 304

Query: 278 TNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQ 337
              M+RH+H D+ VAV++PGG++TPIIR+A+ KS+  IS E+K  A RA+ RKLKPEEYQ
Sbjct: 305 EGGMLRHRHSDVGVAVAMPGGLITPIIRKAETKSLSAISSEMKDFAARARARKLKPEEYQ 364

Query: 338 GGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHR 397
           GGTT++SN+GM GI  F AVINPP +TILA+GA E++ V ++  I+ A IM+ TLS DHR
Sbjct: 365 GGTTAVSNLGMYGIKDFTAVINPPHATILAVGASEERAVVRSGRIEAAHIMSVTLSCDHR 424

Query: 398 SVDGAIASKLLAKFKEYIENPVWMLM 423
           +VDGA+ ++L+  FK  IENPV M++
Sbjct: 425 AVDGALGAELIGAFKTLIENPVMMMV 450


>gi|319898765|ref|YP_004158858.1| dihydrolipoamide acetyltransferase [Bartonella clarridgeiae 73]
 gi|319402729|emb|CBI76276.1| dihydrolipoamide acetyltransferase [Bartonella clarridgeiae 73]
          Length = 441

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 209/439 (47%), Positives = 303/439 (69%), Gaps = 23/439 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW  +EGDK++ GDI+ EIETDKA ME E++DEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWNVKEGDKVTCGDIIAEIETDKATMEIEAIDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKE---------------NIVEVREEHSHSSPVV 110
           T+ + VNS I+ +  +  ++  +  +++E               N   V+  HS  +  +
Sbjct: 65  TQRVKVNSLIVVLAEEGEDLSEAAKIAEETSSIMVKEPVIKQSMNSASVQASHSSKNQQL 124

Query: 111 VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
           ++   +  R  ASPLARRLA + GIDLS +SG+GPHGRI+K D+E +++    ++   ++
Sbjct: 125 IQRNGNNRRLFASPLARRLAAQVGIDLSLISGTGPHGRIIKHDVEKVLNN--GLESSRSL 182

Query: 171 QSFGLVDESI-DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
                +  SI D +IL LF +  Y   PHDN+RKTIA RL  SKQ +PHFYV+IDC +D 
Sbjct: 183 HINQSITSSISDRHILQLFKESEYTFAPHDNMRKTIAKRLVASKQMVPHFYVTIDCELDA 242

Query: 230 LLSLREQMNRT-----LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
           LL LR Q+N       +Q   ++ + K+SVND+++KA AL++  VP+ANVSW  + M+ H
Sbjct: 243 LLKLRTQLNAVVPMVEMQEGTKKPAYKLSVNDMVIKAVALSLKAVPDANVSWLEDGMLYH 302

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           KH D+ VAVS+P G++ PIIR A++KS+  IS E+K LA RA++RKL+ EEYQGGTT++S
Sbjct: 303 KHCDVGVAVSVPNGLMVPIIRCAEEKSLSIISNEMKDLATRARERKLRMEEYQGGTTAVS 362

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIA 404
           NMGM GI +F A+INPP +TI AIG+GEK+ + ++  + +AT+M+ TLS DHR+VDGA+A
Sbjct: 363 NMGMYGIKNFSAIINPPHATIFAIGSGEKRAIVKDGALAIATVMSVTLSVDHRAVDGALA 422

Query: 405 SKLLAKFKEYIENPVWMLM 423
           +++   FK+ IENP+ ML+
Sbjct: 423 AEVAQTFKKIIENPLTMLI 441


>gi|163760093|ref|ZP_02167176.1| dihydrolipoamide acetyltransferase protein [Hoeflea phototrophica
           DFL-43]
 gi|162282492|gb|EDQ32780.1| dihydrolipoamide acetyltransferase protein [Hoeflea phototrophica
           DFL-43]
          Length = 435

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 207/435 (47%), Positives = 288/435 (66%), Gaps = 26/435 (5%)

Query: 15  MTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSP 74
           M EG LAKW+ +EGDKI PGD++ EIETDKA ME E+VDEG + +I+VP GTE + VN+ 
Sbjct: 1   MEEGNLAKWLVKEGDKIGPGDVIAEIETDKATMEVEAVDEGTVAKIVVPGGTEGVKVNAL 60

Query: 75  ILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPV---------------------VVRE 113
           I  +  +   +  +     +         + +  V                         
Sbjct: 61  IAILAGEGESVEDAAKGGGDAAPAPATAPAEAPKVEAAPVAEPAAASAAAPIAATQAPAA 120

Query: 114 KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSF 173
             S  R  +SPLARR+A + G+D++ +SGSGPHGR+VK D+E  I+  T     +   + 
Sbjct: 121 SSSGERTFSSPLARRIAKDAGVDVALISGSGPHGRVVKKDVEAAIAAGTGKAATAAAPAS 180

Query: 174 GLVDESI-----DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNID 228
                +      +  +L  FA+DSYE++ HD +RKTIA RLQ+SKQTIPHFYV++DC +D
Sbjct: 181 AAAPAAAPKGMSEEAVLKNFAEDSYELVKHDGMRKTIARRLQESKQTIPHFYVTVDCELD 240

Query: 229 NLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHID 288
            LL+LR Q+N+      ++   K+SVND+++KA ALA+  VP ANVSWT   M+ HKH D
Sbjct: 241 ALLALRAQINKAAPLKDDKPLYKVSVNDMVIKALALALRDVPNANVSWTDENMVMHKHSD 300

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           + VAVSIPGG++TPIIR A++K++  IS E+K L +RAK+RKLKPEEYQGGTT++SNMGM
Sbjct: 301 VGVAVSIPGGLITPIIRSAEEKTLSAISNEMKDLGKRAKERKLKPEEYQGGTTAVSNMGM 360

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLL 408
           +G+  F AV+NPP +TILA+GAGE++ V +N E+ VAT+M+ TLS DHR+VDGA+ ++LL
Sbjct: 361 MGVKDFAAVVNPPHATILAVGAGEQRPVVKNGELAVATVMSVTLSTDHRAVDGALGAELL 420

Query: 409 AKFKEYIENPVWMLM 423
           A FK YIE+P+ ML+
Sbjct: 421 AAFKGYIESPMGMLV 435


>gi|319405531|emb|CBI79150.1| dihydrolipoamide acetyltransferase [Bartonella sp. AR 15-3]
          Length = 440

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 215/443 (48%), Positives = 301/443 (67%), Gaps = 32/443 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW  +EGDK++ GDI+ EIETDKA ME E++DEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWNIKEGDKVACGDIIAEIETDKATMEVEAIDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKE---------NI------VEVREEHSHSSPVV 110
           T+ + VNS I+ +  +  ++  +  +++E         NI      V V+  HS ++  +
Sbjct: 65  TQRVKVNSLIVILAEEGEDLFEAAKIAEETSSVVVKEPNIKQSVESVSVQAAHSSTNQQL 124

Query: 111 VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
           VR+     R  ASPLARRLA + GIDL  +SG+GPHGRI+K D+E  ++           
Sbjct: 125 VRQNVDNRRLFASPLARRLAAQMGIDLLLISGTGPHGRIIKRDVEKALNN-------GIA 177

Query: 171 QSFGL-VDESI-----DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
            S  L +D+SI     D  IL LF +  Y   PHDN+RKTIA RL  SKQ +PHFYV+ID
Sbjct: 178 SSHSLHIDQSISSGTSDRQILQLFKESEYTFTPHDNMRKTIAKRLVASKQMVPHFYVTID 237

Query: 225 CNIDNLLSLREQMNRTLQF----HREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           C +D LL LR Q+N  +         + + K+SVND+I+KA AL++  VP+ANVSW  + 
Sbjct: 238 CELDALLELRTQLNAVVPMVEMQEGMKAAYKLSVNDMIIKAVALSLKAVPDANVSWLEDG 297

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           M+ HKH D+ VAVS+P G++ PIIR A++KS+  IS E+K LA RA++RKLK EEYQGGT
Sbjct: 298 MLYHKHCDVGVAVSVPNGLMVPIIRCAEEKSLSIISNEMKDLATRARERKLKMEEYQGGT 357

Query: 341 TSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVD 400
           T++SNMGM GI +F A+INPP +TI AIG+GEK+ + ++  + +AT+M+ TLS DHR++D
Sbjct: 358 TAVSNMGMYGIKNFSAIINPPHATIFAIGSGEKRAIVKDGALAIATVMSVTLSVDHRAID 417

Query: 401 GAIASKLLAKFKEYIENPVWMLM 423
           GA+A+++   FK+ IENP+ ML+
Sbjct: 418 GALAAEVAQTFKKVIENPLTMLI 440


>gi|319408351|emb|CBI82004.1| dihydrolipoamide acetyltransferase [Bartonella schoenbuchensis R1]
          Length = 442

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 207/443 (46%), Positives = 304/443 (68%), Gaps = 30/443 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L KW  +EGDK+S GD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLLKWNIKEGDKVSAGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMD--------------STEIPPSPPLSKENIV--EVREEHSHSSPV 109
           T+ + VN+ I+ +  +              S+ +    P+ ++ ++  +++  ++  + +
Sbjct: 65  TQGVKVNTLIMVLAEEGEDLSEVAKIAEDKSSSVSKRAPVDEKQVISKDIQVSNAPQAQL 124

Query: 110 VVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYST 169
            V++  +  R  ASPLARRLA + G++LS +SG+GPHGRI+K D+E ++S    +K   +
Sbjct: 125 SVQKHENNIRLFASPLARRLAAQEGLNLSLISGTGPHGRIIKRDVEKVLSDGA-LKASCS 183

Query: 170 IQ-----SFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
           +Q     + G+ DE     I+ LF +  Y + PHD++RKTIA RL +SKQ +PHFYV++D
Sbjct: 184 LQVGQPMATGIADE----QIIKLFREGEYTLTPHDSMRKTIAKRLTESKQMVPHFYVTVD 239

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNK----ISVNDIILKAFALAMIQVPEANVSWTTNA 280
           C +D LL+LR Q+N      + +   K    +S+ND+++KA AL++  VP+ANVSW    
Sbjct: 240 CELDALLALRAQLNAAAPMVKTQEGTKPAYKLSINDMVIKAIALSLKAVPDANVSWLEGG 299

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           M+ HKH D+ VAVSIP G++TPIIR A++KS+  IS E+K  A RA++RKLKPEEYQGGT
Sbjct: 300 MLYHKHCDVGVAVSIPNGLITPIIRHAEEKSLPIISNEMKDFATRARERKLKPEEYQGGT 359

Query: 341 TSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVD 400
           T++SNMGM G+  F A+IN P +TI AIGAGE++ V ++  + +AT+M+ TLS DHR+VD
Sbjct: 360 TAVSNMGMYGVKEFSAIINSPHATIFAIGAGEQRAVVKDGALAIATMMSVTLSTDHRAVD 419

Query: 401 GAIASKLLAKFKEYIENPVWMLM 423
           GA+A++L   FK+ IENP+ MLM
Sbjct: 420 GALAAELAQAFKKLIENPLAMLM 442


>gi|49475370|ref|YP_033411.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Bartonella
           henselae str. Houston-1]
 gi|49238176|emb|CAF27385.1| Dihydrolipoamide acetyltransferase (E2) [Bartonella henselae str.
           Houston-1]
          Length = 442

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 215/438 (49%), Positives = 299/438 (68%), Gaps = 20/438 (4%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW  +EGD++S GDI+ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWNIKEGDQVSSGDIIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTEIP---------PSPPLSKENIVEVREEH-----SHSSPV-- 109
           T+ + VNS I+ +  +  ++          PS    KE+  E + +      SH S V  
Sbjct: 65  TQGVKVNSLIVVLAEEGEDLAEVAKVAEDSPSSFAIKESEGEKQRDSKVAQISHISSVQQ 124

Query: 110 VVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYST 169
           V+++     R  ASPLARRLA + G+DLS +SGSGPHGRI+K D+E  +    +   YS+
Sbjct: 125 VMQQGKKGMRFFASPLARRLATQVGLDLSLVSGSGPHGRIIKRDVEKAMKGGVSKASYSS 184

Query: 170 IQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
                +   + D  IL LF +D Y   PH+N+RKTIA RL +SKQ +PHFYV++DC +D 
Sbjct: 185 QIEQPVTANTSDKQILQLFKEDEYTFTPHNNMRKTIAKRLVESKQKVPHFYVTLDCELDA 244

Query: 230 LLSLREQMNRTLQFHR-EEISN---KISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           LL LR Q+N      + +E S    K+SVND+I+KA AL+++ VP+ANVSW    ++ HK
Sbjct: 245 LLQLRTQLNAAAPIIKMQEGSKPAYKLSVNDMIIKAVALSLMAVPDANVSWLEGGILHHK 304

Query: 286 HIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
           H D+ VAVS+  G++TPI+R A++KS+  IS E+K   +RA++ KLK EEYQGGTT++SN
Sbjct: 305 HCDVGVAVSVENGLITPIVRHAEKKSLSIISNEMKDFVKRARELKLKMEEYQGGTTAVSN 364

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIAS 405
           MGM G+ SF A++NPP +TI AIGAGE++ V +N  +  AT+M+ TLSADHR+VDGA+A+
Sbjct: 365 MGMYGVKSFSAILNPPHATIFAIGAGEQRAVVKNGALAAATVMSVTLSADHRAVDGALAA 424

Query: 406 KLLAKFKEYIENPVWMLM 423
           +L   FK+ IENP+ ML+
Sbjct: 425 ELARTFKKMIENPLTMLI 442


>gi|49474129|ref|YP_032171.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Bartonella
           quintana str. Toulouse]
 gi|49239633|emb|CAF25992.1| Dihydrolipoamide acetyltransferase (E2) [Bartonella quintana str.
           Toulouse]
          Length = 439

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 212/436 (48%), Positives = 298/436 (68%), Gaps = 19/436 (4%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L KW  +EGDK+S GD+L EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLLKWNIKEGDKVSYGDVLAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPP-----LSKENIVEVREEHSHSSP-------VVVRE 113
           T+ + VNS I+ +  +  ++  +       LS   ++E + +    S        +  R+
Sbjct: 65  TQGVRVNSLIVVLAEEGEDLAEAAKVAEKALSSIAVIESKRKKQTDSKSAQMSRLLSARQ 124

Query: 114 -KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQS 172
            +    R  ASPLARRLA + G+DL  +SGSGPHGRI+K DI+  +S    ++D  ++Q+
Sbjct: 125 VRQQDGRLFASPLARRLAAQEGLDLLCISGSGPHGRIIKRDIDKAMSND-GLEDSCSLQN 183

Query: 173 FG-LVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
              +  +S D  IL LF +D Y  I H N+RKTIA RL +SKQ +PHFYV++DC +D LL
Sbjct: 184 KQPVATDSADKKILQLFKEDEYTFILHSNMRKTIAKRLVESKQKVPHFYVTVDCELDALL 243

Query: 232 SLREQMNRTLQFHREEI----SNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI 287
            LR Q+N      + +     + K+SVND+++K  AL++  V +ANVSW    ++ HKH 
Sbjct: 244 ELRTQLNAAAPMVKMQEGFKPAYKLSVNDMVIKTVALSLKAVSDANVSWLEGGILHHKHC 303

Query: 288 DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMG 347
           D+ VAVS+  G++TPI+R A++KS+  IS E+K   +RA++RKLK EEYQGGTT+ISNMG
Sbjct: 304 DVGVAVSVSNGLITPIVRHAEEKSLSIISNEMKDFVKRARERKLKMEEYQGGTTAISNMG 363

Query: 348 MLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKL 407
           M G+ SF A++NPP +TI AIGAGEK+ V +N+ + VATIM+ TLSADHR+VDGA+A++L
Sbjct: 364 MYGVKSFSAILNPPHATIFAIGAGEKRAVVKNDALGVATIMSVTLSADHRAVDGALAAEL 423

Query: 408 LAKFKEYIENPVWMLM 423
           +  FK+ IENP+ ML+
Sbjct: 424 MRTFKKIIENPLAMLI 439


>gi|121601717|ref|YP_988851.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Bartonella
           bacilliformis KC583]
 gi|120613894|gb|ABM44495.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Bartonella bacilliformis KC583]
          Length = 441

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 206/437 (47%), Positives = 297/437 (67%), Gaps = 19/437 (4%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW  +EGDK+S GD++ EIETDKA ME E++DEG + +I+VPAG
Sbjct: 5   ITMPALSPTMEEGNLSKWNIKEGDKVSSGDVIAEIETDKATMEVEAIDEGTVAKIVVPAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENI------------VEVREEHSHSSPVV--- 110
           T+ + VN+ I+ +  +  ++  +   ++E++            VE +EE    + +    
Sbjct: 65  TQGVKVNALIVILAEEGEDLAEAVKAAEEDVALSGKKSKVTKQVEAKEELVADASLAQQF 124

Query: 111 VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
           ++      R  ASPLARRLA E G DLS +SG+GPHGRI+K D+E  +S        S+ 
Sbjct: 125 IQRDGDNTRLFASPLARRLAAESGFDLSVISGTGPHGRIIKRDVEKALSGGALRDSRSSS 184

Query: 171 QSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNL 230
            +  +V  + D  ++ LF +  Y    H+++RKTIA RL +SK TIPHFYV++DC +D L
Sbjct: 185 VNRPIVTGASDEQVMKLFKESEYTFASHNSMRKTIAKRLVESKSTIPHFYVTVDCELDAL 244

Query: 231 LSLREQMNRT--LQFHREEI--SNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           L LR ++N    +   +E +  + K+SVND+++KA AL++  +P+ANVSW    M+ HKH
Sbjct: 245 LKLRAELNAIAPMVTTQENMNPAYKLSVNDMVIKAVALSLRALPDANVSWLEGGMLYHKH 304

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
            D+ VAVSIP G++TPIIR A++KS+  IS E+K  A RA+  KLKPEEYQGGTT+ISNM
Sbjct: 305 CDVGVAVSIPNGLITPIIRHAEEKSLPVISNEMKDFATRARANKLKPEEYQGGTTAISNM 364

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASK 406
           GM G+  F A+INPP +TI AIGAGE++ V +N  + +AT+M+ TLS DHR+VDGA+A++
Sbjct: 365 GMYGVKDFSAIINPPHATIFAIGAGEQRAVVKNGALAIATVMSVTLSVDHRAVDGALAAE 424

Query: 407 LLAKFKEYIENPVWMLM 423
           L+  FK+ IENP+ +L+
Sbjct: 425 LVQTFKKLIENPLSILV 441


>gi|217976708|ref|YP_002360855.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Methylocella silvestris BL2]
 gi|217502084|gb|ACK49493.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Methylocella silvestris BL2]
          Length = 444

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 211/440 (47%), Positives = 291/440 (66%), Gaps = 22/440 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM +G L++W+K+EGDKI  GD++ EIETDKA ME E+VDEG++  I+VP G
Sbjct: 5   ILMPALSPTMEKGNLSRWLKKEGDKIKSGDVIAEIETDKATMEVEAVDEGVLARIVVPDG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVR------------- 112
           T ++AVN  I  I  D  ++  +   +           +  +                  
Sbjct: 65  TADVAVNDVIGVIAADGEDVSAAAAPAAAKPAPAAPASAAPASAPSAPAASAAQTAPAPA 124

Query: 113 --EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS------TKTNV 164
                +  R  ASPLARR+A E G+DLS ++GSGPHGRIV+ D++  ++       K   
Sbjct: 125 AVNGQAGPRLFASPLARRIAKESGLDLSGVAGSGPHGRIVERDVKAALAQPRPQIAKAPA 184

Query: 165 KDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
              +   +      + D  I   +A  SY+  PHD++RKTIA RL ++ QTIPHFY+S+D
Sbjct: 185 APAAPSPAAPTPAPASDEAIRKFYAPGSYDEAPHDSMRKTIARRLVEASQTIPHFYLSVD 244

Query: 225 CNIDNLLSLREQMNRTLQFHRE-EISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           CN+D LL+LRE +N      ++ + S KISVND I+K  ALA+I+VPEANV+WT + M++
Sbjct: 245 CNLDALLALRETVNAQASRDKDAKPSYKISVNDFIIKGLALALIRVPEANVTWTESVMLK 304

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
           HKH D+ VAVSIPGG++TP+IR AD KS+  IS E+K  A RAK RKLKPEEYQGG++S+
Sbjct: 305 HKHADVGVAVSIPGGLITPVIRSADTKSLSAISNEMKDYAARAKARKLKPEEYQGGSSSV 364

Query: 344 SNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAI 403
           SN+GM GI +F A+INPPQS+ILA+GAGEK+VV ++    VAT+M+ TLS DHR+VDGA+
Sbjct: 365 SNLGMFGIKNFSAIINPPQSSILAVGAGEKRVVVKDGAPAVATLMSVTLSTDHRAVDGAL 424

Query: 404 ASKLLAKFKEYIENPVWMLM 423
            ++LL  FK  IE+P+ ML+
Sbjct: 425 GAELLDAFKSLIEHPMSMLV 444


>gi|86749885|ref|YP_486381.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Rhodopseudomonas palustris HaA2]
 gi|86572913|gb|ABD07470.1| Dihydrolipoamide acetyltransferase, long form [Rhodopseudomonas
           palustris HaA2]
          Length = 451

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/447 (45%), Positives = 294/447 (65%), Gaps = 29/447 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM +G LAKW+K+EGDK+  GD++ EIETDKA ME E+ DEG + +ILVP G
Sbjct: 5   ILMPALSPTMEKGNLAKWLKKEGDKVKSGDVIAEIETDKATMEVEAADEGTLAKILVPEG 64

Query: 66  TENIAVNSPILNILMDSTEI----------------PPSPPLSKENIVEVREEHSHS--- 106
           T+++AVN+ I  +  D  ++                 P     K N+ E + E + +   
Sbjct: 65  TQDVAVNAVIAVLAGDGEDVATAGAGAGKAEAPKAEAPKAEAPKANLAEAKPEKATTPAA 124

Query: 107 ---SPVVVREKHSKN---RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST 160
              +P     + +     R  +SPLARRLA + GIDL+ + GSGPHGR++  DIE   + 
Sbjct: 125 KDGAPRAASPEAAHTNGARVFSSPLARRLAKDSGIDLARVEGSGPHGRVIARDIEKAKAG 184

Query: 161 ---KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIP 217
              K      ++  +  +     D  I  L+ + SYEV+ HD +R+TIA RL QS QTIP
Sbjct: 185 GGLKAPAAAPASSAAPSVAPSMSDQQIRALYPEGSYEVVAHDGMRRTIAQRLTQSTQTIP 244

Query: 218 HFYVSIDCNIDNLLSLREQMNRTLQFHRE-EISNKISVNDIILKAFALAMIQVPEANVSW 276
           HFY++IDCN+D L++ RE +N      ++ + + K+SVND ++KA A+A+ ++P+ANVSW
Sbjct: 245 HFYLTIDCNLDRLMAAREDINAAAPKDKDGKPAYKLSVNDFVIKAMAIALQRIPDANVSW 304

Query: 277 TTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEY 336
           T   M++HKH DI VAV++PGG++TPIIR A+  S+  IS ++K  A RA+ RKLKPEEY
Sbjct: 305 TEAGMLKHKHSDIGVAVAMPGGLITPIIRSAETASLSYISAQMKDFAARARARKLKPEEY 364

Query: 337 QGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADH 396
           QGGTT++SN+GM GI  F AVINPP +TILA+G GE++ +  N +I++AT+M+ TLS DH
Sbjct: 365 QGGTTAVSNLGMYGIKDFTAVINPPHATILAVGTGEQRPIVCNGQIEIATMMSVTLSCDH 424

Query: 397 RSVDGAIASKLLAKFKEYIENPVWMLM 423
           R+VDGA+ ++L+  FK  IENPV M++
Sbjct: 425 RAVDGALGAELIGAFKTLIENPVMMMV 451


>gi|319404089|emb|CBI77677.1| dihydrolipoamide acetyltransferase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 440

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/443 (46%), Positives = 299/443 (67%), Gaps = 32/443 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW  +EGDK++ GD++ EIETDKA ME E++DEG + +I++PAG
Sbjct: 5   ITMPALSPTMEEGNLSKWNIKEGDKVACGDVIAEIETDKATMEVEAIDEGTVAKIVIPAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENI-VEVREE--------------HSHSSPVV 110
           T+ + VNS I+ +  +  ++  +  + +E+  VE++E+              HS ++  +
Sbjct: 65  TQGVKVNSLIVILAEEGEDLSEAAKIVEESSSVEMKEQVVKQSMEAASVQAAHSSTNQKL 124

Query: 111 VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
            ++        ASPLARRLA + GIDLS +SG+GPH RI+K D+E  ++           
Sbjct: 125 AKQNGDNRGLFASPLARRLAAQAGIDLSLISGTGPHKRIIKRDVEKALNN-------GIA 177

Query: 171 QSFGL-VDESI-----DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
            S  L +D+SI     D   L LF +  Y   PHDN+RKTIA RL  SKQ +PHFYV++D
Sbjct: 178 SSHALHIDQSIISGTSDRKTLQLFKESEYTFAPHDNMRKTIAKRLVASKQMVPHFYVTVD 237

Query: 225 CNIDNLLSLREQMNRTLQF----HREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           C +D LL LR Q+N            + + K+SVND+I+KA AL++  +P+ANVSW  + 
Sbjct: 238 CELDALLELRTQLNAVAPIVEIQEGMKPAYKLSVNDMIIKAVALSLKAIPDANVSWLEDG 297

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           M+ HKH D+ VAVS+P G++ PIIR A++KS+  IS E+K LA RA++RKL+ EEYQGGT
Sbjct: 298 MLHHKHCDVGVAVSVPNGLMVPIIRCAEEKSLSIISNEMKDLATRARERKLRMEEYQGGT 357

Query: 341 TSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVD 400
           T++SNMGM GI +F A+INPP +TI AIG+GEK+ + ++E + +AT+M+ TLS DHR++D
Sbjct: 358 TAVSNMGMYGIKNFSAIINPPHATIFAIGSGEKRAIIKDEALAIATVMSVTLSVDHRAID 417

Query: 401 GAIASKLLAKFKEYIENPVWMLM 423
           GA+A+++   FK+ IENP+ ML+
Sbjct: 418 GALAAEVAQTFKKIIENPLTMLI 440


>gi|75676008|ref|YP_318429.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Nitrobacter winogradskyi Nb-255]
 gi|74420878|gb|ABA05077.1| dihydrolipoamide acetyltransferase, long form [Nitrobacter
           winogradskyi Nb-255]
          Length = 452

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 210/448 (46%), Positives = 289/448 (64%), Gaps = 30/448 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM +G LA+W+K+EGD +  GD++ EIETDKA ME E+VDEG I +ILVP G
Sbjct: 5   ILMPALSPTMEKGNLARWLKKEGDAVKSGDVIAEIETDKATMEVEAVDEGTIAKILVPEG 64

Query: 66  TENIAVNSPILNILMDSTEIPP------------SPPLSKENIVEVREEHSHSSPVVVRE 113
           T+++ VN+ I  +  D  ++              + P S+ +      E + S     R 
Sbjct: 65  TQDVPVNNVIAVLAGDGEDVKAAASGATAAPGNEAKPESRADAKAGSGEAAGSPEPSSRA 124

Query: 114 KHSK---------------NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI 158
             SK                R  +SPLARRLA E GIDL+ + GSGPHGRIV  D+E   
Sbjct: 125 PASKPASSGSQAAQPANGHARIFSSPLARRLASEAGIDLARIEGSGPHGRIVARDVEQAK 184

Query: 159 STK--TNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTI 216
           S K        +   +  +     D  IL+LF   SYE++PHDN+R+TIA RL  S Q +
Sbjct: 185 SGKGLKAAAAPAPAGAPSIAPSMSDKQILSLFEDGSYELVPHDNMRRTIAQRLTASIQNV 244

Query: 217 PHFYVSIDCNIDNLLSLREQMNRTLQFHREEIS-NKISVNDIILKAFALAMIQVPEANVS 275
           PHFY+++DC+I  LLS RE++N +    +E+    K+SVND ++KA A+A+ +VP ANVS
Sbjct: 245 PHFYLTMDCDIGRLLSAREEINASAPKDKEKKPLYKLSVNDFVIKAMAVALQRVPNANVS 304

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           WT   M++HKH D+ VAV++PGG++TPIIR+A+ K++  IS E+K  A RA+ RKLKPEE
Sbjct: 305 WTEGGMLKHKHSDVGVAVAMPGGLITPIIRKAETKTLSAISSEMKDFAARARARKLKPEE 364

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSAD 395
           YQGGTT++SN+GM GI  F AVINPP +TILA+GA E++ V +   I+ A IM+ TLS D
Sbjct: 365 YQGGTTAVSNLGMYGIKDFTAVINPPHATILAVGASEERAVVRGGRIEAAQIMSVTLSCD 424

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR+VDGA+ ++L+  FK  IENPV M++
Sbjct: 425 HRAVDGALGAELIGAFKTLIENPVMMMV 452


>gi|115524623|ref|YP_781534.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Rhodopseudomonas palustris BisA53]
 gi|115518570|gb|ABJ06554.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodopseudomonas palustris BisA53]
          Length = 451

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 205/447 (45%), Positives = 294/447 (65%), Gaps = 29/447 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM +G LAKW+K+EGD +  GD++ EIETDKA ME E+VD+G I  I+VP G
Sbjct: 5   ILMPALSPTMEKGNLAKWLKKEGDSVKSGDVIAEIETDKATMEVEAVDDGTIARIVVPEG 64

Query: 66  TENIAVNSPILNILMDSTEI--------------PPSPPLSKENI------------VEV 99
           T+++AVN  I  +  +  +I               P P  S  ++               
Sbjct: 65  TQDVAVNDIIAVLASEGEDIKAAGAAKPEAAKQEAPKPQPSASSVEAPAAPAAQDDAKAP 124

Query: 100 REEHSHSSPVVVRE-KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI 158
           R      +P+   +  HS  R  +SPLARRLA + GID+  ++GSGPHGR++  D+E   
Sbjct: 125 RPAQGAPAPIPTGDASHSNGRNFSSPLARRLAKDAGIDIGRVTGSGPHGRVIARDVEQAK 184

Query: 159 STKTNVKDYSTIQSFGLVDESI-DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIP 217
           +        +   S   +  S+ D  I   F + S++  PHD++RK IA RL Q+KQTIP
Sbjct: 185 AGGGPKAPAAAPSSAPAIAPSLSDQQIRGFFQEGSFDETPHDSMRKIIAQRLVQAKQTIP 244

Query: 218 HFYVSIDCNIDNLLSLREQMNRTLQFHRE-EISNKISVNDIILKAFALAMIQVPEANVSW 276
           HFY+++DCN+D L++ REQ+N +    ++ + + K+SVND ++KA ALA+ +VP+ANV+W
Sbjct: 245 HFYLTMDCNLDRLMAAREQINASAPKDKDGKPAYKLSVNDFVIKALALALQRVPDANVTW 304

Query: 277 TTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEY 336
           T  AM++H+  D+ VAVSIPGG++TP++R A  KS+  IS E+K  A RA+ R+LKPEEY
Sbjct: 305 TEGAMLKHRASDVGVAVSIPGGLITPVVRDAHLKSVSTISREMKDFAARARNRRLKPEEY 364

Query: 337 QGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADH 396
           QGG+T++SN+GM GI  F AVINPP +TILA+GAGE++ V  + +++VATIM+ATLS DH
Sbjct: 365 QGGSTAVSNLGMFGIKDFAAVINPPHATILAVGAGEQRAVVIDGKVEVATIMSATLSTDH 424

Query: 397 RSVDGAIASKLLAKFKEYIENPVWMLM 423
           R+VDGA+ ++LL  FK  IENPV M++
Sbjct: 425 RAVDGALGAELLGAFKLLIENPVMMVV 451


>gi|39935929|ref|NP_948205.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Rhodopseudomonas palustris CGA009]
 gi|39649783|emb|CAE28305.1| dihydrolipoamide acetyltransferase [Rhodopseudomonas palustris
           CGA009]
          Length = 463

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/459 (44%), Positives = 294/459 (64%), Gaps = 41/459 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM +G LAKW+K+EGDK+  GD++ EIETDKA ME E+ DEG + +I+VP G
Sbjct: 5   ILMPALSPTMEKGNLAKWLKKEGDKVKSGDVIAEIETDKATMEVEAADEGTLAKIIVPEG 64

Query: 66  TENIAVNSPILNILMDSTEI-------------PPSPPLSK---------------ENIV 97
           T+++ VN  I  +  D  ++              PSP   +               ++  
Sbjct: 65  TQDVPVNDVIAVLAADGEDVKAAGAGWKASAGGAPSPQRGEGAGPSGGKAEANSHIQDKA 124

Query: 98  EVREEHSHSSPVVVREKH------------SKNRPIASPLARRLAGEHGIDLSSLSGSGP 145
           + R      SP+   E+             +  R  ASPLARRLA + GID++ ++G+GP
Sbjct: 125 DQRPTPQPPSPLPNGERSLPQAAGEGAPAPANGRVFASPLARRLAKDAGIDIARVTGTGP 184

Query: 146 HGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTI 205
           HGR++  D+E   S        S      +     D  I  L+ + SYEV+PHD +R+TI
Sbjct: 185 HGRVIARDVEQAKSGGGLKAPASAPAGPAIAAAMSDQQIRALYPEGSYEVVPHDGMRRTI 244

Query: 206 ACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHRE-EISNKISVNDIILKAFAL 264
           A RL QS QTIPHFY++IDCN+D LL+ RE +N      ++ + + K+SVND I+KA A+
Sbjct: 245 AQRLTQSTQTIPHFYLTIDCNLDRLLAAREDINAAAPKDKDGKPAYKLSVNDFIIKAMAI 304

Query: 265 AMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQ 324
           A+ ++P+ANVSWT   M++HKH DI VAV++PGG++TPIIR A+ +S+  IS ++K  A 
Sbjct: 305 ALQRIPDANVSWTEGGMLKHKHSDIGVAVAMPGGLITPIIRSAETQSLSSISAQMKDFAA 364

Query: 325 RAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKV 384
           RA+ RKLKPEEYQGGTT++SN+GM GI  F AVINPP +TILA+G GE++ + ++ +I+V
Sbjct: 365 RARARKLKPEEYQGGTTAVSNLGMFGIKDFTAVINPPHATILAVGTGEQRAIVKDGKIEV 424

Query: 385 ATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           AT+M+ TLS DHR+VDGA+ ++L+  FK  IENPV M++
Sbjct: 425 ATMMSVTLSCDHRAVDGALGAELIGAFKTLIENPVMMMV 463


>gi|254469392|ref|ZP_05082797.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Pseudovibrio sp. JE062]
 gi|211961227|gb|EEA96422.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Pseudovibrio sp. JE062]
          Length = 445

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/442 (46%), Positives = 293/442 (66%), Gaps = 25/442 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD IS GD++ EIETDKA ME E+VDEG I +I+V  G
Sbjct: 5   ILMPALSPTMEEGNLAKWLVKEGDAISAGDVIAEIETDKATMEVEAVDEGTIGKIMVAEG 64

Query: 66  TENIAVNSPILNILMDSTEIPPS--------------PPLSKENIVEVREEHSHSSPVVV 111
           TE + VN+PI  IL++  E   +               P +           + +     
Sbjct: 65  TEGVKVNAPI-AILLEEGEDASAMDAAPAAAPAPAAAAPQAPATPAAPAAAAAPAPAPAA 123

Query: 112 REKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
               S  R  +SPLARRLA ++G+D++ ++G+GPHGR+VK D+E  I+  T   + +   
Sbjct: 124 PVAASGERVFSSPLARRLAKQNGLDIALINGTGPHGRVVKRDVEAAIAAGTGKAEAAPKA 183

Query: 172 SFGLVDE---------SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVS 222
           +               + D   L LF + SY+++PHD +RK IA RL +SKQT+PHFY++
Sbjct: 184 AEAPKAAEAPKAAPAGASDEQTLKLFEEGSYDLVPHDGMRKVIAKRLTESKQTVPHFYLT 243

Query: 223 IDCNIDNLLSLREQMNRTLQFHRE-EISNKISVNDIILKAFALAMIQVPEANVSWTTNAM 281
           ++C +D LL+LR Q+N +     + + + K+SVND+I+KA ALA+  +P AN S+  + M
Sbjct: 244 VECELDALLALRAQLNSSAPTDADGKPAYKLSVNDMIIKAHALALKAIPAANASYLESGM 303

Query: 282 IRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTT 341
           + HKH D+ VAVSI GG++TPIIR+A++K++  IS+E+K LA+RA++RKL P E+QGGTT
Sbjct: 304 VMHKHADVGVAVSIDGGLITPIIRRAEEKTLSTISIEMKDLAKRARERKLAPTEFQGGTT 363

Query: 342 SISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDG 401
           S+SN+GM G+  F AVINPP +TILA+GAG+K+ V + +EI  AT+M+ TLS DHR+VDG
Sbjct: 364 SVSNLGMFGVKEFAAVINPPHATILAVGAGQKRPVVKGDEIVPATVMSVTLSTDHRAVDG 423

Query: 402 AIASKLLAKFKEYIENPVWMLM 423
           A+ ++LL  FK YIENP+ ML+
Sbjct: 424 ALGAELLQAFKGYIENPMSMLV 445


>gi|92117297|ref|YP_577026.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Nitrobacter hamburgensis X14]
 gi|91800191|gb|ABE62566.1| Dihydrolipoamide acetyltransferase, long form [Nitrobacter
           hamburgensis X14]
          Length = 454

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 207/450 (46%), Positives = 289/450 (64%), Gaps = 32/450 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM +G LAKW+K+EGDK+  GD++ EIETDKA ME E+VDEG I +ILVP G
Sbjct: 5   ILMPALSPTMEKGNLAKWLKKEGDKVKSGDVIAEIETDKATMEVEAVDEGTIAKILVPEG 64

Query: 66  TENIAVNSPILNILMDSTEI-----------------------PPSPPLSKENIVEVREE 102
           T+++ VN  I  +  D  ++                               E  +   + 
Sbjct: 65  TQDVPVNDVIAVLAGDGEDVRAAASGGGASAKAEAKAEAKTESKAGAKTGSEGAIRTPDA 124

Query: 103 HSH-------SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE 155
            S        SS     + + + R  +SPLARRLA + GI+L+ + GSGPHGR+V  D+E
Sbjct: 125 SSSAPAPKPASSGSPTPQANGQARVFSSPLARRLAKDAGIELARIEGSGPHGRVVARDVE 184

Query: 156 TLISTKTNVKDYSTIQSFGLVDESI-DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQ 214
              S K      +       +  ++ D  IL+LF   SYEV+PHDN+R+TIA RL  S Q
Sbjct: 185 QAKSGKGLKAPAAAPAGAPSIAPAMSDKQILSLFEDGSYEVVPHDNMRRTIAQRLTASIQ 244

Query: 215 TIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEIS-NKISVNDIILKAFALAMIQVPEAN 273
           ++PHFY+++DC+I  LL+ RE +N +    +E+    K+SVND ++KA A+A+ +VP AN
Sbjct: 245 SVPHFYLTMDCDIGRLLAAREDINASAPKDKEKKPLYKLSVNDFVIKAMAIALQRVPNAN 304

Query: 274 VSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKP 333
           VSWT   M++H+H DI VAV++PGG++TPIIR+A+ KS+  IS E+K  A RA+ RKLKP
Sbjct: 305 VSWTEGGMLKHRHSDIGVAVAMPGGLITPIIRKAETKSLSAISTEMKDFAGRARARKLKP 364

Query: 334 EEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLS 393
           EEYQGGTT++SN+GM GI  F AVINPP +TILA+GA E++ V +  +I+ A IM+ TLS
Sbjct: 365 EEYQGGTTAVSNLGMYGIKDFTAVINPPHATILAVGASEERAVVRGGKIEAAHIMSVTLS 424

Query: 394 ADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            DHR+VDGA+ ++L+  FK  IENPV M++
Sbjct: 425 CDHRAVDGALGAELIGAFKTLIENPVMMMV 454


>gi|316933976|ref|YP_004108958.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodopseudomonas palustris DX-1]
 gi|315601690|gb|ADU44225.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodopseudomonas palustris DX-1]
          Length = 468

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 208/464 (44%), Positives = 297/464 (64%), Gaps = 46/464 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM +G LAKW+K+EGD++  GD++ EIETDKA ME E+ DEG + +I+VP G
Sbjct: 5   ILMPALSPTMEKGNLAKWLKKEGDQVKSGDVIAEIETDKATMEVEAADEGTLAKIIVPEG 64

Query: 66  TENIAVNSPILNILMDSTEI-------------PPSP---PLSKENIVEV---REEHSHS 106
           T+++ VN  I  +  D  ++              PSP   P   E         E +SH+
Sbjct: 65  TQDVPVNDVIAVLAADGEDVNAAGAGGTASAGGAPSPQPSPQRGEGAGPAGGKAEANSHA 124

Query: 107 ---------------------SPVVVREKHSKN----RPIASPLARRLAGEHGIDLSSLS 141
                                SP     + +K     R  ASPLARRLA + GID+S ++
Sbjct: 125 QDKADQRPAPQPPSPLPNGERSPPQAAGEGAKAPANARVFASPLARRLAKDVGIDISRVT 184

Query: 142 GSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI-DANILNLFAKDSYEVIPHDN 200
           G+GPHGR++  D+E   S        +   +   +  ++ D  I  L+ + SYEV+PHD 
Sbjct: 185 GTGPHGRVIARDVEQAKSGGGLKAPAAAAAAGPAIAPAMSDQQIRALYPEGSYEVVPHDG 244

Query: 201 IRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHRE-EISNKISVNDIIL 259
           +R+TIA RL QS QTIPHFY++IDCN+D LL+ RE +N      ++ + + K+SVND I+
Sbjct: 245 MRRTIAQRLTQSTQTIPHFYLTIDCNLDRLLAAREDINAAAPKDKDGKPAYKLSVNDFII 304

Query: 260 KAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEV 319
           KA A+A+ ++P+ANVSWT   M++HKH DI VAV++PGG++TPIIR A+  S+  IS ++
Sbjct: 305 KAMAIALQRIPDANVSWTEGGMLKHKHSDIGVAVAMPGGLITPIIRSAETASLSSISAQM 364

Query: 320 KQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQN 379
           K  A RA+ RKLKPEEYQGGTT++SN+GM GI  F AVINPP +TILA+G GE++ + ++
Sbjct: 365 KDFAARARARKLKPEEYQGGTTAVSNLGMFGIKDFTAVINPPHATILAVGTGEQRPIVRD 424

Query: 380 EEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            +I++AT+M+ TLS DHR+VDGA+ ++L+  FK  IENPV M++
Sbjct: 425 GKIEIATMMSVTLSCDHRAVDGALGAELIGAFKTLIENPVMMMV 468


>gi|192291579|ref|YP_001992184.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Rhodopseudomonas palustris TIE-1]
 gi|192285328|gb|ACF01709.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodopseudomonas palustris TIE-1]
          Length = 468

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/464 (43%), Positives = 294/464 (63%), Gaps = 46/464 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM +G LAKW+K+EGDK+  GD++ EIETDKA ME E+ DEG + +I+VP G
Sbjct: 5   ILMPALSPTMEKGNLAKWLKKEGDKVKSGDVIAEIETDKATMEVEAADEGTLAKIIVPEG 64

Query: 66  TENIAVNSPILNILMDSTEI----------------PPSPPLSKENIVEV---REEHSH- 105
           T+++ VN  I  +  D  ++                P   P  +E         E +SH 
Sbjct: 65  TQDVPVNDVIAVLAADGEDVKAAGAGWKASAGGASSPQPSPQREEGAGPAGGKAEANSHI 124

Query: 106 --------------------SSP----VVVREKHSKNRPIASPLARRLAGEHGIDLSSLS 141
                                SP           +  R  ASPLARRLA + GID++ ++
Sbjct: 125 QDKADQRPTPQPPSPLPNGDRSPPQAAGEGAPAPANGRVFASPLARRLAKDAGIDIARVT 184

Query: 142 GSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI-DANILNLFAKDSYEVIPHDN 200
           G+GPHGR++  D+E   S        +   +   +  ++ D  I  L+ + SYEV+PHD 
Sbjct: 185 GTGPHGRVIARDVEQAKSGGGLKAAAAAPAAGPAIAPAMSDQQIRALYPEGSYEVVPHDG 244

Query: 201 IRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHRE-EISNKISVNDIIL 259
           +R+TIA RL QS QTIPHFY++IDCN+D L++ RE +N      ++ + + K+SVND I+
Sbjct: 245 MRRTIAQRLTQSTQTIPHFYLTIDCNLDRLMAAREDINAAAPKDKDGKPAYKLSVNDFII 304

Query: 260 KAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEV 319
           KA A+A+ ++P+ANVSWT   M++HKH DI VAV++PGG++TPIIR A+ +S+  IS ++
Sbjct: 305 KAMAIALQRIPDANVSWTEGGMLKHKHSDIGVAVAMPGGLITPIIRSAETQSLSSISAQM 364

Query: 320 KQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQN 379
           K  A RA+ RKLKPEEYQGGTT++SN+GM GI  F AVINPP +TILA+G GE++ + ++
Sbjct: 365 KDFAARARARKLKPEEYQGGTTAVSNLGMFGIKDFTAVINPPHATILAVGTGEQRPIARD 424

Query: 380 EEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            +I++AT+M+ TLS DHR+VDGA+ ++L+  FK  IENPV M++
Sbjct: 425 GKIEIATMMSVTLSCDHRAVDGALGAELIGAFKTLIENPVMMMV 468


>gi|90423992|ref|YP_532362.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Rhodopseudomonas palustris BisB18]
 gi|90106006|gb|ABD88043.1| Dihydrolipoamide acetyltransferase, long form [Rhodopseudomonas
           palustris BisB18]
          Length = 455

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/451 (44%), Positives = 293/451 (64%), Gaps = 33/451 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM +G L+KW+K+EGD +  GD+L EIETDKA ME E+VD+G + +I+VP G
Sbjct: 5   ILMPALSPTMEKGNLSKWLKKEGDAVKSGDVLAEIETDKATMEVEAVDDGTLAKIVVPEG 64

Query: 66  TENIAVNSPILNILMDSTEIP-----------------PSPPLSKENIVEVR-------- 100
           T+++ VN  I  +  +  ++                   SP  +  ++ + +        
Sbjct: 65  TQDVPVNDIIAVMASEGEDVKAAGAGASASKPAAAPAEKSPEKAAASVAQDKTAAPGAAK 124

Query: 101 -----EEHSHSSPVVVREK-HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDI 154
                 E    +PV   +  HS  R  +SPLARRLA + GI+L+ + GSGPHGR++  D+
Sbjct: 125 DAAPHAEEGAKAPVAKGDAAHSNGRVFSSPLARRLAKDAGIELTRIEGSGPHGRVIARDV 184

Query: 155 ETLISTKTNVKDYSTIQSFGLVDESI-DANILNLFAKDSYEVIPHDNIRKTIACRLQQSK 213
           E   S K      +   +      S+ D  I   + + SY+ +PHD++R+ IA RL Q+K
Sbjct: 185 EEAKSGKGLKAPAAAPSAAPQSAPSMSDQQIRGFYPEGSYDEVPHDSMRRIIAQRLVQAK 244

Query: 214 QTIPHFYVSIDCNIDNLLSLREQMNRTLQFHRE-EISNKISVNDIILKAFALAMIQVPEA 272
           QTIPHFY+++DCN+D L++ RE +N      ++ + + K+SVND I+KA ALA+ +VP+A
Sbjct: 245 QTIPHFYLTMDCNLDRLMAARETINAQAPKDKDGKPAYKLSVNDFIIKALALALQRVPDA 304

Query: 273 NVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLK 332
           NV+WT   M++H+  D+ VAVSIPGG++TP++R A  KS+  IS E+K  A RA+ R+LK
Sbjct: 305 NVTWTEGTMLKHRASDVGVAVSIPGGLITPVVRDAHLKSVSTISREMKDFAARARNRRLK 364

Query: 333 PEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATL 392
           PEEYQGGTT++SN+GM GI  F AVINPP  TILA+GAGE++ V  + +++VAT+M+ATL
Sbjct: 365 PEEYQGGTTAVSNLGMFGIKDFAAVINPPHVTILAVGAGEQRAVVIDGKVEVATVMSATL 424

Query: 393 SADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           S DHR+VDGA+ ++ LA FK  IENPV M++
Sbjct: 425 STDHRAVDGALGAEFLAAFKLLIENPVMMVV 455


>gi|304391617|ref|ZP_07373559.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Ahrensia sp. R2A130]
 gi|303295846|gb|EFL90204.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Ahrensia sp. R2A130]
          Length = 448

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/449 (45%), Positives = 295/449 (65%), Gaps = 36/449 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG LAKW+ +EGD +S GD++ EIETDKA ME E+VDEG++ +++VPAG
Sbjct: 5   ITMPALSPTMEEGNLAKWLVKEGDTVSAGDVIAEIETDKATMEVEAVDEGVVAKLMVPAG 64

Query: 66  TENIAVNSPILNILMD--------------STEIPPSPPLSKEN--------IVE--VRE 101
           TE + VN+ ++ +L +              +TE P   P + ++        I E    +
Sbjct: 65  TEGVKVNA-VIAVLAEEGEDASDIDAPQNAATEKPAETPHADDDPKTAPAPVIAEKSAND 123

Query: 102 EHSHSSPVVVR---EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETL- 157
              H  P V     ++    R  A+PLARR+A + G+DL+S+SGSGP GRIVK+D+E   
Sbjct: 124 AKGHGKPDVSATSAKRADGERIFATPLARRIAEQKGVDLASISGSGPRGRIVKADVENAQ 183

Query: 158 --ISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQT 215
              +TK      +  ++ G+ D+     +L L+  D+YE  PHD +RK IA RL +S QT
Sbjct: 184 PGAATKAAASGQTVSRASGMSDD----QVLALYDADAYEKKPHDGMRKVIAERLTESAQT 239

Query: 216 IPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVS 275
           IP ++V+++C +D LL+LR Q+N        + + KISVND I+KA A A+  VP +NVS
Sbjct: 240 IPSYFVTMECELDALLALRAQINAGAPDVDGKPAFKISVNDFIVKAMAHALQAVPMSNVS 299

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           WT+   I HKH D+ VAV++  G+ TPI+R+A+ KS+  IS EVK +A RA+ +KLKPEE
Sbjct: 300 WTSTDRIYHKHSDVGVAVAVEDGLFTPIVRKAETKSLSVISAEVKDMAGRARSKKLKPEE 359

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNE-EIKVATIMNATLSA 394
           YQGG+T++SN+GM G+  F ++INPP ++I++IGAGEKK V +++  I  AT+M AT + 
Sbjct: 360 YQGGSTAVSNLGMFGVREFTSIINPPHASIVSIGAGEKKAVVKSDGTIGAATLMAATFAF 419

Query: 395 DHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           DHR++DGA+ ++L + FK YIENP  ML+
Sbjct: 420 DHRAIDGALGAELASAFKRYIENPTAMLV 448


>gi|114327849|ref|YP_745006.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316023|gb|ABI62083.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex [Granulibacter bethesdensis
           CGDNIH1]
          Length = 416

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/435 (45%), Positives = 289/435 (66%), Gaps = 32/435 (7%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M  TI MP+LSPTMTEG LA+W+K+EGD I+ GD++ EIETDKA ME E+VDEG++  IL
Sbjct: 1   MATTILMPALSPTMTEGTLARWLKKEGDTITAGDVIAEIETDKATMEVEAVDEGVLGRIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIP-----PSPPLSKENIVEVREEHSHSSPVVVREK-- 114
           VP GTE +AVN+PI  ++ +   IP     P+P  +K + +   E    S P  +  K  
Sbjct: 61  VPDGTEGVAVNAPIAILVEEGEAIPDQGDIPAP--AKASAIPAAE---SSVPAKLEPKAI 115

Query: 115 ------HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYS 168
                  ++NR  ASPLARR+A E GIDL+SL+GSGP GRI+++D+E    T       S
Sbjct: 116 ASSGPDRTENRIFASPLARRIAKEAGIDLTSLTGSGPSGRILRADVEKAKGTGGKPASAS 175

Query: 169 TIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNID 228
           T                      +++++PH  +R+TIA RL ++KQTIPHFYV++D  +D
Sbjct: 176 TAAPA--------------ATGATHKLVPHSGMRRTIARRLTEAKQTIPHFYVTMDVALD 221

Query: 229 NLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHID 288
            LL LR  +N       +E + K+SVND+I+KA  LA+ +VP  N +W+ + ++  + +D
Sbjct: 222 ALLKLRADLNARSPAEGQEGAFKLSVNDLIIKAAGLALRRVPGVNAAWSEDGILLFEDVD 281

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           ISVAVSIP G++TPIIRQAD+K ++ IS E+K+LA RA++  L+P +YQGG  SISN+GM
Sbjct: 282 ISVAVSIPDGLITPIIRQADRKGVVSISTEMKELAARARKGGLQPSDYQGGGFSISNLGM 341

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLL 408
            G+  F A+INPPQ+ ILA+GAGE++ V ++  + VAT+M+ TLS DHR VDGA+ ++ L
Sbjct: 342 YGVRDFAAIINPPQAAILAVGAGEQRPVVRDGALAVATVMSCTLSVDHRVVDGALGAQWL 401

Query: 409 AKFKEYIENPVWMLM 423
             F++ +E+P+ +L+
Sbjct: 402 GAFRQIVEDPLSLLL 416


>gi|312114095|ref|YP_004011691.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311219224|gb|ADP70592.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 470

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 204/441 (46%), Positives = 286/441 (64%), Gaps = 24/441 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM +GKLAKW+K+EGDK++ GD + EIETDKA ME E+VDEG I +I+V  G
Sbjct: 29  ILMPALSPTMEQGKLAKWLKKEGDKVASGDAIAEIETDKATMEVEAVDEGTIGKIMVAEG 88

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSS-PVVVRE----------- 113
           TE +AVN+PI  +L +  +         E       + + +S PV V +           
Sbjct: 89  TEGVAVNTPIALLLGEGEDAAALKSYGAEPPQPAPAKAAQASEPVQVAKVNGAPAAAPQS 148

Query: 114 ----KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYS- 168
                H   R  ASPLARR+A + G+DL+++ G+GPHGRIVK D+E   +T +     + 
Sbjct: 149 NGHNGHDGGRVFASPLARRIAKDAGLDLAAVKGTGPHGRIVKHDVEEAKATGSAKPAAAA 208

Query: 169 --TIQSFGLVDESI-----DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYV 221
             T     LV   +     D  I+ ++ K +YE+ P DN+RKTIA RL Q+ QTIPHF +
Sbjct: 209 APTQNGGALVPSRLAAAIPDDQIIAMYEKGTYELRPLDNMRKTIATRLTQATQTIPHFRL 268

Query: 222 SIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAM 281
            ++C ID LL  R+++N       +  + K+SVND I+KA  LA+ +VP+AN ++T   +
Sbjct: 269 FVECEIDTLLEARQRINMRSPKDGQPGAFKVSVNDFIVKALGLALQRVPDANATFTERGI 328

Query: 282 IRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTT 341
           + HK  D+ VAV++ GG+ TP+IR  ++KS+ DIS EVK LA+RA++R+L P EYQGGTT
Sbjct: 329 LLHKASDVGVAVAVEGGLFTPVIRGVERKSLADISNEVKDLAERARKRRLAPHEYQGGTT 388

Query: 342 SISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDG 401
           ++SN+GM G+++F AVINPP +TILA+G GEK+ V +  +I +AT M  TLS DHR VDG
Sbjct: 389 AVSNLGMFGVDNFDAVINPPHATILAVGRGEKRPVVKGNQIVIATTMGCTLSCDHRVVDG 448

Query: 402 AIASKLLAKFKEYIENPVWML 422
           A+ ++LL  FK YIE PV ML
Sbjct: 449 ALGARLLQAFKGYIEEPVTML 469


>gi|229586781|ref|YP_002845282.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           africae ESF-5]
 gi|228021831|gb|ACP53539.1| Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rickettsia africae ESF-5]
          Length = 412

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 204/438 (46%), Positives = 289/438 (65%), Gaps = 50/438 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTMTEG LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I++P  
Sbjct: 5   ILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIVIPQN 64

Query: 66  TENIAVNSPILNILMDSTE--------------IPPSP------PLSKENIVEVREEHSH 105
           ++N+ VNS ++ +L +  E              + PSP      P   ENI  V E+   
Sbjct: 65  SQNVPVNS-LIAVLSEEGEEKTDIDAFIAKNNSVSPSPKTDANLPKPHENIANVEEQ--- 120

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
               V   KH  ++  ASPLA+RLA    I   S+ GSGPHGRIVK DI +   +  + K
Sbjct: 121 ----VTVIKHDASKIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQDILSYTPSTAHNK 176

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             S                      + Y ++P++NIRK IA RL +SKQT+PHFY+SI+C
Sbjct: 177 IVSR-------------------NPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIEC 217

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+D LL +RE +N+   F  E+ S +ISVND I+ A A A+ +VP AN SW  +A+  + 
Sbjct: 218 NVDKLLDIREDINK---FFSEDKSTRISVNDFIILAVAKALQEVPNANASWGEDAIRYYN 274

Query: 286 HIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
           ++DISVAV+I  G+VTPI++ A+QK+IL++S E+K L ++AK  KL PEE+QGG  +ISN
Sbjct: 275 NVDISVAVAIENGLVTPIVKNANQKNILELSREMKALIKKAKDNKLTPEEFQGGGFTISN 334

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIAS 405
           +GM GI +F A+INPPQS I+ +GA  K+ + +N++I +ATIM+ TLSADHR VDGA+ +
Sbjct: 335 LGMYGIKNFNAIINPPQSCIMGVGASAKRAIVKNDQITIATIMDVTLSADHRVVDGAVGA 394

Query: 406 KLLAKFKEYIENPVWMLM 423
           + LA FK++IE+PV ML+
Sbjct: 395 EFLAAFKKFIESPVLMLI 412


>gi|34580402|ref|ZP_00141882.1| dihydrolipoamide acetyltransferase component [Rickettsia sibirica
           246]
 gi|28261787|gb|EAA25291.1| dihydrolipoamide acetyltransferase component [Rickettsia sibirica
           246]
          Length = 412

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 200/432 (46%), Positives = 291/432 (67%), Gaps = 38/432 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTMTEG LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I++P  
Sbjct: 5   ILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIVIPQN 64

Query: 66  TENIAVNSPILNILMDSTE--------------IPPSPPLSKENIVEVREEHSHSSPVVV 111
           ++N+ VNS ++ +L +  E              + PSP  +  N+++ +E  ++    V 
Sbjct: 65  SQNVPVNS-LIAVLSEEGEEKTDIDAFIAKNNSVSPSPK-TDANLLKPQENIANVEEQVT 122

Query: 112 REKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
             KH  ++  ASPLA+RLA    I   S+ GSGPHGRIVK DI +   +  + K  S   
Sbjct: 123 VIKHDASKIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQDILSYTPSTAHNKIVSR-- 180

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
                              + Y ++P++NIRK IA RL +SKQT+PHFY+SI+CN+D LL
Sbjct: 181 -----------------NPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLL 223

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISV 291
            +RE +N+   F  E+ S +ISVND I+ A A A+ +VP AN SW  +A+  + ++DISV
Sbjct: 224 DIREDINK---FFSEDKSTRISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISV 280

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGI 351
           AV+I  G+VTPI++ A+QK+IL++S E+K L ++AK  KL PEE+QGG  +ISN+GM GI
Sbjct: 281 AVAIENGLVTPIVKNANQKNILELSREMKALIKKAKDNKLTPEEFQGGGFTISNLGMYGI 340

Query: 352 NSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKF 411
            +F A+INPPQS I+ +GA  K+ + +N++I +ATIM+ TLSADHR VDGA+ ++ LA F
Sbjct: 341 KNFNAIINPPQSCIMGVGASAKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLAAF 400

Query: 412 KEYIENPVWMLM 423
           K++IE+PV ML+
Sbjct: 401 KKFIESPVLMLI 412


>gi|15892687|ref|NP_360401.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           conorii str. Malish 7]
 gi|32129820|sp|Q92HK7|ODP2_RICCN RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component of pyruvate dehydrogenase complex; AltName:
           Full=Dihydrolipoamide acetyltransferase component of
           pyruvate dehydrogenase complex; AltName: Full=E2
 gi|15619860|gb|AAL03302.1| dihydrolipoamide acetyltransferase component [Rickettsia conorii
           str. Malish 7]
          Length = 412

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 204/438 (46%), Positives = 288/438 (65%), Gaps = 50/438 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTMTEG LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I++P  
Sbjct: 5   ILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIVIPQN 64

Query: 66  TENIAVNSPILNILMDSTE--------------IPPSP------PLSKENIVEVREEHSH 105
           ++N+ VNS ++ +L +  E              + PSP      P   ENI  V E+   
Sbjct: 65  SQNVPVNS-LIAVLSEEGEEKTDIDAFIAKNNSVSPSPKTDANLPKPHENIANVEEQ--- 120

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
               V   KH  +R  ASPLA+RLA    I   S+ GSGPHGRIVK DI +   +  + K
Sbjct: 121 ----VTVIKHDVSRIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQDILSYTPSTAHNK 176

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             S                      + Y ++P++NIRK IA RL +SKQT+PHFY+SI+C
Sbjct: 177 IVSR-------------------NPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIEC 217

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+D LL +RE +N+   F  E+ S +ISVND I+ A A A+ +VP AN SW  +A+  + 
Sbjct: 218 NVDKLLDIREDINK---FFSEDKSTRISVNDFIILAVAKALQEVPNANASWGEDAIRYYN 274

Query: 286 HIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
           ++DISVAV+I  G+VTPI++ A+QK+IL++S E+K L ++AK  KL PEE+QGG  +ISN
Sbjct: 275 NVDISVAVAIENGLVTPIVKNANQKNILELSREMKALIKKAKDNKLTPEEFQGGGFTISN 334

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIAS 405
           +GM GI +F A+INPPQS I+ +GA  K+ + +N++I +ATIM+ TLSADHR VDGA+ +
Sbjct: 335 LGMYGIKNFNAIINPPQSCIMGVGASAKRAIVKNDQITIATIMDVTLSADHRVVDGAVGA 394

Query: 406 KLLAKFKEYIENPVWMLM 423
           + L  FK++IE+PV ML+
Sbjct: 395 EFLVAFKKFIESPVLMLI 412


>gi|148261803|ref|YP_001235930.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Acidiphilium cryptum JF-5]
 gi|146403484|gb|ABQ32011.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Acidiphilium cryptum JF-5]
          Length = 425

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 207/428 (48%), Positives = 283/428 (66%), Gaps = 9/428 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEG LA+W+K+EG+ I  GD++ EIETDKA ME E+VDEG++ +IL
Sbjct: 1   MATNILMPALSPTMTEGTLARWLKKEGETIKAGDVIAEIETDKATMEVEAVDEGVLGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKN--- 118
           V AG+EN+AVN+PI  ++     +P S P +         E   +         ++    
Sbjct: 61  VAAGSENVAVNAPIAILVEPGEAVPDSAPAAPAPKPAAAPEPVAAPAPAAAAPAAETTGH 120

Query: 119 --RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLV 176
             R  ASPLARR+A + GIDL++L GSGP+GRIVK+DI+    +       +        
Sbjct: 121 GPRVFASPLARRMAQQAGIDLATLKGSGPNGRIVKADIDAARGSGPEAAAPAPKAPA-AA 179

Query: 177 DESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
             +  A          ++ IPH ++RK IA RLQ +KQTIPHFY+S+D  +D LL LR +
Sbjct: 180 PPAQAAAAPAAPITAPHDAIPHSSMRKVIAKRLQAAKQTIPHFYLSMDVELDALLKLRAE 239

Query: 237 MNRTLQFHREEISN-KISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSI 295
           +N   Q  +E     K+SVND+I+KA A+A+ +VP AN S+T  AMIR+  +DISVAV+I
Sbjct: 240 LNA--QSPKEGPGAFKLSVNDLIIKAVAVALRRVPAANASFTEEAMIRYHDVDISVAVAI 297

Query: 296 PGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFC 355
           P G++TPIIR+ADQK +  IS E+K LA RAK  KLKP+E+QGG+ SISN+GM GI+SF 
Sbjct: 298 PDGLITPIIRKADQKGLAAISNEMKDLAARAKAGKLKPDEFQGGSFSISNLGMYGISSFS 357

Query: 356 AVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYI 415
           A+INPPQ  ILAIGAGEK+ V + E+I +AT+M  TLS DHR VDGA+ ++ LA FK  +
Sbjct: 358 AIINPPQGGILAIGAGEKRPVVKGEQIAIATMMTVTLSCDHRVVDGAVGAEFLAAFKSIV 417

Query: 416 ENPVWMLM 423
           E P+ +++
Sbjct: 418 ERPLGLML 425


>gi|154253579|ref|YP_001414403.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Parvibaculum lavamentivorans DS-1]
 gi|154157529|gb|ABS64746.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Parvibaculum lavamentivorans DS-1]
          Length = 430

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 203/441 (46%), Positives = 291/441 (65%), Gaps = 30/441 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW  +EGD++  GD++ EIETDKA ME E+VDEG I ++L
Sbjct: 1   MPTNILMPALSPTMEEGTLAKWHVKEGDEVKSGDVIAEIETDKATMEVEAVDEGRIGKLL 60

Query: 62  VPAGTENIAVNSPILNILMDSTE---IPPSPPLSKEN--------IVEVREEHSHSSPVV 110
           V  GTE +AVN PI  +L +  E   I  +PP  K+           EV +  S ++P  
Sbjct: 61  VAEGTEGVAVNKPIAILLEEGEEAADIDNAPPPKKDEPKTSAKPEAKEVEKPRSSATPSS 120

Query: 111 ------VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNV 164
                  +   + +R  ASPLARR+A + GIDLS++SGSGP+GRIVK+D+E         
Sbjct: 121 DGNARPTQATGTGHRVFASPLARRIAEQQGIDLSAISGSGPNGRIVKADLEGAAKAAPKK 180

Query: 165 KDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
           +    +       +SID      +A+ ++E +  D +R+TIA RL QS Q IPHFY++ID
Sbjct: 181 QAAGAVAQ--GAAQSIDPRAY--YAEGTFEEVSLDGMRRTIARRLTQSMQEIPHFYLTID 236

Query: 225 CNIDNLLSLREQMNRTLQFHREEISN--KISVNDIILKAFALAMIQVPEANVSWTTNAMI 282
           C +D LL  R+++N       +E     K+SVND +++A ALA+I+VP+ANVS+  NA++
Sbjct: 237 CELDELLKARKKLN-------DEAGEGVKLSVNDFLIRAAALALIKVPDANVSFAGNALL 289

Query: 283 RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTS 342
           +HK  DI +AV++ GG++TPIIR AD+K + +IS E K+LA+RA+ +KLKP EY+GG+ S
Sbjct: 290 KHKSADIGIAVALEGGLITPIIRNADKKGLAEISNEAKELAERARNKKLKPNEYEGGSFS 349

Query: 343 ISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGA 402
           ISN+GM GI  F AVINPPQ+ ILA+G GE++ V +N +++VATIM  T+S DHR++DGA
Sbjct: 350 ISNLGMFGIKHFTAVINPPQAAILAVGKGEERPVVRNGKVEVATIMTVTMSCDHRAIDGA 409

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ L  F+ ++E P  ML+
Sbjct: 410 LGARFLEAFRSFVEYPARMLL 430


>gi|238650228|ref|YP_002916079.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           peacockii str. Rustic]
 gi|238624326|gb|ACR47032.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           peacockii str. Rustic]
          Length = 412

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 203/438 (46%), Positives = 288/438 (65%), Gaps = 50/438 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTMTEG LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I++P  
Sbjct: 5   ILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIVIPQN 64

Query: 66  TENIAVNSPILNILMDSTE--------------IPPSP------PLSKENIVEVREEHSH 105
           ++N+ VNS ++ +L +  E              + PSP      P   ENI  V E+   
Sbjct: 65  SQNVPVNS-LIAVLSEEGEEKTDIDAFIAKNNSVSPSPKTDANLPKPHENITNVEEQ--- 120

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
               V   KH  ++  ASPLA+RLA    I   S+ GSGPHGRIVK DI +      + K
Sbjct: 121 ----VTVIKHDASKIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQDILSYTPNTAHNK 176

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             S                      + Y ++P++NIRK IA RL +SKQT+PHFY+SI+C
Sbjct: 177 IVSR-------------------NPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIEC 217

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+D LL +RE +N++     E+ S +ISVND I+ A A A+ +VP AN SW  +A+  + 
Sbjct: 218 NVDKLLDIREDINKSFS---EDKSTRISVNDFIILAVAKALQEVPNANASWGEDAIRYYN 274

Query: 286 HIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
           ++DISVAV+I  G+VTPI++ A+QK+IL++S E+K L ++AK  KL PEE+QGG  +ISN
Sbjct: 275 NVDISVAVAIENGLVTPIVKNANQKNILELSREMKALIKKAKDNKLTPEEFQGGGFTISN 334

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIAS 405
           +GM GI +F A+INPPQS I+ +GA  K+ + +N++I +ATIM+ TLSADHR VDGA+ +
Sbjct: 335 LGMYGIKNFNAIINPPQSCIMGVGASAKRAIVKNDQITIATIMDVTLSADHRVVDGAVGA 394

Query: 406 KLLAKFKEYIENPVWMLM 423
           + LA FK++IE+PV ML+
Sbjct: 395 EFLAAFKKFIESPVLMLI 412


>gi|326405306|ref|YP_004285388.1| pyruvate dehydrogenase E2 component [Acidiphilium multivorum
           AIU301]
 gi|325052168|dbj|BAJ82506.1| pyruvate dehydrogenase E2 component [Acidiphilium multivorum
           AIU301]
          Length = 428

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 207/431 (48%), Positives = 282/431 (65%), Gaps = 12/431 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEG LA+W+K+EG+ I  GD++ EIETDKA ME E+VDEG++ +IL
Sbjct: 1   MATNILMPALSPTMTEGTLARWLKKEGETIKAGDVIAEIETDKATMEVEAVDEGVLGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKN--- 118
           V AG+EN+AVN+PI  ++     +P S P +         E   +         +     
Sbjct: 61  VAAGSENVAVNAPIAILVEPGEAVPDSAPAAPAPKPAAAPEPVAAPAPAAAAPAAPAAET 120

Query: 119 -----RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSF 173
                R  ASPLARR+A + GIDL++L GSGP+GRIVK+DI+    +       +     
Sbjct: 121 TGHGPRVFASPLARRMAQQAGIDLATLKGSGPNGRIVKADIDAARGSAPEAAAPAPKAPA 180

Query: 174 GLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSL 233
                +  A          ++ IPH ++RK IA RLQ +KQTIPHFY+S+D  +D LL L
Sbjct: 181 -AAPPAQAAAAPAAPITAPHDAIPHSSMRKVIAKRLQAAKQTIPHFYLSMDVELDALLKL 239

Query: 234 REQMNRTLQFHREEISN-KISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVA 292
           R ++N   Q  +E     K+SVND+I+KA A+A+ +VP AN S+T  AMIR+  +DISVA
Sbjct: 240 RAELNA--QSPKEGPGAFKLSVNDLIIKAVAVALRRVPAANASFTEEAMIRYHDVDISVA 297

Query: 293 VSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGIN 352
           V+IP G++TPIIR+ADQK +  IS E+K LA RAK  KLKP+E+QGG+ SISN+GM GI+
Sbjct: 298 VAIPDGLITPIIRKADQKGLAAISNEMKDLAARAKAGKLKPDEFQGGSFSISNLGMYGIS 357

Query: 353 SFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFK 412
           SF A+INPPQ  ILAIGAGEK+ V + E+I +AT+M  TLS DHR VDGA+ ++ LA FK
Sbjct: 358 SFSAIINPPQGGILAIGAGEKRPVVKGEQIAIATVMTVTLSCDHRVVDGAVGAEFLAAFK 417

Query: 413 EYIENPVWMLM 423
             +E P+ +++
Sbjct: 418 SIVEQPLGLML 428


>gi|67459153|ref|YP_246777.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           felis URRWXCal2]
 gi|75536415|sp|Q4ULG1|ODP2_RICFE RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component of pyruvate dehydrogenase complex; AltName:
           Full=Dihydrolipoamide acetyltransferase component of
           pyruvate dehydrogenase complex; AltName: Full=E2
 gi|67004686|gb|AAY61612.1| Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rickettsia felis URRWXCal2]
          Length = 412

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 201/438 (45%), Positives = 290/438 (66%), Gaps = 50/438 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP LSPTMTEG LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I++P  
Sbjct: 5   ILMPVLSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIVIPQN 64

Query: 66  TENIAVNSPILNILMDSTE--------------IPPSP------PLSKENIVEVREEHSH 105
           ++N+ VNS ++ +L +  E              + PSP      P   ENI +V E+   
Sbjct: 65  SQNVPVNS-LIAVLSEEGEEKTDIDAFIAKNNNVSPSPKTDANLPKPHENIAKVEEQ--- 120

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
               V   KH  ++  ASPLA+RLA    I L S+ GSGPHGRIVK DI +   +  + K
Sbjct: 121 ----VAVIKHDASKIFASPLAKRLAKMGNIRLESVKGSGPHGRIVKQDILSYTPSTVHNK 176

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             S                      + Y ++P++NIRK IA RL +SKQT+PHFY+SI+C
Sbjct: 177 IVSR-------------------NPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIEC 217

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+D LL +RE +N++     E+ S +ISVND I+ A A A+ ++P AN SW  +A+  H 
Sbjct: 218 NVDKLLDIREDINKSFS---EDKSTRISVNDFIILAVAKALQELPNANASWGEDAIRYHN 274

Query: 286 HIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
           ++DISVAV+I  G+VTPI++ A+QK+I+++S E+K+L ++AK  KL PEE+QGG  +ISN
Sbjct: 275 NVDISVAVAIENGLVTPIVKNANQKNIIELSREMKELIKKAKDNKLTPEEFQGGGFTISN 334

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIAS 405
           +GM GI +F A+INPPQS I+ +GA  K+ + +N+++ +ATIM+ TLSADHR VDGA+ +
Sbjct: 335 LGMYGIKNFNAIINPPQSCIMGVGASAKRAIVKNDQVTIATIMDVTLSADHRVVDGAVGA 394

Query: 406 KLLAKFKEYIENPVWMLM 423
           + LA FK++IE+P  ML+
Sbjct: 395 EFLAAFKKFIESPALMLI 412


>gi|319407101|emb|CBI80738.1| dihydrolipoamide acetyltransferase [Bartonella sp. 1-1C]
          Length = 440

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 201/437 (45%), Positives = 296/437 (67%), Gaps = 20/437 (4%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG L+KW  +EGDK++ GD++ EIETDKA ME E++DEG + +I++PAG
Sbjct: 5   ITMPALSPTMEEGNLSKWNIKEGDKVACGDVIAEIETDKATMEVEAIDEGTVAKIVIPAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENI-VEVREE--------------HSHSSPVV 110
           T+ + VNS I+ +  +  ++  +  +++E+  VE++E+              H  ++  +
Sbjct: 65  TQGVKVNSLIVILAEEGEDLSEAAKIAEESSSVEMKEQVVKQSMEAASVQVVHLSTNQKL 124

Query: 111 VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
            ++        ASPLARRLA +  IDLS +SG+GPH RI+K D+E  ++          I
Sbjct: 125 AKQNGDNKGLFASPLARRLAAQAAIDLSLISGTGPHKRIIKRDVEKALNDGIASSHLLHI 184

Query: 171 QSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNL 230
               +V  + D  IL LF +  Y   PHDN+RKTIA RL  SKQ +PHFYV++DC +D L
Sbjct: 185 DQ-SIVSGTSDRQILQLFKESEYTFAPHDNMRKTIAKRLVASKQMVPHFYVTVDCELDAL 243

Query: 231 LSLREQMNRTLQF----HREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           L LR Q+N            + + K+SVND+I+KA AL++  +P+ANVSW  + M+ H+H
Sbjct: 244 LELRTQLNAIAPMVEIQEGMKPAYKLSVNDMIIKAVALSLKAIPDANVSWLEDGMLHHRH 303

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
            D+ VAVS+P G++ PIIR A++KS+  IS E+K LA RA++RKL+ EEYQGGTT++SNM
Sbjct: 304 CDVGVAVSVPNGLMVPIIRCAEEKSLSIISNEMKDLATRARERKLRMEEYQGGTTAVSNM 363

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASK 406
           GM GI +F A+INPP +TI AIG+GEK+ + ++E + +AT+M+ TLS DHR++DGA+A++
Sbjct: 364 GMYGIKNFSAIINPPHATIFAIGSGEKRAIIKDEALAIATVMSVTLSVDHRAIDGALAAE 423

Query: 407 LLAKFKEYIENPVWMLM 423
           +   FK+ IENP+ ML+
Sbjct: 424 VAQTFKKIIENPLTMLI 440


>gi|157828567|ref|YP_001494809.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|157801048|gb|ABV76301.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           rickettsii str. 'Sheila Smith']
          Length = 412

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 199/432 (46%), Positives = 290/432 (67%), Gaps = 38/432 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTMTEG LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I++P  
Sbjct: 5   ILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIVIPQN 64

Query: 66  TENIAVNSPILNILMDSTE--------------IPPSPPLSKENIVEVREEHSHSSPVVV 111
           ++N+ VNS ++ +L +  E              + PSP  +  N+++  E  ++    V 
Sbjct: 65  SQNVPVNS-LIAVLSEEGEEKTDIDAFIAKNNSVSPSPK-TDANLLKPHESITNVEEQVT 122

Query: 112 REKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
             KH  ++  ASPLA+RLA    I   S+ GSGPHGRIVK DI +   +  + K  S   
Sbjct: 123 VIKHDASKIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQDILSYTPSTAHNKIVSR-- 180

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
                              + Y ++P++NIRK IA RL +SKQT+PHFY+SI+CN+D LL
Sbjct: 181 -----------------NPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLL 223

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISV 291
            +RE +N++     E+ S +ISVND I+ A A A+ +VP AN SW  +A+  + ++DISV
Sbjct: 224 DIREDINKSFS---EDKSTRISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISV 280

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGI 351
           AV+I  G+VTPI++ A+QK+IL++S E+K L ++AK  KL PEE+QGG  +ISN+GM GI
Sbjct: 281 AVAIENGLVTPIVKNANQKNILELSREMKALIKKAKDNKLTPEEFQGGGFTISNLGMYGI 340

Query: 352 NSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKF 411
            +F A+INPPQS I+ +GA  K+ + +N++I +ATIM+ TLSADHR VDGA+ ++ LA F
Sbjct: 341 KNFNAIINPPQSCIMGVGAIAKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLAAF 400

Query: 412 KEYIENPVWMLM 423
           K++IE+PV ML+
Sbjct: 401 KKFIESPVLMLI 412


>gi|165933281|ref|YP_001650070.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           rickettsii str. Iowa]
 gi|165908368|gb|ABY72664.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex [Rickettsia rickettsii str. Iowa]
          Length = 412

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 199/432 (46%), Positives = 290/432 (67%), Gaps = 38/432 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTMTEG LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I++P  
Sbjct: 5   ILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIVIPQN 64

Query: 66  TENIAVNSPILNILMDSTE--------------IPPSPPLSKENIVEVREEHSHSSPVVV 111
           ++N+ VNS ++ +L +  E              + PSP  +  N+++  E  ++    V 
Sbjct: 65  SQNVPVNS-LIAVLSEEGEEKTDIDAFIAKNNSVSPSPK-TDANLLKPHENITNVEEQVT 122

Query: 112 REKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
             KH  ++  ASPLA+RLA    I   S+ GSGPHGRIVK DI +   +  + K  S   
Sbjct: 123 VIKHDASKIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQDILSYTPSTAHNKIVSR-- 180

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
                              + Y ++P++NIRK IA RL +SKQT+PHFY+SI+CN+D LL
Sbjct: 181 -----------------NPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLL 223

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISV 291
            +RE +N++     E+ S +ISVND I+ A A A+ +VP AN SW  +A+  + ++DISV
Sbjct: 224 DIREDINKSFS---EDKSTRISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISV 280

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGI 351
           AV+I  G+VTPI++ A+QK+IL++S E+K L ++AK  KL PEE+QGG  +ISN+GM GI
Sbjct: 281 AVAIENGLVTPIVKNANQKNILELSREMKALIKKAKDNKLTPEEFQGGGFTISNLGMYGI 340

Query: 352 NSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKF 411
            +F A+INPPQS I+ +GA  K+ + +N++I +ATIM+ TLSADHR VDGA+ ++ LA F
Sbjct: 341 KNFNAIINPPQSCIMGVGAIAKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLAAF 400

Query: 412 KEYIENPVWMLM 423
           K++IE+PV ML+
Sbjct: 401 KKFIESPVLMLI 412


>gi|159184758|ref|NP_354438.2| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Agrobacterium tumefaciens str. C58]
 gi|159140046|gb|AAK87223.2| dihydrolipoamide acetyltransferase [Agrobacterium tumefaciens str.
           C58]
          Length = 405

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 199/411 (48%), Positives = 272/411 (66%), Gaps = 42/411 (10%)

Query: 49  FESVDEGIIDEILVPAGTENIAVNSPILNILMDSTEIP---------------PSPPLSK 93
            E+VDEG + +++VPAGTE + VN+ I  +  +  ++                P P  +K
Sbjct: 1   MEAVDEGTVAKLVVPAGTEAVKVNALIAILAAEGEDVAEAAKGGDAVPAKAEAPKPEAAK 60

Query: 94  -----ENIVEVREEH-------SHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLS 141
                E    V+ E        + S+P  V +  S  R  ASPLARRLA E G+DLS++S
Sbjct: 61  AEAPKEEAAPVKAEKPVADQAAASSTPAPVAK--SGERIFASPLARRLAKEAGLDLSAVS 118

Query: 142 GSGPHGRIVKSDIETLISTKTNVKDYSTIQSF---------GLVDESIDANILNLFAKDS 192
           GSGPHGRIVK+D+E   ++       +   S          G  DE++    L LF + S
Sbjct: 119 GSGPHGRIVKTDVEKAAASGGAKAAPAAAASAGAPAPALAKGQSDEAV----LKLFEQGS 174

Query: 193 YEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKI 252
           YE++PHD +RK IA RL +SKQT+PHFYVS+DC +D LL+LR Q+N        +   K+
Sbjct: 175 YELVPHDGMRKVIAKRLVESKQTVPHFYVSVDCELDTLLALRAQLNAAAPEKDGKPVYKL 234

Query: 253 SVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSI 312
           SVND+++KA ALA+  VP+ANVSWT +AM++HKH D+ VAVSIPGG++TPIIR+A++KS+
Sbjct: 235 SVNDMVIKALALALRDVPDANVSWTESAMVKHKHADVGVAVSIPGGLITPIIRKAEEKSL 294

Query: 313 LDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGE 372
             IS E+K   +RAK+RKLKPEEYQGGTT++SNMGM+G+ SF AVINPP +TILA+GAGE
Sbjct: 295 STISNEMKDYGKRAKERKLKPEEYQGGTTAVSNMGMMGVKSFSAVINPPHATILAVGAGE 354

Query: 373 KKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           ++ V +N EIK+A +M  TLS DHR VDGA+ ++L+  FK YIENP+ ML+
Sbjct: 355 QRAVVKNGEIKIANVMTVTLSTDHRCVDGALGAELIGAFKRYIENPMGMLV 405


>gi|13473129|ref|NP_104696.1| dihydrolipoamide acetyltransferase homoserine dehydrogenase
           [Mesorhizobium loti MAFF303099]
 gi|14023877|dbj|BAB50482.1| dihydrolipoamide acetyltransferase homoserine dehydrogenase
           [Mesorhizobium loti MAFF303099]
          Length = 454

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 204/461 (44%), Positives = 288/461 (62%), Gaps = 54/461 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P +   M  G++++W  +EG ++  GD+L EIETDKA ME ++   G++ ++    G
Sbjct: 5   VILPKVDMDMATGQISRWFAEEGARVKKGDVLFEIETDKAAMEIDAPASGVLRDVSGKEG 64

Query: 66  TENIAVNSPILNILMD-----------------------STE---IPPS-----PPLSKE 94
             +I V +P+  I  D                       STE   +PP+     PP +  
Sbjct: 65  V-DIPVGAPVAWIYADDEAYGAKQDAAPISPLVGEMSAKSTEGDVVPPTSHSVMPPSALP 123

Query: 95  NIVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDI 154
            I   R E   S P    E+       A+PLARRLA E G+ L+ + G+GPHGR+VK+D+
Sbjct: 124 GISPTRGEIGQSPP---GER-------ATPLARRLAREAGLALAGIIGTGPHGRVVKADV 173

Query: 155 ETLISTKTNVKDYSTIQSFGL--------VDESIDANILNLFAKDSYEVIPHDNIRKTIA 206
           +  I+        +     G         V    D  +L LF + SYE++PHDN+RKTIA
Sbjct: 174 DAAIAGGGAKAAPAAKAPAGAPAAAPAPAVKPMSDDQVLKLFEQGSYELVPHDNMRKTIA 233

Query: 207 CRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISN----KISVNDIILKAF 262
            RL ++K TIPHFY+++DC +D LL+LR Q+N      + E  +    K+SVND+++KA 
Sbjct: 234 RRLVEAKSTIPHFYLTLDCELDALLALRTQINAAAPMKKTEKGDVPAYKLSVNDMVIKAM 293

Query: 263 ALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQL 322
           A+A+  VP+AN SWT  AM++HKH D+ VAVSIPGG++TPIIR AD+K++  IS E+K L
Sbjct: 294 AMALKAVPDANASWTETAMVKHKHADVGVAVSIPGGLITPIIRHADEKTLSTISNEMKDL 353

Query: 323 AQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEI 382
           A RA+ RKLKPEEYQGGTT++SN+GM GI  F AVINPP +TILA+GAGE++ V +N EI
Sbjct: 354 ASRARSRKLKPEEYQGGTTAVSNLGMFGIKDFAAVINPPHATILAVGAGEERAVVKNGEI 413

Query: 383 KVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           K+AT+M+ TLS DHR+VDGA+ ++LL  FK  IENP+ ML+
Sbjct: 414 KIATVMSVTLSTDHRAVDGALGAELLVAFKRLIENPMGMLV 454


>gi|329113473|ref|ZP_08242254.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Acetobacter pomorum DM001]
 gi|326697298|gb|EGE48958.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Acetobacter pomorum DM001]
          Length = 415

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 199/434 (45%), Positives = 279/434 (64%), Gaps = 31/434 (7%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEGKLA+W+K+EGD ++ GD+L EIETDKA ME E+++EGI+  IL
Sbjct: 1   MATEILMPALSPTMTEGKLARWLKKEGDAVNSGDVLAEIETDKATMEVEAIEEGILGRIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREE------------HSHSSPV 109
           V  G E +AVN+PI  IL++  E  P    +  N+                   + ++P 
Sbjct: 61  VQEGAEGVAVNTPIA-ILVEEGEAVPDNIDTPNNVASAAPATASQPAAASAPIATQAAPA 119

Query: 110 VVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYST 169
             R      R +ASPLARR+A +  IDL++L G+GP+GRIVK D+E  ++   +    ++
Sbjct: 120 Q-RADKPVGRVVASPLARRIARQKNIDLAALKGTGPNGRIVKRDVEAALNKAPDAGQVAS 178

Query: 170 IQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
             +                A      +PH  +RK IA RL +SK TIPHFYVSID  +D 
Sbjct: 179 APT----------------ASGGSRAVPHTTMRKVIARRLSESKSTIPHFYVSIDVELDA 222

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDI 289
           LL+LR Q+N  +       + K+SVND+++KA A+A+ QVPE N S+T +AMI H+  DI
Sbjct: 223 LLALRSQLN-AMSPAEGADAFKLSVNDMLIKASAVALKQVPEVNASYTEDAMILHEDADI 281

Query: 290 SVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGML 349
           SVAVS+  G++TPI++QAD+KS+ DIS E K L  RA+  KLKPEE+QGGT SISNMGM 
Sbjct: 282 SVAVSLDDGLITPIVKQADRKSLKDISQEAKDLISRARAGKLKPEEFQGGTFSISNMGMY 341

Query: 350 GINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLA 409
           G+  F A++NPPQ+ ILAI AG+K+ V +  E+ +AT+M  TLS DHR VDGA A++ L+
Sbjct: 342 GVKDFAAIVNPPQAAILAIAAGKKQAVVKGNELAIATVMTVTLSVDHRVVDGAAAARWLS 401

Query: 410 KFKEYIENPVWMLM 423
            F+  +E+P+ +++
Sbjct: 402 AFRAAVESPLSLVL 415


>gi|157964579|ref|YP_001499403.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           massiliae MTU5]
 gi|157844355|gb|ABV84856.1| Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rickettsia massiliae MTU5]
          Length = 412

 Score =  385 bits (988), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 197/432 (45%), Positives = 289/432 (66%), Gaps = 38/432 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTMTEG LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I++P  
Sbjct: 5   ILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIVIPQN 64

Query: 66  TENIAVNSPILNILMDSTE--------------IPPSPPLSKENIVEVREEHSHSSPVVV 111
           ++N+ VNS ++ +L +  E              + PSP  +  N+++  E  ++    V 
Sbjct: 65  SQNVPVNS-LIAVLSEEGEEKTDIDAFIAKNNSVSPSPK-TDANLLKPHENIANVEEQVT 122

Query: 112 REKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
             KH  ++  ASPLA+RLA    I   S+ GSGPHGRIVK DI +   +  + K  S   
Sbjct: 123 VIKHDASKIFASPLAKRLAKMGNIRFESVKGSGPHGRIVKQDILSYTPSTAHNKIVSR-- 180

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
                              + Y ++P++NIRK IA RL +SKQT+PHFY+SI+CN+D LL
Sbjct: 181 -----------------NPEEYRLVPNNNIRKIIAKRLFESKQTVPHFYLSIECNVDKLL 223

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISV 291
            +RE +N++     E+ S +ISVND I+ A A A+ +VP AN SW  +A+  + ++DISV
Sbjct: 224 DIREDINKSFS---EDKSTRISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISV 280

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGI 351
           AV+I  G+VTPI++ A+QK+IL++S E+K+L ++AK  KL PEE+QGG  +ISN+GM GI
Sbjct: 281 AVAIENGLVTPIVKNANQKNILELSREMKELIKKAKDNKLTPEEFQGGGFTISNLGMYGI 340

Query: 352 NSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKF 411
            +F A+INPPQ  I+ +GA  K+ + +N++I +ATIM+ TLSADHR VDGA+ ++ LA F
Sbjct: 341 KNFNAIINPPQGCIMGVGASAKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLAAF 400

Query: 412 KEYIENPVWMLM 423
           K++IE+P  ML+
Sbjct: 401 KKFIESPALMLI 412


>gi|46202384|ref|ZP_00053285.2| COG0508: Pyruvate/2-oxoglutarate dehydrogenase complex,
           dihydrolipoamide acyltransferase (E2) component, and
           related enzymes [Magnetospirillum magnetotacticum MS-1]
          Length = 415

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 194/421 (46%), Positives = 271/421 (64%), Gaps = 11/421 (2%)

Query: 8   MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTE 67
           MP+LSPTMTEG LAKW+K EGD +  GDILCEIETDKA MEFE+VDEG++ +ILV  GT 
Sbjct: 1   MPALSPTMTEGNLAKWLKNEGDAVKSGDILCEIETDKATMEFEAVDEGVLGKILVAGGTS 60

Query: 68  NIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREK-----HSKNRPIA 122
            +AVN+PI  +L +  +            V      + +             H  +R +A
Sbjct: 61  GVAVNTPIAVLLEEGEDASAISAAPAPKAVAAPASVAAAPIAAAPAAAPAAAHGGDRVVA 120

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
           SPLA+R+A +  +DL ++ GSGPHGRIVK+D+E  I         +T  +     +   A
Sbjct: 121 SPLAKRIAKDGNVDLKAVKGSGPHGRIVKADVEAAIKAGPAKPAAATPAAAAAAPKPAPA 180

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
                  + ++E IP+ ++RK IA RL ++K TIPHFY+SIDC +D+LL +R  +N    
Sbjct: 181 PASASPFEPAFEEIPNSSMRKVIARRLTEAKSTIPHFYLSIDCELDSLLKVRADLNGRSD 240

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
            +      K+SVND +++A ALA+ +VP AN SW  +A+ R+K +DISVAV+ P G++TP
Sbjct: 241 AY------KLSVNDFVVRAVALALKKVPAANASWGEDAIKRYKDVDISVAVATPSGLITP 294

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           I+  AD K + +IS E+K LA +A+  KLKPEE+QGG  +ISN+GM GI  F A+INPPQ
Sbjct: 295 IVHHADHKGLAEISNEMKALAGKARDNKLKPEEFQGGGFTISNLGMFGIKDFAAIINPPQ 354

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
             ILA+GAGE++ V +   + VAT+M  TLS DHR VDGA+ ++ LA FK+ IE+P+ ML
Sbjct: 355 GCILAVGAGEQRPVVKAGALAVATVMTCTLSVDHRVVDGAVGAEFLAAFKKLIEDPLSML 414

Query: 423 M 423
           +
Sbjct: 415 L 415


>gi|157825816|ref|YP_001493536.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           akari str. Hartford]
 gi|157799774|gb|ABV75028.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           akari str. Hartford]
          Length = 412

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 198/438 (45%), Positives = 289/438 (65%), Gaps = 50/438 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTMT G LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I++P  
Sbjct: 5   ILMPALSPTMTAGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIVIPQN 64

Query: 66  TENIAVNSPILNILMDSTE--------------IPPSP------PLSKENIVEVREEHSH 105
           ++N+ VNS ++ +L ++ E              + PSP      P   ENI +V E+   
Sbjct: 65  SQNVPVNS-LIAVLSEAREEKADIDAFIAKNNNVSPSPKPDTNLPKHHENIAKVEEQ--- 120

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
               V   KH  ++  ASPLA+RLA    I L S+ GSGPHGRIVK D+ +   +  + K
Sbjct: 121 ----VAVIKHDTSKIFASPLAKRLAKMGNIKLESVKGSGPHGRIVKQDVLSYTPSTVHNK 176

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             S                      + Y ++P++NIRK IA RL +SKQT+PHFY+SI+C
Sbjct: 177 IVSR-------------------NPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIEC 217

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+D LL +RE +N++     E+ + +ISVND I+ A A A+  VP AN SW  +A+  + 
Sbjct: 218 NVDKLLDIREDINKSFS---EDKATRISVNDFIILAVAKALQAVPNANASWREDAIRYYN 274

Query: 286 HIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
           ++DISVAV+I  G+VTPI++ A+QK+I++IS E+K+L ++AK  KL PEE+QGG  +ISN
Sbjct: 275 NVDISVAVAIENGLVTPIVKNANQKNIIEISREMKKLIKKAKDNKLTPEEFQGGGFTISN 334

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIAS 405
           +GM G+ +F A+INPPQS I+ +GA  K+ + +N++I + TIM+ TLSADHR VDGA+ +
Sbjct: 335 LGMYGVKNFNAIINPPQSCIMGVGASAKRAIVKNDQITIETIMDVTLSADHRVVDGAVGA 394

Query: 406 KLLAKFKEYIENPVWMLM 423
           + LA FK++IE+P  ML+
Sbjct: 395 EFLAAFKKFIESPALMLI 412


>gi|209963468|ref|YP_002296383.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodospirillum centenum SW]
 gi|209956934|gb|ACI97570.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodospirillum centenum SW]
          Length = 468

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 206/479 (43%), Positives = 289/479 (60%), Gaps = 76/479 (15%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTMTEGKLA+W+K+EGD++  GD+L EIETDKA ME E+VDEG +  IL+  G
Sbjct: 5   ILMPALSPTMTEGKLARWLKKEGDEVKAGDVLAEIETDKATMEVEAVDEGRLARILIGDG 64

Query: 66  TENIAVNSPILNIL------------------------------MDSTEIP--------- 86
           TE +AVN+PI  I                                D+   P         
Sbjct: 65  TEGVAVNTPIGLIAEEGEDMSAAADGGKAPPPAAPAPREGATGPADAAVAPKPGQTATGP 124

Query: 87  -----PSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLS 141
                PS P S+E     R  H         E+   +R  ASPLARR+A + G+DL+SLS
Sbjct: 125 VGGASPSLPESREPAAPAR--HGGG------EQDGHDRVFASPLARRMAQQAGLDLASLS 176

Query: 142 GSGPHGRIVKSDIETLISTKTNVKDYS-----------------TIQSFGLVDESIDANI 184
           GSGP GRIVK+DIE  ++     K+ +                    + G     IDA  
Sbjct: 177 GSGPQGRIVKADIEAALARGPQQKEAARSATKPSPAPAAPSAAPQPAAAGAAPRGIDARD 236

Query: 185 LNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFH 244
                   Y V+P+  +RKTIA RL ++ QTIPHF +++D  ID LL+LR ++N      
Sbjct: 237 YADRLGMPYTVLPNSGMRKTIARRLTEAWQTIPHFALTVDLEIDRLLALRAELN------ 290

Query: 245 REEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPII 304
            E    K+SVND ++KA ALA+ +VP ANVSW  + +++++++D+SVAV+  GG++TPI+
Sbjct: 291 -ERSGEKVSVNDFVVKAAALALRKVPAANVSWHEDGILQYENVDVSVAVATEGGLITPIV 349

Query: 305 RQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQST 364
           R AD+K +  IS EVK LAQ+A+  KLKPEE+QGGT S+SN+GM GI +F ++INPPQS 
Sbjct: 350 RNADRKGLSTISAEVKALAQKARDGKLKPEEFQGGTFSVSNLGMFGIRTFTSIINPPQSC 409

Query: 365 ILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           IL++GAGEK+ V + + + +AT+M+ TLS DHRSVDGA+ ++ L  F++ IE+P+ M++
Sbjct: 410 ILSVGAGEKRAVVKGDALAIATVMSCTLSVDHRSVDGAVGAEFLKVFRQLIEDPITMML 468


>gi|258542310|ref|YP_003187743.1| dihydrolipoamide acetyltransferase component [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256633388|dbj|BAH99363.1| dihydrolipoamide acetyltransferase component [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256636447|dbj|BAI02416.1| dihydrolipoamide acetyltransferase component [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256639500|dbj|BAI05462.1| dihydrolipoamide acetyltransferase component [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256642556|dbj|BAI08511.1| dihydrolipoamide acetyltransferase component [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256645611|dbj|BAI11559.1| dihydrolipoamide acetyltransferase component [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256648664|dbj|BAI14605.1| dihydrolipoamide acetyltransferase component [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256651717|dbj|BAI17651.1| dihydrolipoamide acetyltransferase component [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256654708|dbj|BAI20635.1| dihydrolipoamide acetyltransferase component [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 414

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 197/439 (44%), Positives = 276/439 (62%), Gaps = 42/439 (9%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEGKLA+W+K+EGD ++ GD+L EIETDKA ME E+++EGI+  IL
Sbjct: 1   MATEILMPALSPTMTEGKLARWLKKEGDTVNSGDVLAEIETDKATMEVEAIEEGILGRIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIP-----------------PSPPLSKENIVEVREEHS 104
           +  G E +AVN+PI  ++ +   +P                 P P  S     +      
Sbjct: 61  IQEGAEGVAVNTPIAILVEEGEAVPDNIDTPKNVASAEPAPVPQPVASAPVAAQAAPAQR 120

Query: 105 HSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNV 164
              PV         R +ASPLARR+A +  IDL+++ G+GP+GRIVK D+E  ++   + 
Sbjct: 121 ADKPV--------GRVVASPLARRIARQKNIDLAAIKGTGPNGRIVKRDVEAALNKAPSA 172

Query: 165 KDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
              ++                 L A      +PH  +RK IA RL +SK TIPHFYVSID
Sbjct: 173 GQVAS----------------ALPASGGSSAVPHTTMRKVIARRLSESKATIPHFYVSID 216

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
             +D LL+LR Q+N  +       + K+SVND+++KA A+A+ QVPE N S+T +AMI H
Sbjct: 217 VELDALLALRAQLN-AMSPAEGADAFKLSVNDMLIKASAVALKQVPEVNASYTEDAMILH 275

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           +  DISVAVS+  G++TPI++QAD+KS+ DIS E K L  RA+  KLKPEE+QGGT SIS
Sbjct: 276 EDADISVAVSLDDGLITPIVKQADRKSLKDISQEAKDLIARARAGKLKPEEFQGGTFSIS 335

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIA 404
           NMGM G+  F A++NPPQ+ ILAI AG+K+ V +  E+ +AT+M  TLS DHR VDGA A
Sbjct: 336 NMGMYGVKDFAAIVNPPQAAILAIAAGKKQAVVKGNELAIATVMTVTLSVDHRVVDGAAA 395

Query: 405 SKLLAKFKEYIENPVWMLM 423
           ++ L+ F+  +E+P+ +++
Sbjct: 396 ARWLSAFRTAVESPLSLVL 414


>gi|239947715|ref|ZP_04699468.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921991|gb|EER22015.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 412

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 200/438 (45%), Positives = 289/438 (65%), Gaps = 50/438 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTMT G LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I++P  
Sbjct: 5   ILMPALSPTMTGGNLARWLKKEGDKVNPGEVIVEIETDKATMEVEAVDEGILAKIVIPQN 64

Query: 66  TENIAVNSPILNILMDSTE--------------IPPSP------PLSKENIVEVREEHSH 105
           ++N+ VNS ++ +L +  E              + P P      P   ENI  V E+ + 
Sbjct: 65  SQNVPVNS-LIAVLSEEGEEKTDIDAFIAKNNSVSPLPKTDTNLPKPHENIANVEEQGA- 122

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
               V+  KH  ++   SPLA+RLA    I L S+ GSGPHGRIVK DI +  S+  + K
Sbjct: 123 ----VI--KHDTSKIFTSPLAKRLAKMGNIRLESVKGSGPHGRIVKQDILSYTSSTVHNK 176

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             S                      + Y ++P++NIRK IA RL +SKQT+PHFY+SI+C
Sbjct: 177 IVSR-------------------NPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIEC 217

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+D LL +RE +N++     E+ S KISVND I+ A A A+ +VP AN SW  +A+  + 
Sbjct: 218 NVDKLLDIREDINKSFS---EDKSTKISVNDFIILAVAKALQEVPNANASWGEDAIRYYN 274

Query: 286 HIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
           ++DISVAV+I  G+VTPI++ A+QK+I+++S E+K+L ++AK  KL PEE+QGG  +ISN
Sbjct: 275 NVDISVAVAIENGLVTPIVKNANQKNIIELSREMKELIKKAKDNKLTPEEFQGGGFTISN 334

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIAS 405
           +GM GI +F A+INPPQS I+ +G+  K+ + +N++I +ATIM+ TLSADHR VDGA  +
Sbjct: 335 LGMYGIKNFNAIINPPQSCIMGVGSSSKRAIVKNDQITIATIMDVTLSADHRVVDGAAGA 394

Query: 406 KLLAKFKEYIENPVWMLM 423
           + LA FK++IE+P  ML+
Sbjct: 395 EFLAAFKKFIESPALMLI 412


>gi|85706334|ref|ZP_01037428.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Roseovarius sp. 217]
 gi|85669107|gb|EAQ23974.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Roseovarius sp. 217]
          Length = 435

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 201/439 (45%), Positives = 284/439 (64%), Gaps = 31/439 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+V+EG++ ++LV  G
Sbjct: 5   ILMPALSPTMEEGTLAKWLVKEGDTVSAGDLLAEIETDKATMEFEAVEEGVVGKLLVAEG 64

Query: 66  TENIAVNSPILNILMD---STEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKN---- 118
           TE + VN+PI  +L D   +++I  +P  +K +     E  S  SP    +K  +     
Sbjct: 65  TEGVKVNTPIAVMLEDGESASDIGSAPAKAKTS-----EAPSEKSPEAAPQKADEAKPAP 119

Query: 119 ---------RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYST 169
                    R  ASPLARR+A + GIDL+ + GSGPHGRIVK+D+E   S+   VKD + 
Sbjct: 120 AAAKSGDGARIFASPLARRIAADKGIDLAGIKGSGPHGRIVKADVEGAKSSTAPVKDAAK 179

Query: 170 IQSFGLVDESIDAN-----ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
                    SI +      ++ ++    YE +  D +RKTIA RL ++KQT+PHFY+  +
Sbjct: 180 PADKAPAPASIASGPSSDAVIAMYQGREYEEVKLDGMRKTIAARLTEAKQTVPHFYLRRE 239

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
             +D L+  R  +N+ L+        K+SVND I+KA ALA+  VP+AN  W  + ++R 
Sbjct: 240 IRLDALMKFRADLNKQLEAR----GVKLSVNDFIIKACALALQAVPDANAVWAGDKVLRL 295

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           K  D++VAV+I GG+ TP+++ A+ KS+  +S E+K LA+RA+ RKL P+EYQGGT +IS
Sbjct: 296 KPSDVAVAVAIEGGLFTPVLKDAEMKSLSALSAEMKDLAKRARDRKLAPQEYQGGTFAIS 355

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAI 403
           N+GM GI +F AVINPP   ILA+GAG KK VV ++ E+ VAT+M+ TLS DHR +DGA+
Sbjct: 356 NLGMFGIENFDAVINPPHGAILAVGAGLKKPVVGKDGELSVATVMSVTLSVDHRVIDGAL 415

Query: 404 ASKLLAKFKEYIENPVWML 422
            ++LL K  E +ENP+ ML
Sbjct: 416 GAELLGKIVENLENPLVML 434


>gi|157803731|ref|YP_001492280.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           canadensis str. McKiel]
 gi|157784994|gb|ABV73495.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           canadensis str. McKiel]
          Length = 418

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 194/436 (44%), Positives = 292/436 (66%), Gaps = 40/436 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTMTEG L++W+K EGDK++PG+++ EIETDKA ME E+VDEGI+ +I++P  
Sbjct: 5   ILMPALSPTMTEGNLSRWLKNEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIVIPQN 64

Query: 66  TENIAVNSPI------------LN--ILMDSTEIPPSPPLSKENIVEVRE----EHSHSS 107
           ++N+ VNS I            +N  I  +S+ +P     +  N+++  E    ++S+  
Sbjct: 65  SQNVPVNSLIAVLSEEGEDIDDINGFIAKNSSVLPSLKADADANLLKSTEDIAVQYSNVE 124

Query: 108 PVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDY 167
             V    H+K++  ASPLA+RLA    I L S+ GSGPHGRI+K DI  L  T + V + 
Sbjct: 125 EQVAVTNHNKSKIFASPLAKRLAKIQNIRLESVKGSGPHGRIIKQDI--LSYTPSTVPNK 182

Query: 168 STIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNI 227
             I++                  + Y ++P++NIRK IA R+ +SKQ +PHFY+SI+CN+
Sbjct: 183 IVIRN-----------------PEEYHLVPNNNIRKIIAKRVLESKQAVPHFYLSIECNV 225

Query: 228 DNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI 287
           D LL +RE +N++     E+ S +ISVND I+ A A A+ +VP AN SW  +A+  + ++
Sbjct: 226 DKLLEIREDINKSFS---EDNSTRISVNDFIILAIAKALQEVPNANASWGKDAIRYYNNV 282

Query: 288 DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMG 347
           DI+VAV+I  G+VTPI++ ADQK+I+++S E+K+L ++AK  KL PEE+QGG  +ISN+G
Sbjct: 283 DIAVAVAIENGLVTPIVKNADQKNIIELSHEMKELIKKAKDNKLTPEEFQGGGFTISNLG 342

Query: 348 MLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKL 407
           M GI +F A+INPPQS I+ +G+  K+ + +N++I +ATIM+ TLSADHR +DG + ++ 
Sbjct: 343 MYGIKNFNAIINPPQSCIMGVGSSSKRAIVKNDQINIATIMDVTLSADHRVIDGVVGAEF 402

Query: 408 LAKFKEYIENPVWMLM 423
           LA FK++IE P  ML+
Sbjct: 403 LAAFKKFIERPALMLL 418


>gi|163852208|ref|YP_001640251.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Methylobacterium extorquens PA1]
 gi|163663813|gb|ABY31180.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Methylobacterium extorquens PA1]
          Length = 470

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 200/466 (42%), Positives = 285/466 (61%), Gaps = 48/466 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G LAKW+K+EGD I  GD++ EIETDKA ME E+VDEG++ +ILV  G
Sbjct: 5   VLMPALSPTMEKGNLAKWLKKEGDAIKSGDVIAEIETDKATMEVEAVDEGVLAKILVAEG 64

Query: 66  TENIAVNSPILNILMD-----STEIPPSPPLSKENIVEVR--------EEHSHSSPVVVR 112
           T ++ VN  I  I  +     S + P     +K   VE +         + SH+S   V 
Sbjct: 65  TADVPVNELIALIAEEGEDPGSVQAPKGGAEAKTAPVEPKGTPDQNAAPDGSHASYARVD 124

Query: 113 E-------------KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
           +               S +R  ASPLARR+A + G+DLS++ GSGPHGR+++ D++  I 
Sbjct: 125 QVPEGAKPNGAAQPAGSGDRVFASPLARRIAKQEGVDLSAVKGSGPHGRVIQRDVQAAIE 184

Query: 160 TKTNVKDYSTIQSFGLVDESIDA---------------------NILNLFAKDSYEVIPH 198
             T   D +         +S  A                      +   + K S+E +P 
Sbjct: 185 NGTAKADAAAKPEAKSEAKSAPAPEKTAPKAASGGGAPAGLSLDQVKGFYEKGSFEEVPL 244

Query: 199 DNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHRE-EISNKISVNDI 257
           D +RKTIA RL ++ Q  PHFY+++DC +D L+ LRE +N +    ++ +   K+SVND 
Sbjct: 245 DGMRKTIAKRLTEAMQVAPHFYLTVDCELDALMKLRETLNNSAGKDKDGKPLFKLSVNDF 304

Query: 258 ILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISL 317
           ++KA  LA+ +VP AN  W  + ++R  H ++ VAV+I GG+ TP+IR+ADQK++  IS 
Sbjct: 305 VIKAMGLALTRVPAANAVWAEDRILRFTHAEVGVAVAIDGGLFTPVIRKADQKTLSTISN 364

Query: 318 EVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF 377
           E+K  A RA+ +KLKPEEYQGG TS+SN+GM GI  F AVINPPQS+ILA+GAGEK+VV 
Sbjct: 365 EMKDFAGRARAKKLKPEEYQGGVTSVSNLGMFGIKHFTAVINPPQSSILAVGAGEKRVVV 424

Query: 378 QNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           ++ +  VA +M ATLS DHR +DGA+ ++L+A FK  IENP+ ML+
Sbjct: 425 KDGQPTVAQVMTATLSCDHRVLDGALGAELIAAFKGLIENPMGMLV 470


>gi|240139538|ref|YP_002964014.1| dihydrolipoamide acetyltransferase [Methylobacterium extorquens
           AM1]
 gi|22652785|gb|AAN03813.1|AF497851_3 dihydrolipoamide acetyltransferase [Methylobacterium extorquens
           AM1]
 gi|240009511|gb|ACS40737.1| dihydrolipoamide acetyltransferase [Methylobacterium extorquens
           AM1]
          Length = 470

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 200/466 (42%), Positives = 285/466 (61%), Gaps = 48/466 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G LAKW+K+EGD I  GD++ EIETDKA ME E+VDEG++ +ILV  G
Sbjct: 5   VLMPALSPTMEKGNLAKWLKKEGDAIKSGDVIAEIETDKATMEVEAVDEGVLAKILVAEG 64

Query: 66  TENIAVNSPILNILMD-----STEIPPSPPLSKENIVEVR--------EEHSHSSPVVVR 112
           T ++ VN  I  I  +     S + P     +K   VE +         + SH+S   V 
Sbjct: 65  TADVPVNELIALIAEEGEDPGSVQAPKGGAEAKTAPVEPKGTPDQNAAPDGSHASYARVD 124

Query: 113 E-------------KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
           +               S +R  ASPLARR+A + G+DLS++ GSGPHGR+++ D++  I 
Sbjct: 125 QVPEGAKPNGAAQPAGSGDRVFASPLARRIAKQEGVDLSAVKGSGPHGRVIQRDVQAAIE 184

Query: 160 TKTNVKDYSTIQSFGLVDESIDA---------------------NILNLFAKDSYEVIPH 198
             T     +         +S  A                      +   + K S+E +P 
Sbjct: 185 NGTAKAGAAAKPEAKSEGKSAPAPEKSAPKAAAAGGAPAGLSLDQVKGFYEKGSFEEVPL 244

Query: 199 DNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHRE-EISNKISVNDI 257
           D +RKTIA RL ++ Q  PHFY+++DC +D L+ LRE +N +    ++ +   K+SVND 
Sbjct: 245 DGMRKTIAKRLTEAMQVAPHFYLTVDCELDALMKLRETLNGSAGKDKDGKPLFKLSVNDF 304

Query: 258 ILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISL 317
           ++KA  LA+ +VP AN  W  + ++R KH ++ VAV+I GG+ TP+IR+ADQK++  IS 
Sbjct: 305 VIKAMGLALTRVPAANAVWAEDRILRFKHAEVGVAVAIDGGLFTPVIRKADQKTLSTISN 364

Query: 318 EVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF 377
           E+K  A RA+ +KLKPEEYQGG TS+SN+GM GI  F AVINPPQS+ILA+GAGEK+VV 
Sbjct: 365 EMKDFAGRARAKKLKPEEYQGGVTSVSNLGMFGIKHFTAVINPPQSSILAVGAGEKRVVV 424

Query: 378 QNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           ++ +  VA +M ATLS DHR +DGA+ ++L+A FK  IENP+ ML+
Sbjct: 425 KDGQPTVAQVMTATLSCDHRVLDGALGAELIAAFKGLIENPMGMLV 470


>gi|91205115|ref|YP_537470.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           bellii RML369-C]
 gi|122425947|sp|Q1RJT3|ODP2_RICBR RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component of pyruvate dehydrogenase complex; AltName:
           Full=Dihydrolipoamide acetyltransferase component of
           pyruvate dehydrogenase complex; AltName: Full=E2
 gi|91068659|gb|ABE04381.1| Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rickettsia bellii RML369-C]
          Length = 418

 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 198/436 (45%), Positives = 289/436 (66%), Gaps = 43/436 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTMTEG LA+W+K+EGDKI+PG+++ EIETDKA ME E+VDEG + +I++P G
Sbjct: 5   LLMPALSPTMTEGNLARWLKKEGDKINPGEVIAEIETDKATMEVEAVDEGTLAKIIIPQG 64

Query: 66  TENIAVNSPILNILMDSTEI--------------PPSPPLSK--ENIV--EVREEHSHSS 107
           ++N+ VNS I  ++ +  E+              P    +SK  E I    V+EE+    
Sbjct: 65  SQNVPVNSLIAVLIEEGEELSGIEEFIAKNNSNSPKKEEISKPAETIAPQNVKEEN---- 120

Query: 108 PVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDY 167
            +      +  +  ASPLA+RLA    + +  + GSGPHGRI+K D+   +S K   K  
Sbjct: 121 -ITTASDQNNIKVFASPLAKRLAKIQNVRIEEIKGSGPHGRIIKQDV---LSHKGGSK-- 174

Query: 168 STIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNI 227
                  L ++ +  N       + Y + P++NIRK IA RL +SKQT+PHFY+SI+CN+
Sbjct: 175 ------ALSNKIVSRN------PEEYRLAPNNNIRKIIAKRLLESKQTVPHFYLSIECNV 222

Query: 228 DNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI 287
           D LL +RE +N++     ++ S KISVND I+ A A A+ +VP AN SW  +A+  + ++
Sbjct: 223 DKLLDIREDINKSFG---DDKSAKISVNDFIILAVAKALQEVPNANASWGDDAIRYYNNV 279

Query: 288 DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMG 347
           DISVAV+I  G+VTPIIR ADQK+I+D+S E+K L ++A++ KL PEE+QGG  +ISN+G
Sbjct: 280 DISVAVAIENGLVTPIIRNADQKNIVDLSSEMKGLIKKARENKLTPEEFQGGGFTISNLG 339

Query: 348 MLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKL 407
           M GI +F A+INPPQS I+ +G+  K+ + +N++I +ATIM+ TLSADHR VDGA+ ++ 
Sbjct: 340 MYGIKNFNAIINPPQSCIMGVGSSSKRAIVKNDQISIATIMDVTLSADHRVVDGAVGAEF 399

Query: 408 LAKFKEYIENPVWMLM 423
           LA FK +IE+P  ML+
Sbjct: 400 LAAFKRFIESPALMLL 415


>gi|319781198|ref|YP_004140674.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167086|gb|ADV10624.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 464

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 193/461 (41%), Positives = 287/461 (62%), Gaps = 44/461 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P +   M  G++++W  +EG  +  GD+L EIETDKA ME ++   G++ ++    G
Sbjct: 5   VILPKVDMDMATGQISRWFAEEGAHVKKGDVLFEIETDKAAMEIDAPASGVLRDVTGKEG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVR------EEHSHSSPVVVREKHSKNR 119
             +IAV + +  I  D          +K+++  +          S     V    HS   
Sbjct: 65  V-DIAVGAAVAWIYADGEAYGADAAAAKQDVAPISTPAGEMSTKSTEGGAVAPTSHSVTH 123

Query: 120 PI-------------------------ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDI 154
           P                          A+PLARRLA E G++LS++SG+GPHGR+VK+D+
Sbjct: 124 PSALPSLPPLGISPTRGEIGQSPSAGRATPLARRLAREAGLNLSTVSGTGPHGRVVKADV 183

Query: 155 ETLISTKTNVKDYSTIQSFGLVDESI--------DANILNLFAKDSYEVIPHDNIRKTIA 206
           +  I+        +     G+   +         D  +L LF + SY+++PHDN+RKTIA
Sbjct: 184 DAAIAGGGAQAAPAAKAPAGVPAAAPAAPVKAMSDDQVLKLFEQGSYDLVPHDNMRKTIA 243

Query: 207 CRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISN----KISVNDIILKAF 262
            RL ++K TIPHFY+++DC +D LL+LR Q+N      + +  +    K+SVND+++KA 
Sbjct: 244 RRLVEAKTTIPHFYLTLDCELDALLALRTQINAAAPVKKTDKGDAPAYKLSVNDMVIKAM 303

Query: 263 ALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQL 322
           A+A+  VP+AN SWT +AM++HKH D+ VAVSIPGG++TPIIR+AD+K++  IS E+K L
Sbjct: 304 AMALKAVPDANASWTESAMVKHKHADVGVAVSIPGGLITPIIRKADEKTLSTISNEMKDL 363

Query: 323 AQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEI 382
           A RA+ RKLKPEEYQGGTT++SN+GM GI  F AVINPP +TILA+GAGE++ V +N EI
Sbjct: 364 ASRARSRKLKPEEYQGGTTAVSNLGMFGIKDFAAVINPPHATILAVGAGEERAVVKNGEI 423

Query: 383 KVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           ++AT+M+ TLS DHR+VDGA+ ++LL  FK  +ENP+ +L+
Sbjct: 424 RIATMMSVTLSTDHRAVDGALGAELLVAFKNLLENPMGLLV 464


>gi|58040716|ref|YP_192680.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase [Gluconobacter oxydans 621H]
 gi|58003130|gb|AAW62024.1| Dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase [Gluconobacter oxydans 621H]
          Length = 403

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 195/420 (46%), Positives = 274/420 (65%), Gaps = 21/420 (5%)

Query: 8   MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTE 67
           MP+LSPTMTEGKLA+W+K EGD +S GD++ EIETDKA ME E+VDEGI+  IL+  G E
Sbjct: 1   MPALSPTMTEGKLARWLKAEGDTVSAGDVIAEIETDKATMEVEAVDEGILSRILIQEGVE 60

Query: 68  NIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH---SHSSPVVVREKHSKNRPIASP 124
            I VN+PI  ++ D   +P +         +        + ++P     +    R   SP
Sbjct: 61  GIPVNTPIAVLVEDGEAVPEASSTQAPAAPKAEAAPAVLTGTAPAKAAPEEKGERIFVSP 120

Query: 125 LARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST-KTNVKDYSTIQSFGLVDESIDAN 183
           LARR+A E GI L +L+GSGP+GRI+K D+E  ++  KT+ K   +       +E++   
Sbjct: 121 LARRMARERGIALDALTGSGPNGRILKRDVEKGVTAPKTSPKAAPSAAPLAASEETV--- 177

Query: 184 ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQF 243
                       +P+  +RK IA RL +SK  +PHFYVS+D  +D LL LR ++N T Q 
Sbjct: 178 ----------RHVPNSTMRKVIARRLTESKTQVPHFYVSVDIELDALLDLRAKLNATAQ- 226

Query: 244 HREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPI 303
              E S KISVND+++KA ALA+ +VP  NV +T    +  +++DIS+AVS+P G++TPI
Sbjct: 227 ---ENSFKISVNDMMIKAVALALKKVPGVNVQFTDAETLHFENVDISMAVSVPDGLITPI 283

Query: 304 IRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQS 363
           IR AD+KS+  IS+E K LA+RA+  KLKPEE+QGGT SISNMGM G+  F A+INPPQ+
Sbjct: 284 IRNADRKSLRQISVEAKDLAKRARAGKLKPEEFQGGTFSISNMGMFGVREFAAIINPPQA 343

Query: 364 TILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            ILAI +GEK+ V +  EI VAT+M ATLS DHR+VDGA+ ++ L   ++ ++NP  +++
Sbjct: 344 GILAIASGEKRAVVRGSEIAVATVMTATLSVDHRAVDGALGAEWLNALRDIVQNPYTLVV 403


>gi|254561954|ref|YP_003069049.1| dihydrolipoamide acetyltransferase [Methylobacterium extorquens
           DM4]
 gi|254269232|emb|CAX25198.1| dihydrolipoamide acetyltransferase [Methylobacterium extorquens
           DM4]
          Length = 470

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 199/467 (42%), Positives = 289/467 (61%), Gaps = 50/467 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G LAKW+K+EGD +  GD++ EIETDKA ME E+VDEG++ +ILV  G
Sbjct: 5   VLMPALSPTMEKGNLAKWLKKEGDAVKSGDVIAEIETDKATMEVEAVDEGVLAKILVAEG 64

Query: 66  TENIAVNSPILNILMDSTEIPPS---PPLSKENIVEVRE-----------EHSHSSPVVV 111
           T ++ VN  ++ ++ +  E P S   P    E  +   E           + SH+S   V
Sbjct: 65  TADVPVNE-LIALIAEEGEDPGSVQAPKGGAEAKIAPVEPKGTPDQNAAPDGSHASYARV 123

Query: 112 RE-------------KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI 158
            +               S +R  ASPLARR+A + G+DLS++ GSGPHGR+++ D++  I
Sbjct: 124 DQVPEGAKPNGAAQPAGSGDRVFASPLARRIAKQEGVDLSAVKGSGPHGRVIQRDVQAAI 183

Query: 159 STKT-------NVKDYSTIQSFGLVDESIDA--------------NILNLFAKDSYEVIP 197
              T         +  S  +S    ++S                  +   + K S+E +P
Sbjct: 184 ENGTAKAGAEAKPEAKSEAKSAPAPEKSAPKAAAAGGAPAGLSLDQVKGFYEKGSFEEVP 243

Query: 198 HDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHRE-EISNKISVND 256
            D +RKTIA RL ++ Q  PHFY+++DC +D L+ LRE +N +    ++ +   K+SVND
Sbjct: 244 LDGMRKTIAKRLTEAMQVAPHFYLTVDCELDALMKLRETLNGSAGKDKDGKPLFKLSVND 303

Query: 257 IILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDIS 316
            ++KA  LA+ +VP AN  W  + ++R KH ++ VAV+I GG+ TP+IR+ADQK++  IS
Sbjct: 304 FVIKAMGLALTRVPAANAVWAEDRILRFKHAEVGVAVAIDGGLFTPVIRKADQKTLSTIS 363

Query: 317 LEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVV 376
            E+K  A RA+ +KLKPEEYQGG TS+SN+GM GI  F AVINPPQS+ILA+GAGEK+VV
Sbjct: 364 NEMKDFAGRARAKKLKPEEYQGGVTSVSNLGMFGIKHFTAVINPPQSSILAVGAGEKRVV 423

Query: 377 FQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            ++ +  VA +M ATLS DHR +DGA+ ++L+A FK  IENP+ ML+
Sbjct: 424 VKDGQPTVAQVMTATLSCDHRVLDGALGAELIAAFKGLIENPMGMLV 470


>gi|218530967|ref|YP_002421783.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Methylobacterium chloromethanicum CM4]
 gi|218523270|gb|ACK83855.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Methylobacterium chloromethanicum CM4]
          Length = 470

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 203/469 (43%), Positives = 289/469 (61%), Gaps = 54/469 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G LAKW+K+EGD I  GD++ EIETDKA ME E+VDEG++ +ILV  G
Sbjct: 5   VLMPALSPTMEKGNLAKWLKKEGDAIKSGDVIAEIETDKATMEVEAVDEGVLAKILVAEG 64

Query: 66  TENIAVNSPILNILMD-----STEIPPSPPLSKENIVEVR--------EEHSHSSPVVVR 112
           T ++ VN  I  I  +     S + P     +K   VE +         + SH+S   V 
Sbjct: 65  TADVPVNELIALIAEEGEDPGSVQAPKGGAEAKTAPVEPKGTPDQNAAPDGSHASYARVD 124

Query: 113 E-------------KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
           +               S +R  ASPLARR+A + G+DLS++ GSGPHGR+++ D++  I 
Sbjct: 125 QVPEGAKPNGAAQPAGSGDRVFASPLARRIAKQEGVDLSAVKGSGPHGRVIQRDVQAAIE 184

Query: 160 T------------------------KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEV 195
                                    KT  K  S   +   +  S+D  +   + K S+E 
Sbjct: 185 GGTAKAGAAAKPEAKSEARSAPAPEKTAPKAASGGGAPAGL--SLD-QVKGFYEKGSFEE 241

Query: 196 IPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHRE-EISNKISV 254
           +P D +RKTIA RL ++ Q  PHFY+++DC +D L+ LRE +N +    ++ +   K+SV
Sbjct: 242 VPLDGMRKTIAKRLTEAMQVAPHFYLTVDCELDALMKLRETLNGSAGKDKDGKPLFKLSV 301

Query: 255 NDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILD 314
           ND ++KA  LA+ +VP AN  W  + ++R KH ++ VAV+I GG+ TP+IR+ADQK++  
Sbjct: 302 NDFVIKAMGLALTRVPAANAVWAEDRILRFKHAEVGVAVAIDGGLFTPVIRKADQKTLST 361

Query: 315 ISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKK 374
           IS E+K  A RA+ +KLKPEEYQGG TS+SN+GM GI  F AVINPPQS+ILA+GAGEK+
Sbjct: 362 ISNEMKDFAGRARAKKLKPEEYQGGVTSVSNLGMFGIKHFTAVINPPQSSILAVGAGEKR 421

Query: 375 VVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           VV ++ +  VA +M ATLS DHR +DGA+ ++L+A FK  IENP+ ML+
Sbjct: 422 VVVKDGQPTVAQVMTATLSCDHRVLDGALGAELIAAFKGLIENPMGMLV 470


>gi|15604387|ref|NP_220903.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           prowazekii str. Madrid E]
 gi|7674152|sp|Q9ZD20|ODP2_RICPR RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component of pyruvate dehydrogenase complex; AltName:
           Full=Dihydrolipoamide acetyltransferase component of
           pyruvate dehydrogenase complex; AltName: Full=E2
 gi|3861079|emb|CAA14979.1| DIHYDROLIPOAMIDE ACETYLTRANSFERASE COMPONENT (pdhC) [Rickettsia
           prowazekii]
 gi|292572143|gb|ADE30058.1| Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rickettsia prowazekii Rp22]
          Length = 408

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 197/427 (46%), Positives = 288/427 (67%), Gaps = 32/427 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LA+W+K+EGDK++PG+++ EIETDKA ME ESVDEGI+ +I++P  
Sbjct: 5   ILMPALSPTMREGNLARWLKKEGDKVNPGEVIAEIETDKATMEVESVDEGILAKIIIPQN 64

Query: 66  TENIAVNSPILNILMDSTE--------IPPSPPLSKENIVEVREEHSHSSPVVVRE-KHS 116
           ++N+ VNS ++ +L +  E        I  +  +S     +   + S+ S   V   KH 
Sbjct: 65  SQNVPVNS-LIAVLSEEGEDKADIDSFIAQNNSVSLSLKTDATLKKSNDSITNVEGIKHD 123

Query: 117 KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLV 176
            N+  ASPLA+RLA    I L ++ GSGPHGRIVK DI +                    
Sbjct: 124 SNKIFASPLAKRLAKIGDIRLENVQGSGPHGRIVKQDILSY------------------- 164

Query: 177 DESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
           D S  +N +     + Y  +P++NIRK IA RL +SKQT+PHFY+SI+CN+D LL +RE 
Sbjct: 165 DSSTSSNKIVYRDTEEYRSVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDVRED 224

Query: 237 MNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIP 296
           +N++  F  ++++ KISVND I+ A A A+ +VP AN SW+ +A+  + ++DISVAV+I 
Sbjct: 225 INKS--FSEDKVT-KISVNDFIILAVAKALQEVPNANASWSEDAIRYYNNVDISVAVAIE 281

Query: 297 GGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCA 356
            GIVTPI++ A++K+I+++S E+K L ++AK  KL P E+QGG  +ISN+GM GI +F A
Sbjct: 282 NGIVTPIVKDANKKNIIELSREMKTLIKKAKDNKLTPIEFQGGGFTISNLGMYGIKNFNA 341

Query: 357 VINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIE 416
           +IN PQS I+ +GA  K+ + +N++I +ATIM+ TLSADHR +DGA++++ LA FK +IE
Sbjct: 342 IINTPQSCIMGVGASTKRAIVKNDQIIIATIMDVTLSADHRVIDGAVSAEFLASFKRFIE 401

Query: 417 NPVWMLM 423
           NPV ML+
Sbjct: 402 NPVLMLI 408


>gi|170747424|ref|YP_001753684.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Methylobacterium radiotolerans JCM 2831]
 gi|170653946|gb|ACB23001.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Methylobacterium radiotolerans JCM 2831]
          Length = 477

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 195/478 (40%), Positives = 281/478 (58%), Gaps = 65/478 (13%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G LAKW+K+EGD I  GD+L EIETDKA ME E++DEG++ +ILVP G
Sbjct: 5   VLMPALSPTMEKGNLAKWLKKEGDPIKSGDVLAEIETDKATMEVEAIDEGVLAKILVPEG 64

Query: 66  TENIAVNSPILNILMDSTEIP--------PSPPLSKENIVEVREE--------------- 102
           T ++ VN  ++ I+    E P        P    + E   E + E               
Sbjct: 65  TADVPVND-LIAIIAGEGEDPSSVQAGGAPKAASNGEAKAESKPEPKADASAAGQNTTPG 123

Query: 103 ----------------HSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPH 146
                               +P    +  S  R  ASPLARR+A + G+DL ++ GSGPH
Sbjct: 124 GGHMAYERVNAAPEGAQPGGAPQAGAQAGSGGRVFASPLARRIAKQEGVDLGAVRGSGPH 183

Query: 147 GRIVKSDIETLISTKTNVKDYSTIQSF--------------------GLVDESIDANILN 186
           GRI+  D++   ++       +   +                     GL  + +      
Sbjct: 184 GRIIARDVQAAKASGATQAPAAAQPAAEAPKAAAPTPKTAPAGGAPAGLTTDQVK----G 239

Query: 187 LFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHRE 246
            FAKD+YE +P D +RKTIA RL ++ Q  PHFY+++DC +D L+ LRE +N +    ++
Sbjct: 240 FFAKDAYEDVPLDGMRKTIAKRLTEAMQVAPHFYLTVDCELDALMKLRETLNGSAGKDKD 299

Query: 247 -EISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIR 305
            + + K+SVND ++KA  LA+ +VP AN  W  + ++R KH ++ VAV+I GG+ TP+IR
Sbjct: 300 GKPAFKLSVNDFVIKAMGLALTRVPAANAVWAEDRILRFKHAEVGVAVAIDGGLFTPVIR 359

Query: 306 QADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTI 365
           +AD+K++  IS E+K  A RA+ +KLKPEEYQGG TS+SN+GM GI  F AVINPPQS+I
Sbjct: 360 RADEKTLSTISNEMKDFAARARAKKLKPEEYQGGVTSVSNLGMFGIKHFTAVINPPQSSI 419

Query: 366 LAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           LA+GAGEK+VV ++    V  +M  TLS DHR +DGA+ ++L++ FK  IENP+ ML+
Sbjct: 420 LAVGAGEKRVVVKDGAPAVVQVMTCTLSCDHRVLDGALGAELVSAFKGLIENPMGMLV 477


>gi|157827552|ref|YP_001496616.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           bellii OSU 85-389]
 gi|157802856|gb|ABV79579.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           bellii OSU 85-389]
          Length = 418

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 197/436 (45%), Positives = 288/436 (66%), Gaps = 43/436 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTMTEG LA+W+K+EGDKI+PG+++ EIETDKA ME E+VDEG + +I++P G
Sbjct: 5   LLMPALSPTMTEGNLARWLKKEGDKINPGEVIAEIETDKATMEVEAVDEGTLAKIIIPQG 64

Query: 66  TENIAVNSPILNILMDSTEI--------------PPSPPLSK--ENIV--EVREEHSHSS 107
           ++N+ VNS I  ++ +  E+              P    +SK  E I    V+EE+    
Sbjct: 65  SQNVPVNSLIAVLIEEGEELSGIEEFIAKNNSNSPKKEEISKPAETIAPQNVKEEN---- 120

Query: 108 PVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDY 167
            +      +  +  ASPLA+RLA    + +  + GSGPHGRI+K D+   +S K   K  
Sbjct: 121 -ITTASDQNNIKVFASPLAKRLAKIQNVRIEEIKGSGPHGRIIKQDV---LSHKGGSK-- 174

Query: 168 STIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNI 227
                  L ++ +  N       + Y + P++NIRK IA RL +SKQT+PHFY+SI+CN+
Sbjct: 175 ------ALSNKIVSRN------PEEYRLAPNNNIRKIIAKRLLESKQTVPHFYLSIECNV 222

Query: 228 DNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI 287
           D LL +RE +N++     ++ S KISVND I+ A A A+ +VP AN SW  +A+  + ++
Sbjct: 223 DKLLDIREDINKSFG---DDKSAKISVNDFIILAVAKALQEVPNANASWGDDAIRYYNNV 279

Query: 288 DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMG 347
           DISVAV+I  G+VTPIIR ADQK+I+D+S E+K L ++A++ KL  EE+QGG  +ISN+G
Sbjct: 280 DISVAVAIENGLVTPIIRNADQKNIVDLSSEMKGLIKKARENKLTSEEFQGGGFTISNLG 339

Query: 348 MLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKL 407
           M GI +F A+INPPQS I+ +G+  K+ + +N++I +ATIM+ TLSADHR VDGA+ ++ 
Sbjct: 340 MYGIKNFNAIINPPQSCIMGVGSSSKRAIVKNDQISIATIMDVTLSADHRVVDGAVGAEF 399

Query: 408 LAKFKEYIENPVWMLM 423
           LA FK +IE+P  ML+
Sbjct: 400 LAAFKRFIESPALMLL 415


>gi|16125973|ref|NP_420537.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Caulobacter crescentus CB15]
 gi|221234740|ref|YP_002517176.1| pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase
           component [Caulobacter crescentus NA1000]
 gi|13423147|gb|AAK23705.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Caulobacter crescentus CB15]
 gi|220963912|gb|ACL95268.1| pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase
           component [Caulobacter crescentus NA1000]
          Length = 428

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 195/428 (45%), Positives = 275/428 (64%), Gaps = 14/428 (3%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW  + GD +  GD++ EIETDKA ME E+VDEG+++ ILVPAG
Sbjct: 5   ILMPALSPTMEEGTLAKWHVKVGDTVKAGDVIAEIETDKATMEVEAVDEGVVEAILVPAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK-----NRP 120
           TEN+ VN+ I  +  +     P+P +            + +    V    +      +R 
Sbjct: 65  TENVKVNALIAKLAGEGDSPAPAPKVEAPKAAAAAPVPAAAPAPAVPAPAAPVAADGSRV 124

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           +ASPLARRLA   G+DL +L G+GPHGR+VKSD+E   S     K         +   + 
Sbjct: 125 LASPLARRLASAAGLDLKALKGTGPHGRVVKSDVEAAKSGAPAAKAAPASAPAAVAPTAA 184

Query: 181 DANILNLFAK-----DSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLRE 235
               +    +      SY+++P D +RKTIA R+ +S + +PHF ++ID  ID LL+ R 
Sbjct: 185 APRQIQSLEQMGIPAGSYDLVPLDGMRKTIARRMTESFRDVPHFPLTIDLEIDALLAARA 244

Query: 236 QMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSI 295
           ++N  L    E+   K+SVNDI++KA A+A+ QVPEAN S+T   +  H H DI+VAV++
Sbjct: 245 KINSLL----EKQGVKVSVNDIVIKAAAVALKQVPEANASYTPEGIAMHHHADIAVAVAV 300

Query: 296 PGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFC 355
            GG++TPIIR+A+ K +  IS E+K LAQRAK +KLKPEE+QGGT SISN+GM GI SF 
Sbjct: 301 DGGLITPIIRKAETKGLAQISAEMKDLAQRAKDKKLKPEEFQGGTFSISNLGMFGIKSFA 360

Query: 356 AVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYI 415
           ++IN PQ  I+++GAGE++ V +N EIKVAT+M  TL+ DHR VDG++ +K LA F+  I
Sbjct: 361 SIINEPQGAIMSVGAGEQRPVVKNGEIKVATVMTVTLTCDHRVVDGSVGAKFLAAFRPLI 420

Query: 416 ENPVWMLM 423
           E P+ +++
Sbjct: 421 EEPLTLIV 428


>gi|188582157|ref|YP_001925602.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Methylobacterium populi BJ001]
 gi|179345655|gb|ACB81067.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Methylobacterium populi BJ001]
          Length = 470

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 200/467 (42%), Positives = 282/467 (60%), Gaps = 50/467 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G LAKW+K+EGD I  GD++ EIETDKA ME E+VDEG++ +ILV  G
Sbjct: 5   VLMPALSPTMEKGNLAKWLKKEGDAIKSGDVIAEIETDKATMEVEAVDEGVLAKILVAEG 64

Query: 66  TENIAVNSPILNILMDSTEIPPS--PPLSKENIVEVRE---------------EHSHSSP 108
           T ++ VN  ++ ++ +  E P S   P   E   E +                + +H+S 
Sbjct: 65  TADVPVNE-LIALIAEEGEDPGSVEAPKGGEAKGEAKTAPVEPKGTPDQNAAPDGAHASY 123

Query: 109 VVVREK-------------HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDI- 154
             V +               S  R  ASPLARR+A + GIDLS++ GSGPHGR+++ D+ 
Sbjct: 124 ARVDQAPEGAKPNGAAQPGASGGRVFASPLARRIAKQEGIDLSAVKGSGPHGRVIQRDVQ 183

Query: 155 ----------------ETLISTKTNVKDYSTIQSFGLVDESIDAN-ILNLFAKDSYEVIP 197
                           ET   T    K        G     +  + +   + K S+E +P
Sbjct: 184 AAIEGGTAKAGAAAKPETKAPTPAADKPAPKAAPTGGAPAGLSLDQVKGFYEKGSFEEVP 243

Query: 198 HDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHRE-EISNKISVND 256
            D +RKTIA RL ++ Q  PHFY+++DC +D L+ LRE +N +    ++ +   K+SVND
Sbjct: 244 LDGMRKTIAKRLTEAMQVAPHFYLTVDCELDALMKLRETLNGSAGKDKDGKPLFKLSVND 303

Query: 257 IILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDIS 316
            ++KA  LA+ +VP AN  W  + ++R KH ++ VAV+I GG+ TP+IR+ADQK++  IS
Sbjct: 304 FVIKAMGLALTRVPAANAVWAEDRILRFKHAEVGVAVAIDGGLFTPVIRKADQKTLSTIS 363

Query: 317 LEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVV 376
            E+K  A RA+ +KLKPEEYQGG TS+SN+GM GI  F AVINPPQSTILA+GAGEK+VV
Sbjct: 364 NEMKDFAGRARAKKLKPEEYQGGVTSVSNLGMFGIKHFTAVINPPQSTILAVGAGEKRVV 423

Query: 377 FQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            ++    V   M ATLS DHR +DGA+ ++L+A FK  IENP+ ML+
Sbjct: 424 VKDGAPAVVQAMTATLSCDHRVLDGALGAELIAAFKGLIENPMGMLV 470


>gi|94498246|ref|ZP_01304806.1| Dihydrolipoamide acetyltransferase, long form [Sphingomonas sp.
           SKA58]
 gi|94422248|gb|EAT07289.1| Dihydrolipoamide acetyltransferase, long form [Sphingomonas sp.
           SKA58]
          Length = 440

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 203/459 (44%), Positives = 275/459 (59%), Gaps = 58/459 (12%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+VDEG+I +IL
Sbjct: 1   MSKKIQMPALSPTMEEGTLAKWLVKEGDSVSSGDLLAEIETDKATMEFEAVDEGVIAKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIP---------PSP---------PLSKENIVEVREEH 103
           V  G+E + V + I  I  +  ++          P+P         P + E+    + E 
Sbjct: 61  VSEGSEGVKVGTVIAIIAEEGEDVADAASGSSDAPAPKAEASTDEAPKTAEDAPAPKAEA 120

Query: 104 SHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIET------- 156
               P       S +R  ASPLARRLA   GIDL+S+ GSG +GRI+K+DI+        
Sbjct: 121 PSEKPEPAAATASGDRIKASPLARRLAEAKGIDLASVKGSGTNGRIIKADIDAAKPGDTP 180

Query: 157 -------------LISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRK 203
                          +           Q FG+                 +EVI    +RK
Sbjct: 181 APAASSATAAPATAAAAPAAAPAAPAAQDFGI----------------PHEVIKLSGMRK 224

Query: 204 TIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFA 263
           TIA RL +SKQ +PH Y+++D  +D LL LR ++N  L+  +     K+SVND+++KA  
Sbjct: 225 TIARRLTESKQQVPHIYLTVDIQLDKLLKLRAELNAGLESRK----VKLSVNDLLIKALG 280

Query: 264 LAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLA 323
           +A++QVPE NV +  + M++ K  DISVAVSIPGG++TPII QAD K +  IS  +K LA
Sbjct: 281 VALMQVPECNVQFAGDQMLQFKRADISVAVSIPGGLITPIITQADGKGVAAISTAMKDLA 340

Query: 324 QRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIK 383
            RAK  KLKPEEYQGGT S+SNMGM GI  F AVINPPQ+ I+AIGAGEK+    ++ ++
Sbjct: 341 ARAKDGKLKPEEYQGGTASLSNMGMFGIKQFEAVINPPQAMIMAIGAGEKRPYIVDDAVQ 400

Query: 384 VATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           +AT+M+AT S DHR++DGA  ++L+  FKE IENP+ +L
Sbjct: 401 IATVMSATGSFDHRAIDGADGARLMQVFKELIENPMGLL 439


>gi|220926288|ref|YP_002501590.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Methylobacterium nodulans ORS 2060]
 gi|219950895|gb|ACL61287.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Methylobacterium nodulans ORS 2060]
          Length = 462

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 196/463 (42%), Positives = 279/463 (60%), Gaps = 50/463 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G LAKW+K+EGD +  GD+L EIETDKA ME E++DEG++ +I+VP G
Sbjct: 5   VLMPALSPTMEKGNLAKWLKKEGDTVKSGDVLAEIETDKATMEVEAIDEGVLAKIVVPEG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHS------------------- 106
           T ++ VN  ++ ++    E P S         + +     +                   
Sbjct: 65  TADVPVND-LIALIAGEGEDPKSVSAGAGAGAKAKPAEDRTPGGGTMAYARVDAAPDAAK 123

Query: 107 ---SPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
               P       +  R  ASPLARR+A + GIDLS ++GSGPHGR+++ D+   ++    
Sbjct: 124 AEAKPNGATRPQADGRIFASPLARRIAKQEGIDLSRIAGSGPHGRVIERDVRAALAEGGA 183

Query: 164 VKDYSTIQS----------------------FGLVDESIDANILNLFAKDSYEVIPHDNI 201
            K  +  +                        GL  E + A    +F K SYE IP D +
Sbjct: 184 TKAPAPARPAPKEAGEAVPPAAPTATAGALPLGLKAEQVKA----MFDKGSYEEIPLDGM 239

Query: 202 RKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHRE-EISNKISVNDIILK 260
           RKTIA RL +SKQT+PHFY+S+D  +D LL+LREQ+N      ++ +   K+SVND ++K
Sbjct: 240 RKTIAKRLVESKQTVPHFYLSLDVELDALLALREQVNAGAGQDKDGKPLFKLSVNDFVIK 299

Query: 261 AFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVK 320
           A ALA+ +VP AN  W  + +++ +H D+ VAV++ GG+ TP+IR+A+QK++  IS E+K
Sbjct: 300 ALALALQRVPNANAVWAEDRILKFRHSDVGVAVAVEGGLFTPVIRKAEQKTLSTISAEMK 359

Query: 321 QLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNE 380
            LA RA+ +KLKP+EYQGG T++SN+GM GI  F AVINPP  TILA+GAGE +VV +N 
Sbjct: 360 DLAGRARTKKLKPDEYQGGATAVSNLGMYGIKEFGAVINPPHGTILAVGAGEARVVVKNG 419

Query: 381 EIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
              V   M  TLS DHR VDGA+ ++LLA FK  IE+P+ ML+
Sbjct: 420 APAVVQAMTVTLSCDHRVVDGALGAELLAAFKGLIESPMGMLV 462


>gi|170743964|ref|YP_001772619.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Methylobacterium sp. 4-46]
 gi|168198238|gb|ACA20185.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Methylobacterium sp. 4-46]
          Length = 479

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 199/480 (41%), Positives = 284/480 (59%), Gaps = 67/480 (13%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G LAKW+K+EGD +  GD+L EIETDKA ME E+VDEG++  I+VP G
Sbjct: 5   VLMPALSPTMEKGNLAKWLKKEGDPVKSGDVLAEIETDKATMEVEAVDEGVLARIVVPEG 64

Query: 66  TENIAVNSPILNILMDSTEIPP----------------SPPLSKENIVEVREEHSHS--- 106
           T ++ VN  ++ ++    E P                 +PP   E+  E     +++   
Sbjct: 65  TADVPVND-LIAVIAAEGEDPARVGAGEGAAQGAAKGAAPPPRDEDRTEGGASLAYARVN 123

Query: 107 --------------------SPVVVREKHS--KNRPIASPLARRLAGEHGIDLSSLSGSG 144
                               +P    +  +    R +ASPLARR+A + GIDLS + GSG
Sbjct: 124 EAPDAAKAAANGAAAKPNGAAPGGAPQGAAPAGGRILASPLARRIAKQEGIDLSRVRGSG 183

Query: 145 PHGRIVKSDIETLISTKTNVKDYSTIQSF--------------------GLVDESIDANI 184
           PHGR+++ D+   +         +   +                     GL  + + A  
Sbjct: 184 PHGRVIERDVRAALKEGPAPAAPAGAPAAAPGGATPPAAKPAAGAPAASGLTGDQVKA-- 241

Query: 185 LNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFH 244
             +F + SYE +P D +R+TIA RL +SKQT+PHFY+S+DC +D LL+LREQ+N      
Sbjct: 242 --MFERGSYEEVPLDGMRRTIAKRLVESKQTVPHFYLSLDCELDALLALREQVNAGAGKD 299

Query: 245 RE-EISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPI 303
           R+ +   K+SVND ++KA ALA+ +VP AN  W  + +++ +H D+ VAV++ GG+ TP+
Sbjct: 300 RDGKPLFKLSVNDFVIKALALALQRVPNANAVWAEDRILKFRHSDVGVAVAVDGGLFTPV 359

Query: 304 IRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQS 363
           IR+A+QK++  +S E+K LA RA+ RKLKPEEYQGG T++SN+GM GI  F AVINPP  
Sbjct: 360 IRRAEQKTLSTLSAEMKDLAGRARSRKLKPEEYQGGATAVSNLGMYGIKEFGAVINPPHG 419

Query: 364 TILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           TILA+GAGE +VV +N    V   M  TLS DHR VDGA+ ++LLA FK  IENP+ ML+
Sbjct: 420 TILAVGAGEARVVARNGAPAVVQAMTVTLSCDHRVVDGALGAELLAAFKSLIENPMGMLV 479


>gi|227820167|ref|YP_002824138.1| acetyltransferase [Sinorhizobium fredii NGR234]
 gi|227339166|gb|ACP23385.1| dihydrolipoyllysine-residue acetyltransferase component of
           pyruvatedehydrogenase complex [Sinorhizobium fredii
           NGR234]
          Length = 430

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 194/432 (44%), Positives = 278/432 (64%), Gaps = 12/432 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P +   M  GK++KW   EGD +  GD+L EIETDKA ME ++   G++  + 
Sbjct: 1   MATEVILPKVDMDMATGKISKWFFGEGDAVKEGDVLFEIETDKAAMEIDAPASGVLHNVT 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSP-PLSKENIVE----VREEHSHSSPVVVREKHS 116
              G  +I V S +  I  +   +  +  PL+  + V+    V E  + ++ V V E+++
Sbjct: 61  GKEGV-DIPVGSAVAWIYAEGEAVNETAVPLTASDAVQSSLPVSETKTSAAEVAV-ERNA 118

Query: 117 KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDI----ETLISTKTNVKDYSTIQS 172
                A+PLARRLA E G+DLS+L+ SGPHGR+V +D+     T+       +   T   
Sbjct: 119 GGAVRATPLARRLARERGLDLSTLAASGPHGRVVSADVLAASNTVADAWVQAEPTRTSGR 178

Query: 173 FGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232
               +  +  N L  F   SYE+  H ++R+TIA RL ++K T+PHFY+S DC +D LL 
Sbjct: 179 SEAGNNIVGENTLRHFPDGSYELQAHTSMRRTIARRLVEAKSTVPHFYLSADCRLDALLK 238

Query: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVA 292
           LR ++N          + K+SVND+++KA+ALA+I VP+ANVSWT   ++RH H D+ VA
Sbjct: 239 LRAELNAAAPLVESVPAYKLSVNDLVIKAYALALIGVPDANVSWTDEHLVRHSHSDVGVA 298

Query: 293 VSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGIN 352
           VS+PGG++TPIIRQA+QKS+  IS E+K LA RAK  KLKP EYQGGT ++SN+GM G+ 
Sbjct: 299 VSVPGGLITPIIRQAEQKSLSTISNEMKDLALRAKAGKLKPNEYQGGTGAVSNLGMYGVK 358

Query: 353 SFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKF 411
            F A+INPP STILA+GAGEK+ +V    E+ VAT+M+ TLS DHR+VDGA+ ++LLAKF
Sbjct: 359 EFAAIINPPHSTILAVGAGEKRPMVTAEGELGVATVMSVTLSTDHRAVDGALGAELLAKF 418

Query: 412 KEYIENPVWMLM 423
           +  IENP+ +L+
Sbjct: 419 RALIENPLSILV 430


>gi|144898633|emb|CAM75497.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 419

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/422 (44%), Positives = 273/422 (64%), Gaps = 11/422 (2%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTMTEG LA+W+K+EGD +  GD+L EIETDKA MEFE+VDEG++ +IL+  G
Sbjct: 5   LLMPALSPTMTEGTLARWLKKEGDAVKSGDVLAEIETDKATMEFEAVDEGVLGKILIADG 64

Query: 66  TENIAVNSPILNILM---DSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
           T  +AVN+PI  +L    D++ I   P  +    V      + ++       H   R  A
Sbjct: 65  TSGVAVNTPIGVLLEEGEDASSIVAKPKAAAPAAVAPAAAAAPAAAAAPAPSHGGERVFA 124

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE-TLISTKTNVKDYSTIQSFGLVDESID 181
           SPLA+R+A + G+DL ++ GSGP+GR+VK+D+E  L          +          +  
Sbjct: 125 SPLAKRIAADAGLDLKAVKGSGPYGRVVKADVEQALKGGVAAAPVATAAAPVAAAKAAPA 184

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
             + N F + ++E IP+ ++RK IA RL ++K TIPHFY+SIDC +D LL +R  +N   
Sbjct: 185 PAVANPF-EPAFEEIPNSSMRKVIARRLTEAKSTIPHFYLSIDCELDALLKVRSDLNGRS 243

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
             +      K+SVND I++A ALA+ +VP AN SW   A+ R+  +D+SVAV+ P G++T
Sbjct: 244 DAY------KLSVNDFIIRAVALALKKVPAANASWGEEAIKRYTDVDVSVAVATPNGLIT 297

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI+  AD K +  IS E+K+LA +A+  KLKPEE+QGG  +ISN+GM G+  F A+INPP
Sbjct: 298 PIVHHADHKGLAAISNEMKELAAKARDGKLKPEEFQGGGFTISNLGMFGVKDFAAIINPP 357

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q  ILA+GAGE++ V +   + +AT+M  TLS DHR VDGA+ ++ LA FK+ +E+P+ M
Sbjct: 358 QGCILAVGAGEQRPVVKAGALAIATVMTCTLSVDHRVVDGAVGAEFLAAFKKLVEDPLSM 417

Query: 422 LM 423
           L+
Sbjct: 418 LL 419


>gi|254462094|ref|ZP_05075510.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodobacterales bacterium HTCC2083]
 gi|206678683|gb|EDZ43170.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 422

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 196/422 (46%), Positives = 275/422 (65%), Gaps = 10/422 (2%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM +G LAKW+ +EGD +S GD+L EIETDKA MEFE+VDEG+I +ILV AG
Sbjct: 5   ILMPALSPTMEDGTLAKWLVKEGDTVSSGDLLAEIETDKATMEFEAVDEGVIGKILVEAG 64

Query: 66  TENIAVNSPILNILMD---STEIPPSPPLSKENIV-EVREEHSHSSPVVVREKHSKNRPI 121
           T  + VNSPI  +L D   S E+  S   +   I  EV      ++P   +   + +R  
Sbjct: 65  TAGVLVNSPIALLLEDGEDSAEVVASSQTAPAPIAPEVLSTPVATAPAP-KLTQTGDRVF 123

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           ASPLARR+A + GIDL++++GSGP GRIVK+D+E   S                  ++  
Sbjct: 124 ASPLARRIAADKGIDLATITGSGPRGRIVKADVENAQSAPAAQPAAIPTPQTAKAPDTNP 183

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           + I  ++    +  +P D +RKTIA RL ++KQ IPHFY+  D ++D LL  R Q+N+  
Sbjct: 184 SQIAKMYEGREFTELPLDGMRKTIAARLTEAKQNIPHFYLRRDIHLDALLKFRSQLNK-- 241

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           Q    +I  K+SVND I+KA ALA+ QVP AN  W  + +++ K  D++VAV+I GG+ T
Sbjct: 242 QLAARDI--KLSVNDFIIKACALALQQVPAANAVWAGDRVLQMKASDVAVAVAIEGGLFT 299

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++ AD KS+  +S ++K LA RA+ RKL P EY GG+ +ISN+GM+GI +F AVINPP
Sbjct: 300 PVLQDADSKSLSALSAQMKDLANRARDRKLAPHEYMGGSFAISNLGMMGIENFDAVINPP 359

Query: 362 QSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
              ILA+GAG KK +V  + ++ +AT+M+ TLS DHR +DGA+ + LLA  K  +ENP+ 
Sbjct: 360 HGAILAVGAGAKKPIVNSDGDLDIATVMSVTLSVDHRVIDGALGADLLAAIKANLENPIA 419

Query: 421 ML 422
           ML
Sbjct: 420 ML 421


>gi|83593214|ref|YP_426966.1| dihydrolipoamide acetyltransferase, long form [Rhodospirillum
           rubrum ATCC 11170]
 gi|83576128|gb|ABC22679.1| Dihydrolipoamide acetyltransferase, long form [Rhodospirillum
           rubrum ATCC 11170]
          Length = 440

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 195/439 (44%), Positives = 272/439 (61%), Gaps = 24/439 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+K+EGD I+ GD++ EIETDKA MEFE+ DEG++ +ILV  G
Sbjct: 5   ILMPALSPTMEEGTLAKWLKKEGDPIAAGDVIAEIETDKATMEFEATDEGVLGKILVADG 64

Query: 66  TENIAVNSPILNILMDSTEIPPS----------------PPLSKENIVEVREEHSHSSPV 109
           T  I VN PI  IL++  E   +                 P         + + + +   
Sbjct: 65  TAGIKVNQPI-GILLEEGEDASALVQAAPAKAPDAPAKAAPEPAPVAAASQSDAAPAPAA 123

Query: 110 VVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYST 169
              ++ +  R  ASPLARR+A   G+DL +L GSGPHGRIV+ D+E  ++  T       
Sbjct: 124 AAPKRAAGERLFASPLARRIAAAEGLDLGALQGSGPHGRIVRRDVEAALAAGTGKTAEKA 183

Query: 170 IQSFGLVDESIDANILNLFAKDSYEVIPHDNI-----RKTIACRLQQSKQTIPHFYVSID 224
           + +         A         +    PH  +     RK IA RL +SKQT+PHFY+++D
Sbjct: 184 VAAPVAPAAPPQAVAAAAPKPVALPDAPHTKVANTSMRKIIARRLTESKQTVPHFYLTVD 243

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
           C ID LL LR+ +N   +   + +  K+SVND+I+KA ALA+ +VP AN SW+  A++  
Sbjct: 244 CKIDALLDLRKSLNARAEKRGDGV--KLSVNDLIIKAVALALRKVPAANASWSDEAIVLW 301

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
             +DISVAV+ PGG++TPI+R+ADQK +  IS E+K LA RA+  KLKPEE+QGG  SIS
Sbjct: 302 SDVDISVAVATPGGLITPIVRKADQKGLATISAEMKDLATRARDGKLKPEEFQGGGFSIS 361

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIA 404
           N+GM GI  F A+INPPQ  ILA+GAGE++ V +   + +AT+M+ TLS DHR VDGA+ 
Sbjct: 362 NLGMYGIREFAAIINPPQGCILAVGAGEQRPVVEAGALAIATVMSCTLSVDHRVVDGAVG 421

Query: 405 SKLLAKFKEYIENPVWMLM 423
           ++ L+ FK  IE+P+ M++
Sbjct: 422 AEFLSAFKILIEDPMAMML 440


>gi|110680209|ref|YP_683216.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Roseobacter denitrificans OCh 114]
 gi|109456325|gb|ABG32530.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Roseobacter denitrificans OCh 114]
          Length = 431

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 196/430 (45%), Positives = 281/430 (65%), Gaps = 17/430 (3%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD ++ GDI+ EIETDKA MEFE+VDEG I +ILV  G
Sbjct: 5   ILMPALSPTMEEGTLAKWLVKEGDTVASGDIMAEIETDKATMEFEAVDEGTIGKILVEEG 64

Query: 66  TENIAVNSPILNILMD-------STEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKN 118
           TE + VN+PI  +L D       S E  P+   +KE+      E + +      +    +
Sbjct: 65  TEGVKVNTPIAVLLEDGESADDISAEPEPAAAATKEDAPAPTPEPTATPAPAAPQSSDGS 124

Query: 119 RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDE 178
           R  ASPLARR+A  +G+DL+++ GSGPHGRIVK+D+E L ++       +   +      
Sbjct: 125 RIFASPLARRIAASNGVDLATVKGSGPHGRIVKADVEGLSASAAAPAPAAPGPAAPAPSA 184

Query: 179 SIDAN-----ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSL 233
            + +      ++ ++   +Y+ I  + +RKTIA RL ++KQ+IPHFY+  D  +D LL+ 
Sbjct: 185 PVASGPAAEAVMAMYEGRAYDEISLNGMRKTIAARLTEAKQSIPHFYLRRDIELDALLAF 244

Query: 234 REQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAV 293
           R Q+N+ L    E    K+SVND I+KA ALA+  VP+AN  W  + M++    D++VAV
Sbjct: 245 RGQLNKQL----ESRGVKLSVNDFIIKACALALQTVPDANAVWAGDRMLKLTPSDVAVAV 300

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
           +I GG+ TP++R A+ KS+  +S E+K LA RA+ RKL P EYQGG+ +ISN+GM GI++
Sbjct: 301 AIEGGLFTPVLRDAEMKSLSALSAEMKDLAARARDRKLAPHEYQGGSFAISNLGMFGIDN 360

Query: 354 FCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFK 412
           F AVINPP   ILA+GAG KK VV ++ E+ VAT+M+ TLS DHR +DGA+ ++L++  K
Sbjct: 361 FDAVINPPHGAILAVGAGVKKPVVGKDGELAVATVMSVTLSVDHRVIDGALGAQLISAIK 420

Query: 413 EYIENPVWML 422
           E +ENP+ ML
Sbjct: 421 ENLENPMTML 430


>gi|330994554|ref|ZP_08318478.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Gluconacetobacter sp. SXCC-1]
 gi|329758408|gb|EGG74928.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Gluconacetobacter sp. SXCC-1]
          Length = 431

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 194/430 (45%), Positives = 271/430 (63%), Gaps = 20/430 (4%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LA+W+K EGD I+ GD++ EIETDKA ME E+VDEGI+  IL+  G
Sbjct: 10  ILMPALSPTMKEGTLARWLKAEGDAIAAGDVIAEIETDKATMEVEAVDEGILGRILIGEG 69

Query: 66  TENIAVNSPILNILMDSTEIP------------PSPPLSKENIVEVREEHSHSSPVVVRE 113
           TE IAVN+PI  ++ +   +P            P+ P     +  V      +    V  
Sbjct: 70  TEGIAVNTPIAILVAEGESVPDAPAATAAATPAPAAPAPATPVAPVPATTQAAPAAPVAP 129

Query: 114 KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSF 173
                R  ASPLARR+A + GIDL++L GSGP+GRIV+ D+E            +   + 
Sbjct: 130 APKGTRVFASPLARRIAAQKGIDLATLKGSGPNGRIVRRDVEQAQQAPAAAPAATAAPAA 189

Query: 174 GLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSL 233
                          A  +Y+ +PH  +RK IA RL ++K TIPHFYV +D  +D LL+L
Sbjct: 190 -------APASAPAPASTAYDTVPHSGMRKVIARRLTEAKSTIPHFYVEMDVELDALLAL 242

Query: 234 REQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAV 293
           R Q+N          + KISVND+++KA A+ + +VP+ NVS+T +A++ +  +DISVAV
Sbjct: 243 RSQLNAAAPSEGPG-AYKISVNDMLVKAAAVTLRRVPQVNVSYTDDALLAYHDVDISVAV 301

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
           SIP G++TPI+R AD K +  ISLE + L  RA+  KLKPEE+QGGT SISNMGM G+ +
Sbjct: 302 SIPDGLITPIVRAADTKGLRQISLETRDLVARARAGKLKPEEFQGGTFSISNMGMYGVKA 361

Query: 354 FCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKE 413
           F A+INPPQ+ ILAI AGE++ V +  +I +AT+M  TLS DHR VDGA+A++ L+ F+ 
Sbjct: 362 FSAIINPPQAAILAIAAGERRAVVKGNDIVIATVMTVTLSVDHRVVDGALAAQWLSAFRT 421

Query: 414 YIENPVWMLM 423
            +ENP+ +++
Sbjct: 422 VVENPMSLVV 431


>gi|114768962|ref|ZP_01446588.1| Dihydrolipoamide acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [alpha proteobacterium HTCC2255]
 gi|114549879|gb|EAU52760.1| Dihydrolipoamide acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [alpha proteobacterium HTCC2255]
          Length = 420

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 194/426 (45%), Positives = 287/426 (67%), Gaps = 18/426 (4%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD +  GD++ EIETDKA MEFE+VDEG+I +I+VP G
Sbjct: 5   IQMPALSPTMEEGTLAKWLVKEGDTVESGDVMAEIETDKATMEFEAVDEGVIGKIIVPEG 64

Query: 66  TENIAVNSPILNILMD---STEIPPSPPLSKENIVEVREEHSHSSPVVVRE----KHSKN 118
           +  I VN  I  +L D   S+ I  + P +K+++V++ + +   +PV+  E    K SK 
Sbjct: 65  STGIKVNEIIAILLEDGENSSNIKTNDPENKQDVVDIIK-NDEKTPVIKSENTDLKFSKE 123

Query: 119 RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDE 178
           R  A+PLARR+A    +DL+++ GSGP+GRIVK+D+++  +        + I S  +  E
Sbjct: 124 RIFATPLARRIAQSTNVDLANIKGSGPYGRIVKADVQSKNAIALEKAPKTQITS-SVTSE 182

Query: 179 SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMN 238
           +I A    ++    +  IP D +RK IA RL ++KQTIPHFY+    N+D LL +R +MN
Sbjct: 183 TIKA----MYKDREFAEIPLDGMRKVIANRLTEAKQTIPHFYLRKSVNLDKLLIVRSEMN 238

Query: 239 RTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGG 298
             L         KISVND I+KA +LA+  +P+ANV W  + +++    D++VAVS+ GG
Sbjct: 239 TGLIDQ----GIKISVNDFIIKASSLALQDIPQANVVWAQDRILQMTSSDVAVAVSVEGG 294

Query: 299 IVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVI 358
           + TP+I  +++K++  +SLE+K LA RA+ +KL P EYQGG+ +ISN+GM+G+ +F AVI
Sbjct: 295 LYTPVIFDSEKKTLSSLSLEIKDLASRARDKKLLPNEYQGGSFAISNLGMMGVENFDAVI 354

Query: 359 NPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           NPP  +ILA+GAG KK +V ++  I VAT+M+ TLS DHR++DGA+ ++ LAK   Y+EN
Sbjct: 355 NPPHGSILAVGAGTKKPIVKEDGTICVATVMSLTLSVDHRAIDGALGAEFLAKITNYLEN 414

Query: 418 PVWMLM 423
           P+ ML+
Sbjct: 415 PLTMLV 420


>gi|307293150|ref|ZP_07572996.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Sphingobium chlorophenolicum L-1]
 gi|306881216|gb|EFN12432.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Sphingobium chlorophenolicum L-1]
          Length = 422

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 203/441 (46%), Positives = 276/441 (62%), Gaps = 40/441 (9%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M  TI MP+LSPTM EG LAKW+ +EGD++S GD+L EIETDKA MEFE+VDEG++ +IL
Sbjct: 1   MSKTIQMPALSPTMEEGTLAKWLVKEGDRVSSGDLLAEIETDKATMEFEAVDEGVVAQIL 60

Query: 62  VPAGTENIAVNSPILNILM---DSTEIPPSPPLSKENIVEVREEHSHSSPVVVREK---- 114
           V  G+E + V + I  I     DS +   + P  K + V  + E    +     +     
Sbjct: 61  VAEGSEGVKVGTVIAIIAEEGEDSAQAAKTAPAPKADPVPPKAEAPAPALAPTAKAAPAK 120

Query: 115 HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE-------------TLISTK 161
            + +R  ASPLARRLA   G+DLS++SGSGP+GRIVK+D+E                   
Sbjct: 121 STGDRVKASPLARRLAEAKGLDLSTISGSGPNGRIVKADLEGSAPAATAPAPVSAAAPAA 180

Query: 162 TNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYV 221
                 +  Q FG+                 ++VI    +RKTIA RL +SKQ +PH Y+
Sbjct: 181 IPAAAPAAAQDFGI----------------PHDVIKLSGMRKTIARRLTESKQQVPHIYL 224

Query: 222 SIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAM 281
           ++D  +D LL LR ++N  L       + K+SVND+++KA  +A+IQVPE NV +  + M
Sbjct: 225 TVDVQLDKLLKLRSELNAGLVSR----NVKLSVNDLLIKALGVALIQVPECNVQFAGDQM 280

Query: 282 IRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTT 341
           ++ K  DISVAVSIPGG++TPI+ +AD K +  IS  +K LA RAK  KLKPEEYQGGT 
Sbjct: 281 LQFKRADISVAVSIPGGLITPIVTEADSKGVAAISTAMKDLAARAKDGKLKPEEYQGGTA 340

Query: 342 SISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDG 401
           S+SNMGM GI  F AVINPPQ  ILAIGAGEK+    ++ +++AT+M+AT S DHR++DG
Sbjct: 341 SLSNMGMFGIKQFEAVINPPQGMILAIGAGEKRPFVIDDSLQIATVMSATGSFDHRAIDG 400

Query: 402 AIASKLLAKFKEYIENPVWML 422
           A  ++L+  FKE +ENP+ ML
Sbjct: 401 ADGARLMQVFKELVENPMGML 421


>gi|254486431|ref|ZP_05099636.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Roseobacter sp. GAI101]
 gi|214043300|gb|EEB83938.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Roseobacter sp. GAI101]
          Length = 435

 Score =  368 bits (944), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 193/438 (44%), Positives = 278/438 (63%), Gaps = 29/438 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD +S GD++CEIETDKA MEFE+ DEG+I +IL+  G
Sbjct: 5   ILMPALSPTMEEGTLAKWLVKEGDTVSSGDVMCEIETDKATMEFEATDEGVIGKILIADG 64

Query: 66  TENIAVNSPILNILMDS------------TEIPPSPPLSKENIVEVREEHSHSSPVVVRE 113
           TE + VN+PI  +L +              E  P+P   +E    V    S  +P   + 
Sbjct: 65  TEGVKVNTPIAVLLEEGESADDIGAASAPAETAPTPAPQEE--APVAASASPDTPAAPKS 122

Query: 114 KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSF 173
              K R  A+PLARR+A + G+DLS + GSGPHGRI+K+D+E L  ++      +   + 
Sbjct: 123 ADGK-RIFATPLARRIAADKGLDLSQIKGSGPHGRIIKADVEGLSESEAPKAAAAAAPTA 181

Query: 174 GLVDE--------SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
                        S DA ++ ++    +E I  + +RKTIA RL ++KQ+IPHFY+  D 
Sbjct: 182 TEAAAKPALAAGPSADA-VMKMYEGREFEEISLNGMRKTIASRLTEAKQSIPHFYLRRDI 240

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
            +D L+  R  +N+ L+        K+SVND I+KA ALA+  VP+AN  W  + +++ K
Sbjct: 241 QLDALMKFRGDLNKQLEAR----GVKLSVNDFIIKACALALQAVPDANAVWAGDRILKLK 296

Query: 286 HIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
             D++VAV+I GG+ TP+++ ++ KS+  +S E+K LA RA+ RKL P EYQGG+ +ISN
Sbjct: 297 PSDVAVAVAIDGGLFTPVLKDSEMKSLSALSAEMKDLATRARDRKLAPHEYQGGSFAISN 356

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIA 404
           +GM GI++F AVINPP   ILA+GAG KK VV ++ E+ VAT+M+ TLS DHR +DGA+ 
Sbjct: 357 LGMFGIDNFDAVINPPHGAILAVGAGVKKPVVGKDGELAVATVMSVTLSVDHRVIDGALG 416

Query: 405 SKLLAKFKEYIENPVWML 422
           ++LL   K+ +ENP+ ML
Sbjct: 417 AQLLTAIKDNLENPITML 434


>gi|307321957|ref|ZP_07601338.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Sinorhizobium meliloti AK83]
 gi|306892381|gb|EFN23186.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Sinorhizobium meliloti AK83]
          Length = 447

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 173/308 (56%), Positives = 228/308 (74%), Gaps = 3/308 (0%)

Query: 119 RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS---TKTNVKDYSTIQSFGL 175
           R  +SPLARRLA E GIDLS+++GSGPHGR+VK D+ET +S    K      +      L
Sbjct: 140 RIFSSPLARRLAKEAGIDLSAIAGSGPHGRVVKKDVETAVSGGAAKPAAAPAAAPAPATL 199

Query: 176 VDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLRE 235
                +  +L LF   SYE++PHD +RKTIA RL +SKQTIPHFYVS+DC +D L++LR 
Sbjct: 200 AKGMSEDAVLKLFEPGSYELVPHDGMRKTIAKRLVESKQTIPHFYVSVDCELDALMALRA 259

Query: 236 QMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSI 295
           Q+N        +   K+SVND+++KA ALA+  VP+ANVSWT   M++HKH D+ VAVSI
Sbjct: 260 QLNAAAPEKDGKPVYKLSVNDMVIKALALALRDVPDANVSWTDQNMVKHKHADVGVAVSI 319

Query: 296 PGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFC 355
           PGG++TPI+RQA+ KS+  IS E+K L +RAK+RKLKPEEYQGGTT++SNMGM+G+  F 
Sbjct: 320 PGGLITPIVRQAELKSLSAISNEMKDLGKRAKERKLKPEEYQGGTTAVSNMGMMGVKDFA 379

Query: 356 AVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYI 415
           AV+NPP +TILA+GAGE +VV +N+E+ +A +M  TLS DHR VDGA+ ++LLA FK YI
Sbjct: 380 AVVNPPHATILAVGAGEDRVVVRNKEMVIANVMTVTLSTDHRCVDGALGAELLAAFKRYI 439

Query: 416 ENPVWMLM 423
           ENP+ ML+
Sbjct: 440 ENPMGMLV 447



 Score =  100 bits (249), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%)

Query: 6  ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
          ITMP+LSPTM EG LAKW+ +EGDK+  GD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5  ITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66 TENIAVNSPI 75
          TE + VN+ I
Sbjct: 65 TEGVKVNALI 74


>gi|51473711|ref|YP_067468.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           typhi str. Wilmington]
 gi|81692291|sp|Q68WK6|ODP2_RICTY RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component of pyruvate dehydrogenase complex; AltName:
           Full=Dihydrolipoamide acetyltransferase component of
           pyruvate dehydrogenase complex; AltName: Full=E2
 gi|51460023|gb|AAU03986.1| Lipoate acetyltransferase [Rickettsia typhi str. Wilmington]
          Length = 404

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 195/427 (45%), Positives = 287/427 (67%), Gaps = 36/427 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM +G LA+W+K+EGDK++PG+++ EIETDKA ME ESVDEGI+ +I++P  
Sbjct: 5   ILMPALSPTMKDGNLARWLKKEGDKVNPGEVIAEIETDKATMEVESVDEGILAKIIIPQN 64

Query: 66  TENIAVNSPILNILMDSTEIPPS--PPLSKENIVEVR-------EEHSHSSPVVVREKHS 116
           ++N+ VNS ++ +L +  E        ++K N V +        ++ + S   V   KH 
Sbjct: 65  SQNVPVNS-LIAVLSEEGESTADIDAFIAKNNSVSLSLKTDTTLKKANESITNVEVVKHD 123

Query: 117 KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLV 176
            ++  ASPLA+RLA    I L S+ GSGPHGRIVK DI +          YS   ++   
Sbjct: 124 LSKIFASPLAKRLAKIRNIRLESVQGSGPHGRIVKQDILS----------YSPSTAYNRD 173

Query: 177 DESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
            E              Y  +P++NIR+ IA RL +SKQT+PHFY+SI+CN+D LL +RE 
Sbjct: 174 TEE-------------YRSVPNNNIRQIIAKRLLESKQTVPHFYLSIECNVDKLLDIRED 220

Query: 237 MNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIP 296
           +N++  F  ++++ KISVND I+ A A A+ +VP AN SW  +A+  + ++DISVAV+I 
Sbjct: 221 INKS--FSEDKLT-KISVNDFIILAVAKALQEVPNANASWAEDAIRYYNNVDISVAVAIE 277

Query: 297 GGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCA 356
            GIVTPII+ A++K+I+++S E+K L ++AK  KL P E+QGG  +ISN+GM GI +F A
Sbjct: 278 NGIVTPIIKDANKKNIIELSHEMKILIKKAKDNKLTPVEFQGGGFTISNLGMYGIKNFNA 337

Query: 357 VINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIE 416
           +IN PQS I+ +GA  K+ + +N++I +ATIM+ TLSADHR +DGA++++ LA FK +IE
Sbjct: 338 IINTPQSCIMGVGASTKRAIVKNDQIIIATIMDVTLSADHRVIDGAVSAEFLASFKRFIE 397

Query: 417 NPVWMLM 423
           +PV ML+
Sbjct: 398 HPVLMLI 404


>gi|149201841|ref|ZP_01878815.1| branched-chain alpha-keto acid dehydrogenase E2 subunit
           [Roseovarius sp. TM1035]
 gi|149144889|gb|EDM32918.1| branched-chain alpha-keto acid dehydrogenase E2 subunit
           [Roseovarius sp. TM1035]
          Length = 435

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 195/440 (44%), Positives = 280/440 (63%), Gaps = 25/440 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+V+EG++ +IL
Sbjct: 1   MATEILMPALSPTMEEGTLAKWLVKEGDTVSAGDLLAEIETDKATMEFEAVEEGVVGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSP---------VVVR 112
           V  GTE + VN+PI  +++D  E       +         + + ++P             
Sbjct: 61  VAEGTEGVKVNTPI-AVMLDEGESAADISSAPAKAEAPAAKQAEATPQAEVAAKPAPAAP 119

Query: 113 EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE---------TLISTKTN 163
           +    +R  ASPLARR+A + GIDL+ ++GSGPHGRIVK+D+E            +    
Sbjct: 120 KTGDGDRIFASPLARRIAADKGIDLAGITGSGPHGRIVKADVEGAKAGAAPVASAAEAPA 179

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
            K  +   +      S DA ++ ++   +YE +  D +RKTIA RL ++KQT+PHFY+  
Sbjct: 180 SKAATPAPAAAPSGPSSDA-VVAMYQGRAYEEVKLDGMRKTIAARLTEAKQTVPHFYLRR 238

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           +  +D L+  R ++N+ L    E    K+SVND I+KA ALA+  VP+AN  W  + ++R
Sbjct: 239 EIRLDALMKFRAELNKQL----EPRGVKLSVNDFIIKACALALQAVPDANAVWAGDKVLR 294

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
            K  D++VAV+I GG+ TP+++ A+ KS+  +S E+K LA+RA+ RKL P+EYQGGT +I
Sbjct: 295 LKPSDVAVAVAIEGGLFTPVLKDAEMKSLSALSAEMKDLAKRARDRKLAPQEYQGGTFAI 354

Query: 344 SNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGA 402
           SN+GM GI +F AVINPP   ILA+GAG KK VV ++ E+ VAT+M+ TLS DHR +DGA
Sbjct: 355 SNLGMFGIENFDAVINPPHGAILAVGAGLKKPVVGKDGELTVATVMSVTLSVDHRVIDGA 414

Query: 403 IASKLLAKFKEYIENPVWML 422
           + ++LL K  E +ENP+ ML
Sbjct: 415 LGAELLTKIVENLENPMVML 434


>gi|197105204|ref|YP_002130581.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Phenylobacterium zucineum HLK1]
 gi|196478624|gb|ACG78152.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Phenylobacterium zucineum HLK1]
          Length = 446

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 189/447 (42%), Positives = 277/447 (61%), Gaps = 33/447 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW  ++GD +  GD++ EIETDKA ME E+VDEG++ EILVP G
Sbjct: 4   ILMPALSPTMEEGTLAKWHVKQGDAVRSGDVIAEIETDKATMEVEAVDEGVVSEILVPEG 63

Query: 66  TENIAVNSPILNILMDS-----------TEIPPSPPLSKENIVEVREEHSHSSPVVVREK 114
           TE + VN+PI  +  +                P+P    +     REE + ++     + 
Sbjct: 64  TEGVKVNTPIARLGGEGEAAAPAPQPKAEAPKPAPTPESDGARAAREEKTEAAAKTPAQA 123

Query: 115 ----------HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNV 164
                        +R  ASPLARRLA + G+DLS++ G+GPHGRIVK+DIE     +T  
Sbjct: 124 PAPAPSPARAQDGSRIFASPLARRLAEQKGVDLSAVKGTGPHGRIVKADIEQARPGETKP 183

Query: 165 KDYSTIQSFGLVDESIDANILNL--------FAKDSYEVIPHDNIRKTIACRLQQSKQTI 216
            +     +      S                 A  SY++IP D +RKT+A R+  S + +
Sbjct: 184 GEAKAPAAQPTAAPSAARAEPRPAASLEQMGIAPGSYDLIPLDGMRKTVARRMTDSFRDV 243

Query: 217 PHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSW 276
           PHF ++ID  ID LL+ R ++N  L    E+   K+SVND+++KA A+A+ +VPEAN S+
Sbjct: 244 PHFPLTIDLEIDGLLAARARINALL----EKEGVKVSVNDMVMKAAAVALKRVPEANASY 299

Query: 277 TTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEY 336
           T   +  H H DI++AV++PGG++TPIIR+A+ K +  I+ E K LA+RA+ +KLKPEE+
Sbjct: 300 TPEGIAMHHHADIAMAVAVPGGLITPIIRKAETKGLAQIATEAKDLAERARNKKLKPEEF 359

Query: 337 QGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADH 396
           QGGT S+SN+GM GI +F +++N PQ  IL++GAGEK+ V + +++++AT+M+ TL+ DH
Sbjct: 360 QGGTFSVSNLGMFGIKTFSSILNEPQGCILSVGAGEKRPVVRGDKLEIATLMSVTLTCDH 419

Query: 397 RSVDGAIASKLLAKFKEYIENPVWMLM 423
           R VDGA  ++ L  FK  IE P+ M++
Sbjct: 420 RVVDGATGARWLQAFKALIEEPLTMIV 446


>gi|84517289|ref|ZP_01004643.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Loktanella
           vestfoldensis SKA53]
 gi|84508769|gb|EAQ05232.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Loktanella
           vestfoldensis SKA53]
          Length = 436

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 198/447 (44%), Positives = 280/447 (62%), Gaps = 46/447 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW  +EGDK+S GDIL EIETDKA MEFE+VDEGI+ +I++  G
Sbjct: 5   ILMPALSPTMEEGTLAKWHVKEGDKVSSGDILAEIETDKATMEFEAVDEGIMGKIMIAEG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKH---------- 115
           TE + VN  ++ +L++  E       S  +I +V  E   +S                  
Sbjct: 65  TEGVKVND-VIAVLLEEGE-------SAGDISKVPGEARDASAKKADAPAPAPGPRAAAA 116

Query: 116 --------SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIET----------- 156
                     +R  ASPLARR+A E G+DL+ +SGSGPHGRIVK+D++T           
Sbjct: 117 APAVAPAKDSSRVFASPLARRIAAEKGLDLAGVSGSGPHGRIVKADVQTAKAGATHAPTT 176

Query: 157 LISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTI 216
             + K      +T  + G    S DA ++ ++    Y  +  D +RKTIA RL ++KQ++
Sbjct: 177 AAAPKAEAPKAATTMATG---PSTDA-VIKMYDGRPYTEVKLDGMRKTIAARLTEAKQSV 232

Query: 217 PHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSW 276
           PHFY+  D N+D L++ R Q+N  L+        K+SVND I+KA ALA+ QVP+AN  W
Sbjct: 233 PHFYLRRDINLDALMAFRGQLNAQLEGR----GVKLSVNDFIIKACALALQQVPDANAVW 288

Query: 277 TTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEY 336
             +  ++    D++VAV+I GG+ TP++R A+ KS+  +S E+K LA RA+ RKL P+EY
Sbjct: 289 AGDRTLKFAKSDVAVAVAIEGGLFTPVLRDAEMKSLSALSAEMKDLATRARDRKLAPQEY 348

Query: 337 QGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSAD 395
           QGG+ +ISN+GM GI++F A+INPP + ILA+GAG KK +V ++  + VATIM+ TLS D
Sbjct: 349 QGGSFAISNLGMFGIDNFDAIINPPHAAILAVGAGVKKPIVGKDGALAVATIMSVTLSVD 408

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWML 422
           HR +DGA+ + LLA  K+ +ENP+ ML
Sbjct: 409 HRVIDGALGANLLAAIKDNLENPLTML 435


>gi|163793251|ref|ZP_02187227.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide
           acyltransferase (E2) component, and related enzyme
           [alpha proteobacterium BAL199]
 gi|159181897|gb|EDP66409.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide
           acyltransferase (E2) component, and related enzyme
           [alpha proteobacterium BAL199]
          Length = 429

 Score =  364 bits (934), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 200/439 (45%), Positives = 280/439 (63%), Gaps = 33/439 (7%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
           +I MP+LSPTM+EG LAKW  +EGD IS GD++ EIETDKA ME E+V+EG I +I+V  
Sbjct: 4   SILMPALSPTMSEGNLAKWHVKEGDTISAGDVIAEIETDKATMEVEAVEEGKIGKIVVAE 63

Query: 65  GTENIAVNSPILNILMD---STEIPPSPP--------LSKENIVEVREEHSHSSPVVVRE 113
           GTE +AVN+ I  +L +   + +IP             +        E     +P     
Sbjct: 64  GTEGVAVNAVIAWLLEEGESAGDIPSDGGHAPAPAAEAATPQPAAKAEPAKTDAPAASAP 123

Query: 114 KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS--------TKTNVK 165
           K S+ R  ASPLA+R+A + GIDL ++ GSGP+GRIVK+DIE  +S              
Sbjct: 124 KASEGRVFASPLAKRMAEQAGIDLGAVKGSGPNGRIVKADIEAAVSGGAPKKAVAAAAPT 183

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             +   S G   ++  A++  +     Y+ +P+  +RK IA RL +SKQ  PHFY++IDC
Sbjct: 184 PAAAAPSLG---QAPSADVPGM---PEYDEVPNSGMRKVIAKRLTESKQFAPHFYLTIDC 237

Query: 226 NIDNLLSLREQMN-RTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
            ID LL +R+ +N +   F       K+SVND++++A ALA+ +VP AN SWT  A+  +
Sbjct: 238 EIDELLKVRKDLNTKGDDF-------KLSVNDLVIRAAALALKKVPAANASWTEKAIRIY 290

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           K +DISVAV+I  G++TP+I+ A  K +  IS E+K LA RA+ RKLKPEE+QGGT SIS
Sbjct: 291 KQVDISVAVAIDDGLITPVIKDAGSKGLKQISAEMKDLATRARDRKLKPEEFQGGTFSIS 350

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIA 404
           N+GM GI  F AVINPPQ  ILA+GAGE++ V ++  + +AT+M+ TLS DHR VDGAI 
Sbjct: 351 NLGMFGIKDFAAVINPPQGAILAVGAGEQRAVVKDGALAIATVMSCTLSVDHRVVDGAIG 410

Query: 405 SKLLAKFKEYIENPVWMLM 423
           ++ LA FK+ +E+P+ ML+
Sbjct: 411 AQFLAAFKKLVEDPLTMLL 429


>gi|83311417|ref|YP_421681.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide
           acyltransferase (E2) component, and related enzyme
           [Magnetospirillum magneticum AMB-1]
 gi|82946258|dbj|BAE51122.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide
           acyltransferase (E2) component, and related enzyme
           [Magnetospirillum magneticum AMB-1]
          Length = 427

 Score =  364 bits (934), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 194/429 (45%), Positives = 271/429 (63%), Gaps = 17/429 (3%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTMTEG LAKW+K EGD +  GDILCEIETDKA MEFE+VDEG++ +ILV  G
Sbjct: 5   ILMPALSPTMTEGNLAKWLKNEGDAVKSGDILCEIETDKATMEFEAVDEGVLGKILVAGG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREK----------- 114
           T  +AVN+PI  +L +  +      +S  +     +  + ++                  
Sbjct: 65  TSGVAVNTPIAVLLEEGEDASAISAISAISAAPAPKAAAPAAAAAPVTAAAPVAAPSGPA 124

Query: 115 HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFG 174
           H  +R +ASPLA+R+A +  +DL ++ GSGPHGRIVK+D+E  I         +      
Sbjct: 125 HGGDRVVASPLAKRIAKDGNVDLKAVKGSGPHGRIVKADVEAAIKAGPAKPAAAPAAIVA 184

Query: 175 LVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLR 234
              +S  A       + ++E IP+ ++RK IA RL ++K TIPHFY+SIDC +D LL +R
Sbjct: 185 PAAKSAPAPAAASPFEPAFEEIPNSSMRKVIARRLTEAKSTIPHFYLSIDCELDALLKVR 244

Query: 235 EQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVS 294
             +N     +      K+SVND +++A ALA+ + P AN SW   A+ R+  IDISVAV+
Sbjct: 245 ADLNGRSDAY------KLSVNDFVVRAVALALKKAPAANASWGEEAIKRYTDIDISVAVA 298

Query: 295 IPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSF 354
            P G++TPI+  AD K + +IS E+K LA +A+  KLKPEE+QGG  +ISN+GM GI  F
Sbjct: 299 TPSGLITPIVHHADHKGLAEISNEMKSLAAKARDGKLKPEEFQGGGFTISNLGMFGIKEF 358

Query: 355 CAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEY 414
            A+INPPQ  ILA+GAGE++ V +   + VAT+M  TLS DHR VDGA+ ++ LA FK+ 
Sbjct: 359 AAIINPPQGCILAVGAGEQRPVVKAGALAVATVMTCTLSVDHRVVDGAVGAEFLAAFKKL 418

Query: 415 IENPVWMLM 423
           IE+P+ ML+
Sbjct: 419 IEDPLSMLL 427


>gi|84687415|ref|ZP_01015293.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84664573|gb|EAQ11059.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Rhodobacterales
           bacterium HTCC2654]
          Length = 437

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 194/441 (43%), Positives = 273/441 (61%), Gaps = 31/441 (7%)

Query: 8   MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTE 67
           MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+VDEG+I +ILV AG+E
Sbjct: 1   MPALSPTMEEGTLAKWLVKEGDAVSSGDLLAEIETDKATMEFEAVDEGVIGKILVEAGSE 60

Query: 68  NIAVNSPILNIL---------MDSTEIPPSPPLSKENIVEVREEHSHS--------SPVV 110
            + VN+PI  +L          +++   P+P   K +      E + +         P+ 
Sbjct: 61  GVKVNTPIAVLLEEGESADDIGEASSGAPAPSSDKADAAPKATEEAKADSPAPKSTGPIP 120

Query: 111 VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDI--------ETLISTKT 162
             +     R  ASPLARR+A + G+DL+ + GSGP GRIVK+D+              K 
Sbjct: 121 APKDDKGGRIFASPLARRIAKDKGLDLAQIKGSGPKGRIVKADVLDAKPSAAPAKDDAKP 180

Query: 163 NVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVS 222
                           S DA +L ++    +E +  D +RKTIA RL ++KQTIPHFY+ 
Sbjct: 181 AAAPAGGGGGAMPAGPSTDA-VLKMYEGREFEEVKLDGMRKTIAARLTEAKQTIPHFYLR 239

Query: 223 IDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMI 282
            D  +D L+  R Q+N+ L+        K+SVND I+KA ALA+  VP+AN  W  + ++
Sbjct: 240 RDIKLDALMKFRSQLNKQLEAR----GVKLSVNDFIIKASALALQAVPDANAVWAGDRVL 295

Query: 283 RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTS 342
           + K  D++VAV+I GG+ TP+++ AD KS+  +S E+K LA RA+ RKL P EYQGG+ +
Sbjct: 296 KLKPSDVAVAVAIEGGLFTPVLKDADMKSLSALSAEMKDLAARARDRKLAPHEYQGGSFA 355

Query: 343 ISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNE-EIKVATIMNATLSADHRSVDG 401
           ISN+GM GI++F AVINPP   ILA+G+G KK +   E EI+VATIM+ TLS DHR +DG
Sbjct: 356 ISNLGMFGIDNFDAVINPPHGGILAVGSGVKKPIVNAEGEIEVATIMSVTLSVDHRVIDG 415

Query: 402 AIASKLLAKFKEYIENPVWML 422
           A+ ++LL +  + +ENP+ ML
Sbjct: 416 ALGAQLLEQIVQNLENPMMML 436


>gi|84503366|ref|ZP_01001435.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Oceanicola batsensis
           HTCC2597]
 gi|84388276|gb|EAQ01227.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Oceanicola batsensis
           HTCC2597]
          Length = 469

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 208/474 (43%), Positives = 280/474 (59%), Gaps = 59/474 (12%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ QEGD +S GD+L EIETDKA MEFE+VDEG I +IL
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWLVQEGDTVSSGDLLAEIETDKATMEFEAVDEGTIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDS-------------------TEIPPSPPLSKENIV----- 97
           V AGTE + VNSPI  +L +                    T   P+ P   E        
Sbjct: 61  VEAGTEGVKVNSPIAVLLEEGESAEDIGEVSKEPKPVDEDTGTEPASPKEGEKPAGGYAG 120

Query: 98  EVREEHSHS----------------SPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLS 141
           EV+     +                +P   ++   K R  ASPLARR+A + G+DL+ + 
Sbjct: 121 EVQVSQGKAGGGSGTGGGEETTEVVAPAAPKDADGK-RIFASPLARRIAAQKGLDLAQIK 179

Query: 142 GSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGL------------VDESIDANILNLFA 189
           GSGP GRIVK+D+E+  +  T           G                S DA +L ++A
Sbjct: 180 GSGPRGRIVKADVESAQAGATKAAAGDPGAEAGAGGARAADAAVMPAGPSTDA-VLKMYA 238

Query: 190 KDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEIS 249
              +E I  D +R+TIA RL ++KQTIPHFY+  D  ID+LL+ R Q+N+ L    E+  
Sbjct: 239 DREFEEIKLDGMRRTIAARLTEAKQTIPHFYLRRDIRIDDLLAFRSQINKQL----EKRG 294

Query: 250 NKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQ 309
            K+SVND I+KA ALA+ QVP AN  W  + +++ K  D++VAV+I GG+ TP++R AD 
Sbjct: 295 VKLSVNDFIIKACALALQQVPAANAVWAGDRVLQLKPSDVAVAVAIEGGLFTPVLRDADA 354

Query: 310 KSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIG 369
           KS+  +S E+K LA RA+ RKL P EYQGG+ ++SN+GM GI++F AVINPP   ILA+G
Sbjct: 355 KSLSTLSTEMKDLAARARDRKLAPHEYQGGSFAVSNLGMFGIDNFDAVINPPHGAILAVG 414

Query: 370 AGEKKVVFQNE-EIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           AG KK V   E  ++VAT+M+ TLS DHR +DGA+ ++LL    E +E P+ ML
Sbjct: 415 AGVKKPVVNAEGAVEVATVMSVTLSVDHRVIDGALGAELLQAIVEGLEAPMTML 468


>gi|327194490|gb|EGE61350.1| dihydrolipoamide acetyltransferase homoserine dehydrogenase
           [Rhizobium etli CNPAF512]
          Length = 428

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 188/429 (43%), Positives = 274/429 (63%), Gaps = 8/429 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P +   M  GK++KW  +EGD++  GD+L EIETDKA ME +S   GI+  + 
Sbjct: 1   MATEIILPKVDMDMATGKISKWFFKEGDRVGKGDVLFEIETDKAAMEIDSPAAGILRNVN 60

Query: 62  VPAGTENIAVNSPILNILMDSTE-----IPPSPPL-SKENIVEVREEHSHSSPVVVREKH 115
              G  +IAV S +  I  +  E      P +P + +K    E  +  S S+P       
Sbjct: 61  GEEGV-DIAVGSAVAWIYEEGEEHQAASAPSAPTMPAKTGASEATDLGSISAPNHTASAG 119

Query: 116 SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGL 175
           + +   A+PLARRLA E GIDL S++G+GPHGRIV +D+         +   +   +  +
Sbjct: 120 AGSSMRATPLARRLARETGIDLGSVAGTGPHGRIVSADVSKARVAGAPLAPPAPAGAQHV 179

Query: 176 VDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLRE 235
             ++     L LFA+ +++V PH  +R+TIA RL ++K TIPHFY+S+DC +D LL LR 
Sbjct: 180 GRKAASDGSLALFAEGTFDVQPHTPMRRTIARRLLEAKTTIPHFYLSVDCRLDALLKLRA 239

Query: 236 QMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSI 295
           ++N +          K+SVND+++KA+ALA+   P+ANVSWT  +++RH  +D+ VAVS+
Sbjct: 240 ELNASAPMADGAPHFKLSVNDMVIKAYALALGSTPDANVSWTEESLLRHHFVDVGVAVSV 299

Query: 296 PGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFC 355
            GG++TPIIR A+ K++  IS E+K LA RA+  KLKP EYQGGT +ISN+GM G+  F 
Sbjct: 300 AGGLITPIIRHAESKTLSAISNEMKDLAARARSGKLKPVEYQGGTGAISNLGMFGVREFA 359

Query: 356 AVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEY 414
           A+INPP STILA+G+GE++ VV    ++  AT+M  TLS DHR+VDGA+ ++LL KF+ +
Sbjct: 360 AIINPPHSTILAVGSGERRPVVSAQGDLSSATVMTVTLSTDHRAVDGALGAQLLGKFQAF 419

Query: 415 IENPVWMLM 423
           IENP+ ML+
Sbjct: 420 IENPMSMLI 428


>gi|332187183|ref|ZP_08388923.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Sphingomonas sp. S17]
 gi|332012883|gb|EGI54948.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Sphingomonas sp. S17]
          Length = 447

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 203/454 (44%), Positives = 284/454 (62%), Gaps = 49/454 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD +  GDI+ EIETDKA MEFE+VDEG+I +ILV  G
Sbjct: 5   IKMPALSPTMEEGTLAKWLVKEGDTVKSGDIMAEIETDKATMEFEAVDEGVIAKILVSEG 64

Query: 66  TENIAVNSPILNILMD------------STEIP-PSPPL-------------SKENIVEV 99
           T+N+ V + ++ IL +             +E P P+ P+             +K     +
Sbjct: 65  TDNVKVGT-VIAILAEEGEDASSVQAPTKSETPAPAKPMPTDPTDPNKTGSEAKPAERTL 123

Query: 100 REEHSHSSPVVVREKHSKN----RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE 155
            +   H  PV   ++   +    R IASPLARR+A + G+DLS+L+GSGP+GRIVK+D+E
Sbjct: 124 TQAEDHGKPVDSGKQGGSSAGNGRAIASPLARRVASQKGLDLSALTGSGPNGRIVKADVE 183

Query: 156 TLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEV--IPHD-----NIRKTIACR 208
                +      +T  S     E+  A +    A    +V  IPH+     N+RKTIA R
Sbjct: 184 NAQPGQAKAVPAATASS----SETASAPVA---APKPAQVPDIPHEASKLSNMRKTIARR 236

Query: 209 LQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQ 268
           L +SKQ +PH Y+++D  +D LL LR ++N  L    E    K+SVND+++KA  +A++ 
Sbjct: 237 LTESKQQVPHIYLTVDVRLDALLKLRGELNAGL----ESRGVKLSVNDMLIKALGVALMA 292

Query: 269 VPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQ 328
           VP+ NV +T + +I  K  DISVAVS P G++TPI+ +AD +S+  IS  +K LA RA+ 
Sbjct: 293 VPKCNVMFTPDQLISFKRADISVAVSTPAGLITPIVSEADTRSLSSISTTMKDLATRARD 352

Query: 329 RKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIM 388
            KL+P E+QGGT SISNMGM GI  F AVINPPQ  ILAIGAGEK+    ++++ VAT+M
Sbjct: 353 NKLQPHEFQGGTASISNMGMFGIKQFEAVINPPQGMILAIGAGEKRPYIVDDQLGVATVM 412

Query: 389 NATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           +AT S DHR++DGA  ++L+  FKE +E P+ ML
Sbjct: 413 SATGSFDHRAIDGADGAELMKVFKELVERPLAML 446


>gi|328543937|ref|YP_004304046.1| dihydrolipoamide acetyltransferase protein [polymorphum gilvum
           SL003B-26A1]
 gi|326413681|gb|ADZ70744.1| Dihydrolipoamide acetyltransferase protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 308

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 167/307 (54%), Positives = 230/307 (74%), Gaps = 4/307 (1%)

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN----VKDYSTIQSFGLV 176
            ASPLARRLA ++ +DL +L+G+GPHGR+V+ DIET +   T         +   +  L 
Sbjct: 2   FASPLARRLAAQNNLDLKALAGTGPHGRVVQRDIETALKAGTGKATPADAPAPKAAPALA 61

Query: 177 DESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
             + D  +L L+ + SYE++PHD +RKTIA RL +SKQTIPHFYVS+DC +D LL+LR Q
Sbjct: 62  AGASDEQVLKLYEEGSYELVPHDGMRKTIARRLTESKQTIPHFYVSVDCELDALLALRTQ 121

Query: 237 MNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIP 296
           +N       ++ + K+SVND+++KA ALA+  VP+ANVSWT  AM+RHKH D+ VAV+IP
Sbjct: 122 INDAAPKKGDQPAYKLSVNDMVIKALALALRDVPDANVSWTEQAMVRHKHSDVGVAVAIP 181

Query: 297 GGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCA 356
           GG++TPIIRQA+QK +  IS E+K L +RAK RKLKPEEYQGGTT++SNMGM+G+  F A
Sbjct: 182 GGLITPIIRQAEQKPLSVISNEMKDLGKRAKDRKLKPEEYQGGTTAVSNMGMMGVKDFAA 241

Query: 357 VINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIE 416
           V+NPP +TILA+G+GE++ V +N+ + +AT+M  TLS DHR+VDGA+ ++L+  FK YIE
Sbjct: 242 VVNPPHATILAVGSGERRPVVKNDALAIATVMTVTLSTDHRAVDGALGAELIGAFKRYIE 301

Query: 417 NPVWMLM 423
           NP+ ML+
Sbjct: 302 NPMAMLV 308


>gi|294012050|ref|YP_003545510.1| pyruvate dehydrogenase E2 component [Sphingobium japonicum UT26S]
 gi|292675380|dbj|BAI96898.1| pyruvate dehydrogenase E2 component [Sphingobium japonicum UT26S]
          Length = 427

 Score =  363 bits (931), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 197/446 (44%), Positives = 267/446 (59%), Gaps = 45/446 (10%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M  TI MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+VDEG + +IL
Sbjct: 1   MSKTIQMPALSPTMEEGTLAKWLVKEGDTVSSGDLLAEIETDKATMEFEAVDEGTVAKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKH------ 115
           V  G+E + V + I  I  +  ++  +   +                  V  K       
Sbjct: 61  VAEGSEGVKVGTVIAIIAEEGEDLSQAAAGNAAPSAAAPAAGPAPQADPVPAKAPAPAPK 120

Query: 116 --------SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE-----------T 156
                   +  R  ASPLARRLA   G+DL++++GSGP+GRIVK+D+E            
Sbjct: 121 ADPAPAKATDGRVKASPLARRLAEAKGLDLAAVTGSGPNGRIVKADLEGAAPVAKTAVPA 180

Query: 157 LISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTI 216
                      +  Q FG+                 +EVI    +RKTIA RL +SKQ +
Sbjct: 181 AAPAAPLAAAPAAAQDFGI----------------PHEVIKLSGMRKTIARRLTESKQQV 224

Query: 217 PHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSW 276
           PH Y+++D  +D LL LR ++N  L         K+SVND+++KA  +A+IQVPE NV +
Sbjct: 225 PHIYLTVDVQLDKLLKLRGELNAGLASR----GVKLSVNDLLIKALGVALIQVPECNVQF 280

Query: 277 TTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEY 336
             + M++ +  DISVAVSIPGG++TPI+ +AD K +  IS  +K LA RAK  KLKPEEY
Sbjct: 281 AGDQMLKFQRADISVAVSIPGGLITPIVTEADSKGVAAISTAMKDLAARAKDGKLKPEEY 340

Query: 337 QGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADH 396
           QGGT S+SNMGM GI  F AVINPPQ  ILAIGAGEK+    ++ +++AT+M+AT S DH
Sbjct: 341 QGGTASLSNMGMFGIKQFEAVINPPQGMILAIGAGEKRPFVIDDSLQIATVMSATGSFDH 400

Query: 397 RSVDGAIASKLLAKFKEYIENPVWML 422
           R++DGA  ++L+  FKE +ENP+ ML
Sbjct: 401 RAIDGADGARLMQVFKELVENPIGML 426


>gi|83943190|ref|ZP_00955650.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Sulfitobacter sp.
           EE-36]
 gi|83846198|gb|EAP84075.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Sulfitobacter sp.
           EE-36]
          Length = 447

 Score =  362 bits (930), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 194/447 (43%), Positives = 280/447 (62%), Gaps = 35/447 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+  EGD +S GDILCEIETDKA MEFE+VDEG I +IL+  G
Sbjct: 5   ILMPALSPTMEEGTLAKWLVSEGDSVSSGDILCEIETDKATMEFEAVDEGTIGKILIGDG 64

Query: 66  TENIAVNSPILNIL--------MDSTEIPPSPPLSKENIVEV--------------REEH 103
           +E + VN+PI  +L        +DS   P     +KE+  +                 + 
Sbjct: 65  SEGVKVNTPIAVLLEEGEEASDIDSAPAPDVKDSAKEDAPDQDAAPEKGYGRGESDANDT 124

Query: 104 SHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
           S S+P   +    K R   +PLARR+A + G+DL+ LSGSGPHGRI+K+D+E   +    
Sbjct: 125 STSAPAAPKSSDGK-RLFVTPLARRIAADKGVDLAELSGSGPHGRIIKADVEAASAGSAK 183

Query: 164 VKDYSTIQSFGLVDESIDAN-------ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTI 216
            K   + ++      +           ++ ++   ++E I  + +RKTIA RL ++KQ+I
Sbjct: 184 AKPAESTETASAPAATAAPAAGPSADAVMKIYEGRAFEEISLNGMRKTIAARLTEAKQSI 243

Query: 217 PHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSW 276
           PHFY+  D  +D LL  R ++N+ L+        K+SVND I+KA ALA+  V +AN  W
Sbjct: 244 PHFYLRRDIELDALLKFRGELNKQLEAR----DVKLSVNDFIIKACALALQTVSDANAVW 299

Query: 277 TTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEY 336
             + +++ K  D++VAV+I GG+ TP+++ A+ KS+  +S E+K LA RA+ RKL P EY
Sbjct: 300 AGDRILKLKPSDVAVAVAIEGGLFTPVLKDAEMKSLSTLSAEMKDLATRARDRKLAPHEY 359

Query: 337 QGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSAD 395
           QGG+ +ISN+GM GI++F AVINPP   ILA+GAG KK VV ++ E+ VAT+M+ TLS D
Sbjct: 360 QGGSFAISNLGMFGIDNFDAVINPPHGAILAVGAGVKKPVVGKDGELAVATVMSVTLSVD 419

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWML 422
           HR +DGA+ ++LL+  K+ +ENP+ ML
Sbjct: 420 HRVIDGALGAQLLSAIKDNLENPMMML 446


>gi|89069564|ref|ZP_01156908.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Oceanicola granulosus
           HTCC2516]
 gi|89044899|gb|EAR50989.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Oceanicola granulosus
           HTCC2516]
          Length = 452

 Score =  362 bits (929), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 196/456 (42%), Positives = 274/456 (60%), Gaps = 40/456 (8%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+VDEG++ +IL
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWLVKEGDTVSSGDLLAEIETDKATMEFEAVDEGVVGKIL 60

Query: 62  VPAGTENIAVNSPILNILM------DSTEIPPSP---------PLSKENIVEVREEHSHS 106
           V AGTE + VN PI  +L       D ++ P +P         P +     E ++ +   
Sbjct: 61  VEAGTEGVKVNQPIAVLLEEGESADDISDTPATPSGDADSHAEPAAASEATEPQKGYGRG 120

Query: 107 SPVVVREKHSKN---------RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETL 157
                    S           R  ASPLARR+A + G+DL+ L GSGP GRIVK+D+E  
Sbjct: 121 DAPAPAPAPSGGGEAAQEKGERIFASPLARRIAKDKGLDLAQLKGSGPKGRIVKADVEKA 180

Query: 158 ISTKTNVKDYSTIQSFGL----------VDESIDANILNLFAKDSYEVIPHDNIRKTIAC 207
              +      +                      DA +L ++    +E +  D +RKTI  
Sbjct: 181 EPGQQQAAPKAEAPKAAATAGGEKPPMPAGMGADA-VLKMYEGREFEEVKLDGMRKTIGA 239

Query: 208 RLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMI 267
           RL ++KQTIPHFY+  D  +D LL  R Q+N+ L    E    K+SVND I+KA ALA+ 
Sbjct: 240 RLTEAKQTIPHFYLRRDIRLDALLKFRSQLNKQL----EAKGVKLSVNDFIIKAGALALQ 295

Query: 268 QVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAK 327
           +VP+AN  W  + +++ K  D++VAV+I GG+ TP+++ A QKS+  +S E+K LA+RA+
Sbjct: 296 EVPDANAVWAGDRILKLKPSDVAVAVAIEGGLFTPVLKDAHQKSLSALSAEMKDLAKRAR 355

Query: 328 QRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVAT 386
            RKL P EYQGG+ +ISN+GM G+ +F AVINPP  +ILA+GAG KK VV ++ E+ VAT
Sbjct: 356 DRKLAPHEYQGGSFAISNLGMFGVENFDAVINPPHGSILAVGAGVKKPVVGEDGELAVAT 415

Query: 387 IMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           +M+ TLS DHR +DGA+ ++ L+  K  +E P+ ML
Sbjct: 416 VMSVTLSVDHRVIDGALGAQFLSALKANLEAPMTML 451


>gi|126725379|ref|ZP_01741221.1| branched-chain alpha-keto acid dehydrogenase E2 subunit
           [Rhodobacterales bacterium HTCC2150]
 gi|126704583|gb|EBA03674.1| branched-chain alpha-keto acid dehydrogenase E2 subunit
           [Rhodobacterales bacterium HTCC2150]
          Length = 425

 Score =  362 bits (929), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 190/424 (44%), Positives = 279/424 (65%), Gaps = 11/424 (2%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ + GD ++ GD++ EIETDKA MEFE+VDEG+I E+LV  G
Sbjct: 5   ILMPALSPTMEEGTLAKWLVKAGDTVNSGDLIAEIETDKATMEFEAVDEGVISELLVAEG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLS-KENIVEVREEHSHSSPVVVREKH----SKNRP 120
           +E +AVN+ I  +L+D  E    P    KE         S S+ V            +R 
Sbjct: 65  SEGVAVNTAIAILLVDGEEAGTKPTAKPKETAAAPAPAASVSAVVSSVSPQPLAEKGDRV 124

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
            A+PLARR+A ++G+DL ++SGSGPHGRI+K+D+E L +T   V   +   +   +  S 
Sbjct: 125 FATPLARRIAKQNGVDLGAVSGSGPHGRIIKADVEGLSATAAPVATSTAPAAKQEIASSA 184

Query: 181 DAN-ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
            ++ +  ++A   Y+ IP + +RK IA RL ++KQTIPHFY+  D  +D LL+ R  +N+
Sbjct: 185 TSDSVKAMYADREYKEIPLNGMRKIIAGRLTEAKQTIPHFYLRRDILLDELLAFRSTLNK 244

Query: 240 TLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGI 299
            L     EI  K+SVND I+KA ALA+  VP AN  W  + +++    D++VAV+I GG+
Sbjct: 245 KLAAR--EI--KLSVNDFIIKACALALQDVPAANAVWAEDRVLQMVKSDVAVAVAIDGGL 300

Query: 300 VTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVIN 359
            TP+++ +D K++  +S E+K LA RA+ +KL P EYQGG+ +ISN+GM+G+++F AVIN
Sbjct: 301 FTPVLQDSDTKTLSTLSTEMKDLAARARDKKLAPHEYQGGSFAISNLGMMGVDNFDAVIN 360

Query: 360 PPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENP 418
           PP   ILA+GAG++K VV  N ++  AT+M+ TLS DHR +DGA+ ++LL    +Y+E+P
Sbjct: 361 PPHGAILAVGAGKRKPVVGPNGDLTSATVMSVTLSVDHRVIDGALGAELLQSIVDYLESP 420

Query: 419 VWML 422
           + ML
Sbjct: 421 IAML 424


>gi|114569970|ref|YP_756650.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Maricaulis maris MCS10]
 gi|114340432|gb|ABI65712.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Maricaulis maris MCS10]
          Length = 440

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 196/441 (44%), Positives = 269/441 (60%), Gaps = 28/441 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW  +EGD +  G +L EIETDKA ME E+VDEG + +ILV  G
Sbjct: 5   ILMPALSPTMEEGTLAKWHVKEGDVVESGMVLAEIETDKATMEVEAVDEGTVGKILVEDG 64

Query: 66  TENIAVNSPILNIL------------------MDSTEIPPSPPLSKENIVEVREEHSHSS 107
           TE + VN+ I  +L                  + S +  P+    K  +V         S
Sbjct: 65  TEGVKVNAVIAILLEEGETEVSAPTPAAPAPSVSSADTSPASGGEKSELVSAPASGGSGS 124

Query: 108 PVVVRE----KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
                E    K   NR  ASPLA+R+A + G+DL ++ GSGP+GRIVK D+E    +   
Sbjct: 125 AKGGDEGGAAKGGDNRIKASPLAKRIAADKGLDLKTIDGSGPYGRIVKRDVENAQPSAAT 184

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
               S   +   VD         + A+D Y+V   D I K  A RL +S + IPHF +++
Sbjct: 185 SASASEAPAAAPVDMDDPLKAYGI-ARDRYDVEKADGITKISAKRLSESFRDIPHFPLTV 243

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMI- 282
           DC ID L+  R+++N       E+  +K+SVNDI++KA  LA+ +VP AN SW    MI 
Sbjct: 244 DCRIDALMDFRKRINAAA----EKDGDKVSVNDILIKASGLALKKVPAANSSWIEGGMIA 299

Query: 283 RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTS 342
           RHKH D+S+AV+I GG++TPII  ADQK +++IS + K LA RA+ RKLKPEE+QGGT S
Sbjct: 300 RHKHADVSMAVAIEGGLITPIIADADQKGLVEISRQSKDLATRARDRKLKPEEFQGGTFS 359

Query: 343 ISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGA 402
           +SN+GM GI+SF ++INPPQ  IL++GAGE++ V ++  + +A +M  TL+ DHR VDGA
Sbjct: 360 LSNLGMFGIDSFASIINPPQGMILSVGAGEQRPVVKDGALAIAMVMTVTLTCDHRVVDGA 419

Query: 403 IASKLLAKFKEYIENPVWMLM 423
             +K L  FK Y+E+P+ MLM
Sbjct: 420 TGAKWLQAFKTYVEDPMTMLM 440


>gi|294677240|ref|YP_003577855.1| pyruvate dehydrogenase complex E2 component
           dihydrolipoyllysine-residue acetyltransferase
           [Rhodobacter capsulatus SB 1003]
 gi|294476060|gb|ADE85448.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoyllysine-residue acetyltransferase
           [Rhodobacter capsulatus SB 1003]
          Length = 418

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 190/422 (45%), Positives = 267/422 (63%), Gaps = 6/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +  G I+ EIETDKA MEFE+VDEG+I ++L
Sbjct: 1   MAVEILMPALSPTMEEGTLAKWLVKEGDAVKSGQIIAEIETDKATMEFEAVDEGVIGKLL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  GT  + VN+ I  ++ +      +P         V      +    V  K +  R  
Sbjct: 61  VAEGTSGVKVNAAIAVLIEEGGSAEVAPVAKAAAPAPVAAPAVATPAAPVVPKAAGARIF 120

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           ASPLARR+A + G+DL+++SGSGPHGRIVK+D+E  ++          + +         
Sbjct: 121 ASPLARRIAADKGLDLAAISGSGPHGRIVKADVEGAVAKPAPAAAPVLVAAP-APAPVSA 179

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A +  L+   +Y  IP D +R+ IA RL ++KQTIPHFY+  +  +D LLS RE++NR L
Sbjct: 180 ATVAKLYEGRAYTEIPLDGMRRVIAARLTEAKQTIPHFYLRREVRLDALLSFREELNRQL 239

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
                    K+SVND I+KA ALA+  +P AN  W  + +++ +  D++VAV+I GG+ T
Sbjct: 240 SAR----GVKLSVNDFIIKASALALQAIPAANAVWAGDRVLQMQASDVAVAVAIEGGLFT 295

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++ AD KS+  +S ++K LA+RA+ RKL P EYQGG+ +ISN+GM+GI SF AVINPP
Sbjct: 296 PVLQDADTKSLSQLSAQMKDLAKRARDRKLAPHEYQGGSFAISNLGMMGIESFDAVINPP 355

Query: 362 QSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
              ILA+GAG KK VV  +  I+VAT+M  TLS DHR +DGA+ ++LLA     +ENP+ 
Sbjct: 356 HGAILAVGAGVKKPVVSASGTIEVATMMALTLSVDHRVIDGALGAELLAAIVSNLENPMA 415

Query: 421 ML 422
           ML
Sbjct: 416 ML 417


>gi|150396298|ref|YP_001326765.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Sinorhizobium medicae WSM419]
 gi|150027813|gb|ABR59930.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Sinorhizobium medicae WSM419]
          Length = 457

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 171/312 (54%), Positives = 230/312 (73%), Gaps = 11/312 (3%)

Query: 119 RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSF----- 173
           R  +SPLARRLA E GIDLS+++GSGPHGR++K D+E   S        +   +      
Sbjct: 150 RIFSSPLARRLAREAGIDLSAIAGSGPHGRVIKKDVEAAASGGAAKTAAAPAAAPAPSAP 209

Query: 174 --GLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
             G+ ++++    L LF   SYE++PHD +RKTIA RL +SKQTIPHFYVS+DC +D LL
Sbjct: 210 AKGMSEDAV----LKLFEPGSYELVPHDGMRKTIAKRLVESKQTIPHFYVSVDCELDALL 265

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISV 291
           +LR Q+N        +   K+SVND+++KA ALA+  VP+ANVSWT   M++HKH D+ V
Sbjct: 266 ALRAQLNSAAPEKDGKSVYKLSVNDMVIKALALALRDVPDANVSWTDQNMVKHKHADVGV 325

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGI 351
           AVSIPGG++TPIIRQA+ KS+  IS E+K L +RAK+RKLKPEEYQGGTT++SNMGM+G+
Sbjct: 326 AVSIPGGLITPIIRQAELKSLSAISNEMKDLGKRAKERKLKPEEYQGGTTAVSNMGMMGV 385

Query: 352 NSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKF 411
            +F AV+NPP +TILA+GAGE++VV +N+E  +A +M  TLS DHR VDGA+ ++LLA F
Sbjct: 386 KNFAAVVNPPHATILAVGAGEERVVVKNKETVIANVMTVTLSTDHRCVDGALGAELLAAF 445

Query: 412 KEYIENPVWMLM 423
           K YIE+P+ ML+
Sbjct: 446 KRYIESPMGMLV 457



 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/80 (57%), Positives = 61/80 (76%)

Query: 6  ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
          ITMP+LSPTM EG LAKW+ +EGDK+  GD++ EIETDKA ME E+VDEG + +I+VPAG
Sbjct: 5  ITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64

Query: 66 TENIAVNSPILNILMDSTEI 85
          TE + VN+ I  +  D  ++
Sbjct: 65 TEGVKVNALIAVLAADGEDV 84


>gi|126728755|ref|ZP_01744570.1| Dihydrolipoamide acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [Sagittula stellata E-37]
 gi|126710685|gb|EBA09736.1| Dihydrolipoamide acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [Sagittula stellata E-37]
          Length = 433

 Score =  360 bits (923), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 193/434 (44%), Positives = 274/434 (63%), Gaps = 23/434 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+VDEG+I  I+V  G
Sbjct: 5   IQMPALSPTMEEGTLAKWLVKEGDTVSSGDVLAEIETDKATMEFEAVDEGVIGRIVVAEG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEV----REE------HSHSSPVVVREKH 115
           T  + V + ++ +L++  E       S E+  E      EE       SH++P    E+ 
Sbjct: 65  TAEVKVGT-VIAVLLEEGETAEDIGTSAESTAETPATPEEEPAAPKTDSHAAPPA-PERA 122

Query: 116 SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGL 175
              R  ASPLARR+A + G+DLS ++GSGP GRIVK+D+E+  +     K  +   +  +
Sbjct: 123 DGERIFASPLARRIAAQKGLDLSRITGSGPRGRIVKADVESATAEPAAAKPAAAAATPAV 182

Query: 176 VDESID------ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
                       +++  L+A   Y  +P D +R+TIA RL ++KQTIPHFY+  D  +D 
Sbjct: 183 APAKAAPTPVDPSSVAALYADRDYTEVPLDGMRRTIAARLTEAKQTIPHFYLRRDITLDA 242

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDI 289
           L++ R Q+N  L         K+SVND I+KA A+A+ QVP+AN  W  + +++    D+
Sbjct: 243 LMAFRAQLNEQLAPR----GVKLSVNDFIIKACAMALQQVPKANAVWAGDRILQLTPSDV 298

Query: 290 SVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGML 349
           +VAV+I GG+ TP++R A QK++  +S ++K LA RA+ RKL P EYQGG+ +ISN+GM 
Sbjct: 299 AVAVAIEGGLFTPVLRDAHQKTLSALSADMKDLAARARDRKLAPSEYQGGSFAISNLGMF 358

Query: 350 GINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIASKLL 408
           GI +F AVINPP   ILA+GAG KK VV  +  + VAT+M+ TLS DHR +DGA+ ++LL
Sbjct: 359 GIENFDAVINPPHGAILAVGAGVKKPVVNADGALAVATVMSVTLSVDHRVIDGALGAELL 418

Query: 409 AKFKEYIENPVWML 422
              K  +ENP+ ML
Sbjct: 419 TAIKGNLENPLAML 432


>gi|149913854|ref|ZP_01902386.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Roseobacter sp. AzwK-3b]
 gi|149812138|gb|EDM71969.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Roseobacter sp. AzwK-3b]
          Length = 446

 Score =  360 bits (923), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 197/450 (43%), Positives = 271/450 (60%), Gaps = 34/450 (7%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD++S GD+L EIETDKA MEFE+VD+G I +IL
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWLVKEGDEVSSGDLLAEIETDKATMEFEAVDDGTIGKIL 60

Query: 62  VPAGTENIAVNSPILNIL--------MDST-------------EIPPSPPLSKENIVEVR 100
           +  GTE + VN+PI  +L        +DST             E P              
Sbjct: 61  IAEGTEGVKVNTPIAVLLDEGESADDIDSTSGDTGGDVKAAASEAPAKTGGEGSGKDAPT 120

Query: 101 EEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE----- 155
            + S +      +  S NR  ASPLARR+A + G+DL+ + GSGPHGRIVK+D++     
Sbjct: 121 AKASDTKAPAAPQDDSGNRIFASPLARRIAADKGVDLAQIKGSGPHGRIVKADVQGAKAG 180

Query: 156 --TLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSK 213
                                    S DA +  ++   +Y  +  D +RKTIA RL ++K
Sbjct: 181 TAAAADAPAAAPAAKQAAPVAPTGPSADA-VAAMYKDRAYTEVKLDGMRKTIAARLTEAK 239

Query: 214 QTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEAN 273
           QT+PHFY+  D  +D LL  R ++N  L    EE   K+SVND I+KA ALA+  VP+AN
Sbjct: 240 QTVPHFYLRRDIRLDALLKFRGELNAQL----EERGVKLSVNDFIIKACALALQAVPDAN 295

Query: 274 VSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKP 333
             W    +++    D++VAV+I GG+ TP+++ A+ KS+  +S E+K LA+RA+ RKL P
Sbjct: 296 AVWAGERVLKLAPSDVAVAVAIEGGLFTPVLKDAEAKSLSALSAEMKDLAKRARDRKLSP 355

Query: 334 EEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATL 392
           EEYQGGT +ISN+GM GI +F AVINPP   ILA+GAG KK VV ++ E+ VAT+M+ TL
Sbjct: 356 EEYQGGTFAISNLGMFGIENFDAVINPPHGAILAVGAGIKKPVVGKDGELSVATVMSVTL 415

Query: 393 SADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S DHR +DGA+ ++LL    + +ENP+ ML
Sbjct: 416 SVDHRVIDGALGAELLQHIVDNLENPLVML 445


>gi|260428116|ref|ZP_05782095.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Citreicella sp. SE45]
 gi|260422608|gb|EEX15859.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Citreicella sp. SE45]
          Length = 440

 Score =  359 bits (921), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 191/439 (43%), Positives = 275/439 (62%), Gaps = 26/439 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD +S GDIL EIETDKA MEFE+VDEG I +IL+  G
Sbjct: 5   ILMPALSPTMEEGTLAKWLVKEGDTVSSGDILAEIETDKATMEFEAVDEGTIGKILISEG 64

Query: 66  TENIAVNSPILNILMD----------STEIPPSPPLSKENIVEVR----EEHSHSSPVVV 111
           +E + VN+PI  +L +          S+  P +P  S+           E+ + ++    
Sbjct: 65  SEGVKVNTPIAVLLEEGESASDISATSSSAPEAPKASEPAAEAAPAGGSEKAAPAAAPAA 124

Query: 112 REKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
            +     R  A+PLARR+A + G+DL+++ GSGPHGRIVK+D+E   +  T     +  +
Sbjct: 125 PQGADGKRIFATPLARRIAADKGLDLAAIKGSGPHGRIVKADVEGASAAPTAKPAAAAAE 184

Query: 172 SFGLVDESIDA-------NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
           +      +           ++ ++    YE +  D +RKT+A RL ++KQTIPHFY+  D
Sbjct: 185 APAAKPAAAAMSAGPGAEQVMKMYEGRDYEEVKLDGMRKTVAARLTEAKQTIPHFYLRRD 244

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
             +D LL  R Q+N+ L+        K+SVND I+KA ALA+  VP+AN  W  + M++ 
Sbjct: 245 IKLDALLKFRSQLNKQLEGR----GVKLSVNDFIIKACALALQSVPDANAVWAGDRMLKL 300

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           K  D++VAV++ GG+ TP+++ A+ KS+  +S E+K LA RA+ RKL P EY GG+ +IS
Sbjct: 301 KPSDVAVAVAVDGGLFTPVLKDAEMKSLSALSAEMKDLAGRARNRKLAPHEYVGGSFAIS 360

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAI 403
           N+GM GI++F AVINPP   ILA+GAG KK VV  + E+ VAT+M+ TLS DHR +DGA+
Sbjct: 361 NLGMFGIDNFDAVINPPHGAILAVGAGVKKPVVGADGELTVATVMSVTLSVDHRVIDGAL 420

Query: 404 ASKLLAKFKEYIENPVWML 422
            ++LL    E +ENP+ ML
Sbjct: 421 GAELLQAIVENLENPMVML 439


>gi|254419497|ref|ZP_05033221.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brevundimonas sp. BAL3]
 gi|196185674|gb|EDX80650.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brevundimonas sp. BAL3]
          Length = 431

 Score =  359 bits (921), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 191/434 (44%), Positives = 268/434 (61%), Gaps = 24/434 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW  + GD +S GD++ EIETDKA ME E+VDEG I +ILV  G
Sbjct: 4   ILMPALSPTMEEGVLAKWHVKVGDVVSAGDVIAEIETDKATMEVEAVDEGEITDILVAEG 63

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREK----------- 114
           TE + VN+PI  +     E   + P   E      EE   ++P  V              
Sbjct: 64  TEGVKVNTPIARL---KDEGGAAAPQKSEKPAAKAEETPKAAPAAVEAPKASAPVAPAPA 120

Query: 115 ----HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
                + +R  +SPLARR+A ++G+DL S+ G+GPHGRIVK D+E            +T 
Sbjct: 121 APKSDNGDRIFSSPLARRIAAQNGVDLKSVKGTGPHGRIVKRDVEAAGKGAAQPAAATTA 180

Query: 171 QSF--GLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNID 228
            +   G+    + +         SY++IP D ++K +A R+  S Q +PHF + IDC ID
Sbjct: 181 AAATSGIAPRQVQSLAQMGIPDGSYDLIPLDGMKKAVARRMVDSIQNVPHFPLFIDCEID 240

Query: 229 NLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHID 288
            L+++R ++N+ L    E    K+SVND I+KA ALA+  VPEAN S+T   +  H + D
Sbjct: 241 QLMAVRAKVNKML----EPQGIKVSVNDFIIKAAALALKMVPEANASYTPEGIAMHHNAD 296

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           +S+AV+I GG++TPIIR+A+ K +  I+ E K LA+RA++RKLKPEE+QGGT S+SN+GM
Sbjct: 297 VSMAVAIDGGLITPIIRKAETKGLAQIATESKDLAKRARERKLKPEEFQGGTFSVSNLGM 356

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLL 408
            GI  F ++IN PQ  I+++GAGE++ V +N +I  AT+M  TL+ DHR VDGA  ++ L
Sbjct: 357 FGIKQFTSIINEPQGCIMSVGAGEQRAVVKNGQIVPATVMTVTLTCDHRVVDGATGARFL 416

Query: 409 AKFKEYIENPVWML 422
             FK  IE+PV ML
Sbjct: 417 QAFKPLIEDPVAML 430


>gi|295689367|ref|YP_003593060.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Caulobacter segnis ATCC 21756]
 gi|295431270|gb|ADG10442.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Caulobacter segnis ATCC 21756]
          Length = 429

 Score =  359 bits (921), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 198/430 (46%), Positives = 269/430 (62%), Gaps = 17/430 (3%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW  + GD +  GD++ EIETDKA ME E+VDEG+++ ILV AG
Sbjct: 5   ILMPALSPTMEEGTLAKWHVKVGDTVKAGDVIAEIETDKATMEVEAVDEGVVEAILVDAG 64

Query: 66  TENIAVNSPILNILMDS--------TEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK 117
           TEN+ VN+ I  +  +          E P +   +             +           
Sbjct: 65  TENVKVNALIAKLAGEGESPAPAPKAEAPKAAAAAPAPTAAPAAPAPAAPAPAAPVAADG 124

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
           +R  ASPLARRLA   G+DL S+ G+GPHGR++KSD+E   S     K      S     
Sbjct: 125 SRVFASPLARRLASAAGLDLKSIKGTGPHGRVIKSDVEAAKSGAPAAKAAPASTSA-APA 183

Query: 178 ESIDANILNL----FAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSL 233
            +     L+L        SY+++P D +RKTIA RL  S + +PHF + ID  ID LL+ 
Sbjct: 184 AAEPRKALSLEQMGIPAGSYDLVPLDGMRKTIARRLTDSFRDVPHFPLQIDLEIDALLAA 243

Query: 234 REQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAV 293
           R ++N  L    E+   K+SVNDI++KA A+A+ QVPEAN S+T   +  H + DI+VAV
Sbjct: 244 RAKINSLL----EKQGVKVSVNDIVIKAAAVALKQVPEANASYTPEGIAMHHNADIAVAV 299

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
           +I GG++TPIIR+A+ K +  IS E+K LAQRAK +KLKPEE+QGGT SISN+GM GI S
Sbjct: 300 AIDGGLITPIIRKAETKGLAQISAEMKDLAQRAKDKKLKPEEFQGGTFSISNLGMFGIKS 359

Query: 354 FCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKE 413
           F ++IN PQ  I+++GAGE++ V +N E+KVAT+M  TL+ DHR VDGAI +K LA FK 
Sbjct: 360 FASIINEPQGAIMSVGAGEQRPVVKNGELKVATVMTVTLTCDHRVVDGAIGAKFLAAFKP 419

Query: 414 YIENPVWMLM 423
            IE P+ +++
Sbjct: 420 LIEEPLTLIV 429


>gi|159044703|ref|YP_001533497.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Dinoroseobacter shibae DFL 12]
 gi|157912463|gb|ABV93896.1| dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Dinoroseobacter shibae DFL 12]
          Length = 420

 Score =  358 bits (919), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 192/430 (44%), Positives = 267/430 (62%), Gaps = 20/430 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+VD+GII +IL
Sbjct: 1   MATEILMPALSPTMEEGTLAKWMVKEGDSVSSGDLLAEIETDKATMEFEAVDDGIIGKIL 60

Query: 62  VPAGTENIAVNSPI--------LNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVRE 113
           V AGT+++ VN+ I                E PP P         V++E +         
Sbjct: 61  VAAGTDDVKVNTLIAILLEEGEELGAEKPAEQPPEP-------ASVQQEAAPQETAKAPP 113

Query: 114 KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSF 173
             + +R  ASPLARRLA + G+DLS + GSGPHGRIVK+D++         +  +  Q+ 
Sbjct: 114 PKTGDRVFASPLARRLAKQKGLDLSEIRGSGPHGRIVKADVDAAEQPAAVPEQAAAPQTR 173

Query: 174 GLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSL 233
                   +++ ++FA   +  +  D +RKTIA RL ++KQTIPHFY+    N+D LL+ 
Sbjct: 174 QPEGPKSASSVASIFADRPFTEVSLDGMRKTIAARLTEAKQTIPHFYLRRAANLDALLTF 233

Query: 234 REQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAV 293
           R ++N  L         K+SVND ++KA A A+  VP AN  W  + +++ +  D++VAV
Sbjct: 234 RTELNAQLAPS----GKKLSVNDFVIKACARALQSVPHANAVWAEDRILQMQRSDVAVAV 289

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
           +I GG+ TP+I+ ADQKSI  +S E+K LA RA++RKL P EY GGT +ISN+GM GI +
Sbjct: 290 AIEGGLFTPVIKDADQKSISALSEEMKDLAARARERKLAPSEYVGGTFAISNLGMFGIEN 349

Query: 354 FCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFK 412
           F AVINPP   ILA+GAG KK  V  +  + VAT M+ TLS DHR +DG++ + LLA+  
Sbjct: 350 FDAVINPPHGAILAVGAGVKKPTVDADGAVTVATQMSMTLSVDHRVIDGSVGAALLAEIV 409

Query: 413 EYIENPVWML 422
             +ENP+ +L
Sbjct: 410 SGLENPLLLL 419


>gi|113473789|ref|YP_718052.1| dihydrolipoamide acetyotransferase, long form [Sphingomonas sp.
           KA1]
 gi|112821469|dbj|BAF03340.1| dihydrolipoamide acetyotransferase, long form [Sphingomonas sp.
           KA1]
          Length = 418

 Score =  358 bits (919), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 194/431 (45%), Positives = 274/431 (63%), Gaps = 32/431 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ + GD +S GDI+ EIETDKA MEFE+VDEG+I +I VPAG
Sbjct: 5   IKMPALSPTMEEGTLAKWLIKVGDTVSSGDIMAEIETDKATMEFEAVDEGVIADIAVPAG 64

Query: 66  TENIAVNSPILNILMDSTE-----IPPS-------PPLSKE-NIVEVREEHSHSSPVVVR 112
           TE + V + I  +  +  E     +P +       P  S E + V V      ++PV   
Sbjct: 65  TEGVKVGTVIATLTCEDEEDSAVTMPKAEVKATAEPAKSAEPSTVSVSTPQPTAAPV--- 121

Query: 113 EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI-STKTNVKDYSTIQ 171
                 R +ASPLA+R+A + G+DL  + GSGP GRIVKSD+E    ST +  +     Q
Sbjct: 122 --SKSGRVVASPLAKRIAAQRGVDLGEIRGSGPSGRIVKSDVEGAQDSTPSETQRAPAPQ 179

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
           +   VD   D +I        YE    +N+RKTIA RL ++KQTIPH Y+++D  +D LL
Sbjct: 180 A--AVDAVPDFSI-------PYEAEKLNNVRKTIARRLTEAKQTIPHIYLTVDARLDGLL 230

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISV 291
            LR ++N+ L    E    K+SVND+++KA A A+I+VP+ NVS+  + + +    DISV
Sbjct: 231 RLRGELNKAL----EPDGVKLSVNDLLIKALAKALIRVPKCNVSFAADELRKFTRADISV 286

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGI 351
           AV+ P G++TPI+  A  K +  IS E+K LA +A++ KL+P EYQGGT S+SN+GM GI
Sbjct: 287 AVAAPSGLITPIVVDAATKGVAQISTEMKALADKAREGKLQPHEYQGGTASLSNLGMFGI 346

Query: 352 NSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKF 411
             F AVINPPQ  I+AIGAGE++    +  + +AT+M+AT S DHR++DGA  ++L+  F
Sbjct: 347 KQFEAVINPPQGMIMAIGAGEQRPYVVDGALAIATVMSATGSFDHRAIDGADGAQLMQAF 406

Query: 412 KEYIENPVWML 422
           K+ +ENP+ ++
Sbjct: 407 KDLVENPLGLV 417


>gi|254436681|ref|ZP_05050175.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Octadecabacter antarcticus 307]
 gi|198252127|gb|EDY76441.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Octadecabacter antarcticus 307]
          Length = 428

 Score =  358 bits (919), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 192/427 (44%), Positives = 275/427 (64%), Gaps = 14/427 (3%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD++  GD++ EIETDKA MEFE+VDEGII +ILV  G
Sbjct: 5   ILMPALSPTMEEGTLAKWLVKEGDEVKSGDLIAEIETDKATMEFETVDEGIIGKILVAEG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKE--------NIVEVREEHSHSSPVVVREKHSK 117
           TE + VN+PI  I  +  E+  +              + V   E  + +S          
Sbjct: 65  TEGVKVNTPICIIGEEGEEMSSASAAPAPKAEAAGVADTVAPAEAAATTSAAPAPAAKDG 124

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
           +R  A+PLARR+A + G+DL+++ GSGPHGRI+K+D+E   +        + + S  +  
Sbjct: 125 SRLFATPLARRIAKDKGLDLATIKGSGPHGRIIKADVENATAQPAAASAAAPLASSAVAV 184

Query: 178 ESIDAN-ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
               A  ++ ++    +E I  D +RK IA RL ++KQT+PHFY+  D  +D LL  R Q
Sbjct: 185 TGPSAQQVIKMYEGRKFEEIKLDGMRKIIASRLTEAKQTVPHFYLRRDIELDTLLKFRSQ 244

Query: 237 MNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIP 296
           +N+TL    E    K+SVND I+KA ALA+ ++PEAN  W  + +++    D++VAV+I 
Sbjct: 245 LNKTL----EPRGVKLSVNDFIIKACALALQEIPEANAVWAGDHVLQMTASDVAVAVAIE 300

Query: 297 GGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCA 356
           GG+ TP+++ A+ KS+  +S ++K LA RA++RKL P EYQGG+ +ISN+GM GI++F A
Sbjct: 301 GGLFTPVLQDAETKSLSALSAQMKDLASRARERKLAPHEYQGGSFAISNLGMFGIDNFDA 360

Query: 357 VINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYI 415
           +INPP S ILA+GAG KK +V  + EIKVATIM+ TLS DHR +DGA+ + LL   K  +
Sbjct: 361 IINPPHSGILAVGAGAKKPIVGADGEIKVATIMSTTLSVDHRVIDGAMGANLLNAIKANL 420

Query: 416 ENPVWML 422
           ENP+ ML
Sbjct: 421 ENPMGML 427


>gi|254509775|ref|ZP_05121842.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodobacteraceae bacterium KLH11]
 gi|221533486|gb|EEE36474.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodobacteraceae bacterium KLH11]
          Length = 431

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 191/438 (43%), Positives = 272/438 (62%), Gaps = 33/438 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+VDEG I +IL+P G
Sbjct: 5   ILMPALSPTMEEGTLAKWLVKEGDTVSSGDLLAEIETDKATMEFEAVDEGTIGKILIPEG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVRE------------ 113
           +E + VN+ I  +L D          S ++I     +   ++P                 
Sbjct: 65  SEGVRVNTAIAVLLEDGE--------SADDIAATPAKAPEAAPAAAGNEAAAPAAPEAPA 116

Query: 114 -------KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKD 166
                  K    R  ASPLARR+A + G+DL+ ++GSGPHGRIVK+D+E+  +       
Sbjct: 117 PAPAAPVKADGGRIFASPLARRIAAQKGLDLAQIAGSGPHGRIVKADVESATAAPAAAPA 176

Query: 167 YSTIQSFGLVDESIDANIL-NLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
            +   +         A+++  ++    YE I  D +RKTIA RL ++KQTIPHFY+  D 
Sbjct: 177 PAAAPAPAAAPAGPSADMVARMYEGREYEEIQLDGMRKTIAARLGEAKQTIPHFYLRRDI 236

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
            +D LL  R Q+N+ L+        K+SVND I+KA A A+ QVPE N  W  + +++ K
Sbjct: 237 KLDALLKFRSQLNKQLEGR----GVKLSVNDFIIKAVANALQQVPECNAVWAGDRVLQLK 292

Query: 286 HIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
             D++VAV+I GG+ TP+++ AD KS+  +S E+K LA RA++RKL P EYQGGT ++SN
Sbjct: 293 PSDVAVAVAIEGGLFTPVLQDADTKSLSALSSEMKDLAGRARERKLAPHEYQGGTFAVSN 352

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIA 404
           +GM GI++F A++NPP + ILA+G G KK VV  + E+ VAT+M+ T+S DHR +DGA+ 
Sbjct: 353 LGMFGIDNFDAIVNPPHAGILAVGTGVKKPVVGDDGELTVATVMSVTMSVDHRVIDGALG 412

Query: 405 SKLLAKFKEYIENPVWML 422
           ++LL    E +ENP+ ML
Sbjct: 413 AELLKAIVENLENPMVML 430


>gi|288958360|ref|YP_003448701.1| pyruvate dehydrogenase E2 component [Azospirillum sp. B510]
 gi|288910668|dbj|BAI72157.1| pyruvate dehydrogenase E2 component [Azospirillum sp. B510]
          Length = 444

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 188/451 (41%), Positives = 275/451 (60%), Gaps = 36/451 (7%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEG LAKW+K+EGD +  GD+L EIETDKA ME E+VDEG I +IL
Sbjct: 1   MTVQILMPALSPTMTEGNLAKWLKKEGDTVKSGDVLAEIETDKATMEVEAVDEGRIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTE----------------IPPSPPLSKENIVEVREEHSH 105
           +PAG++ +AVN+PI  IL++  E                     P               
Sbjct: 61  IPAGSQGVAVNTPI-AILLEEGEDESALASAGSAPAPVPAAAPAPAQTAAPAAAPVPAPA 119

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTK-TNV 164
            +           R  ASPLARR+A + G+DL ++ G+GPHGRIVK+D+E   +     V
Sbjct: 120 PAAPAAAPAAGGARVFASPLARRIAEQAGVDLKTVKGTGPHGRIVKADVEAAKAAGPAKV 179

Query: 165 KD------------YSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQS 212
            D                 +     E +DA  L      +Y  +P+  +RKTIA RL + 
Sbjct: 180 ADTPAAAAPAAAPAPVAAPAPAPKAEGVDAKALADKLGMAYTAVPNSGMRKTIAKRLGEV 239

Query: 213 KQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEA 272
           K+T+P +Y+++D  ID L+ +R ++N      R + + K+SVND I++A ALA+ +VP  
Sbjct: 240 KRTVPDYYLTVDVEIDALMKVRAELN-----GRSD-AYKLSVNDFIIRAVALALKKVPAL 293

Query: 273 NVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLK 332
           N +WT  AM++ +H D+SVAV+ P G++TPI+++A+ K + DIS E+K LA++A+   LK
Sbjct: 294 NAAWTDEAMLQFQHADVSVAVATPTGLITPIVKKAETKGLADISNEMKVLAKKARDNALK 353

Query: 333 PEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATL 392
           PEEYQGGT SISN+GM+GI  F A+INPPQ+ ILA+GA E++ V ++  + +AT+M+ T 
Sbjct: 354 PEEYQGGTISISNLGMMGIKQFAAIINPPQACILAVGASEQRPVVKDGALAIATVMSLTG 413

Query: 393 SADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           + DHR  DGA+ ++ LA  K+ +E+P+ ML+
Sbjct: 414 TFDHRVADGAVGAEFLAAVKKLLEDPLSMLL 444


>gi|163746656|ref|ZP_02154013.1| branched-chain alpha-keto acid dehydrogenase E2 subunit
           [Oceanibulbus indolifex HEL-45]
 gi|161379770|gb|EDQ04182.1| branched-chain alpha-keto acid dehydrogenase E2 subunit
           [Oceanibulbus indolifex HEL-45]
          Length = 453

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 195/453 (43%), Positives = 275/453 (60%), Gaps = 41/453 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD ++ GDIL EIETDKA MEFE+VDEG I +IL+  G
Sbjct: 5   ILMPALSPTMEEGTLAKWMVKEGDTVASGDILAEIETDKATMEFEAVDEGTIGKILISDG 64

Query: 66  TENIAVNSPILNIL--------MDSTEIPPSP---PLSKENIVEVREE------------ 102
           +E + VN+PI  +L        +DS+   P+    P ++E+      E            
Sbjct: 65  SEGVKVNTPIAVLLEEGESADDIDSSAKAPAKEEKPQAEESDKAADAETPEAGYGRGATD 124

Query: 103 ------HSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIET 156
                  S S      +     R  ASPLARR+A + G+DLS + GSGP GRIVK+D+E 
Sbjct: 125 ANDAQGKSDSKAPAAPKSDKGERIFASPLARRIAADKGLDLSQIDGSGPRGRIVKADVEN 184

Query: 157 LISTKTN------VKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQ 210
              +          K+ + +        S DA +  ++    YE +  + +RKTIA RL 
Sbjct: 185 AQPSAVKSDSTAPAKEAAPVAKAVATGPSADA-VAKMYEGREYEEVTLNGMRKTIAARLT 243

Query: 211 QSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVP 270
           ++KQT+PHFY+  D  ID LLS R  +N+ L         K+SVND I+KA ALA+  VP
Sbjct: 244 EAKQTVPHFYLRRDIQIDALLSFRSDLNKQLDAR----GVKLSVNDFIIKACALALQSVP 299

Query: 271 EANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRK 330
           +AN  W  + +++ K  D++VAV+I GG+ TP+++ AD KS+  +S ++K LA RA+ RK
Sbjct: 300 DANAVWAGDRILKLKPSDVAVAVAIEGGLFTPVLQDADTKSLSTLSAQMKDLATRARDRK 359

Query: 331 LKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMN 389
           L P EYQGG+ +ISN+GM GI++F AVINPP   ILA+GAG KK ++ ++ E+  AT+M+
Sbjct: 360 LAPHEYQGGSFAISNLGMFGIDNFDAVINPPHGAILAVGAGLKKPIIGKDGEVTAATVMS 419

Query: 390 ATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
            TLS DHR +DGA+ ++LL    E +ENP+ ML
Sbjct: 420 VTLSVDHRVIDGALGAQLLNAIVENLENPMVML 452


>gi|260433370|ref|ZP_05787341.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417198|gb|EEX10457.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 437

 Score =  357 bits (915), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 192/444 (43%), Positives = 275/444 (61%), Gaps = 39/444 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+VDEG++ +IL+P G
Sbjct: 5   ILMPALSPTMEEGTLAKWLVKEGDTVSSGDLLAEIETDKATMEFEAVDEGVVGKILIPEG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVRE------------ 113
           TE + VN+PI  +L++  E       S ++I  V  +   ++P                 
Sbjct: 65  TEGVKVNTPI-AVLLEEGE-------SADDIAAVPAKAPEAAPAADAGNEAAAPAASEAP 116

Query: 114 ----------KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
                     K    R  ASPLARR+A + G+DL+ + GSGPHGRIVK+D+E   +    
Sbjct: 117 APASATAAPVKADGGRIFASPLARRIAAQKGLDLAQIKGSGPHGRIVKADVEGATAPAAA 176

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAK----DSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
               +   +      +      ++ A+      Y+ +  D +RKTIA RL ++KQTIPHF
Sbjct: 177 PAPAAAASAAPAPAAAPAGPSADMVARMYEGREYQEVKLDGMRKTIAARLAEAKQTIPHF 236

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN 279
           Y+  D  +D LL  R Q+N+ L    E    K+SVND I+KA A A+ QVPE N  W  +
Sbjct: 237 YLRRDIKLDALLKFRSQLNKQL----ESRGVKLSVNDFIIKAVANALQQVPECNAVWAGD 292

Query: 280 AMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
            +++ K  D++VAV+I GG+ TP+++ AD KS+  +S E+K LA RA++RKL P EYQGG
Sbjct: 293 RVLQLKPSDVAVAVAIEGGLFTPVLQDADTKSLSALSTEMKDLAARARERKLAPHEYQGG 352

Query: 340 TTSISNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRS 398
           T +ISN+GM GI++F A++NPP + ILA+G G KK VV ++ E+ VAT+M+ T+S DHR 
Sbjct: 353 TFAISNLGMYGIDNFDAIVNPPHAGILAVGTGAKKPVVGEDGELTVATVMSVTMSVDHRV 412

Query: 399 VDGAIASKLLAKFKEYIENPVWML 422
           +DGA+ ++LL    + +ENP+ ML
Sbjct: 413 IDGALGAQLLQAIVDNLENPMVML 436


>gi|296116186|ref|ZP_06834804.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase [Gluconacetobacter hansenii ATCC 23769]
 gi|295977292|gb|EFG84052.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase [Gluconacetobacter hansenii ATCC 23769]
          Length = 436

 Score =  356 bits (913), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 192/448 (42%), Positives = 276/448 (61%), Gaps = 38/448 (8%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEGKL +W+K+EG+ +S GD++ EIETDKA ME E+VDEGI+  IL
Sbjct: 1   MSTNILMPALSPTMTEGKLLRWLKKEGEAVSAGDVVAEIETDKATMEVEAVDEGILGRIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENI-------------------VEVREE 102
           V  GT+ ++VN+PI  ++ +   +P +P                              + 
Sbjct: 61  VQEGTDAVSVNTPIAILVTEGEAVPDAPSPPATPPTPAPVTAPAAAAIPATTMPAATGQG 120

Query: 103 HSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKT 162
               +    R +    R  ASPLARR+A + GIDLS+L+GSGP+GRIV+ D+E       
Sbjct: 121 TGQEARGQARGQARGQRIFASPLARRIASQKGIDLSALNGSGPNGRIVRRDVE------- 173

Query: 163 NVKDYSTIQSFGLVDESIDANI------LNLFAKDS-YEVIPHDNIRKTIACRLQQSKQT 215
                +TIQ          A +      +   A D+ +  + +  +RK IA RL ++K T
Sbjct: 174 ----QATIQPAASPAAPPTATVPAPVQDIAAIAGDTPHHTVANSTMRKVIARRLSEAKST 229

Query: 216 IPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVS 275
           IPHFYV +D  +D LL+LR Q+N          + KISVND+++KA A+ + +VP+ NVS
Sbjct: 230 IPHFYVEVDVELDALLALRTQLNAASPADGPG-AYKISVNDMLIKAAAVTLRRVPDVNVS 288

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           +  +  + +  IDIS+AVSIP G++TPI+RQAD KS+  IS E + L +RA+  KLKP E
Sbjct: 289 FAGDMTVHYDTIDISMAVSIPDGLITPIVRQADHKSLGQISAETRDLIKRARAGKLKPHE 348

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSAD 395
           +QGGT SISNMGM+G+ +F A+INPPQ+ ILAI AGE + V ++  I +AT+M  TLS D
Sbjct: 349 FQGGTFSISNMGMMGVKAFSAIINPPQAAILAIAAGEARPVVKDGGISIATVMTVTLSVD 408

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR VDGA+A++ ++ F+  +ENP+ +L+
Sbjct: 409 HRVVDGALAAQWVSVFRSVVENPLSLLV 436


>gi|218674665|ref|ZP_03524334.1| dihydrolipoamide acetyltransferase homoserine dehydrogenase
           [Rhizobium etli GR56]
          Length = 428

 Score =  356 bits (913), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 184/429 (42%), Positives = 271/429 (63%), Gaps = 8/429 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P +   M  GK++KW  +EGD++  GD+L EIETDKA ME +S   GI+  + 
Sbjct: 1   MATEIILPKVDMDMATGKISKWFFKEGDRVGKGDVLFEIETDKAAMEIDSPAAGILRNVN 60

Query: 62  VPAGTENIAVNSPILNILMDSTE------IPPSPPLSKENIVEVREEHSHSSPVVVREKH 115
              G + IAV S +  I  +  E             ++    +  +  S S+P       
Sbjct: 61  GEEGVD-IAVGSAVAWIYEEGEEHQAASAPSAPALPAETGTSDATDLGSISAPHHNASAG 119

Query: 116 SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGL 175
           + +   A+PLARRLA E+GIDL S++G+GPHGRI  +D+      +  +   +   +  +
Sbjct: 120 AGSSIRATPLARRLARENGIDLGSVAGTGPHGRIRSADVSKARGAEAPLAPSAPAGAQHV 179

Query: 176 VDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLRE 235
             ++     L LFA+ +++V PH  +R+TIA RL ++K TIPHFY+S+DC ID LL LR 
Sbjct: 180 GQKAASDGSLALFAEGTFDVQPHTPMRRTIARRLLEAKTTIPHFYLSLDCRIDALLKLRA 239

Query: 236 QMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSI 295
           ++N +          K+SVND+++KA+ALA+   P+ANVSWT  +++RH  +D+ VAVS+
Sbjct: 240 ELNASAPMADGAPQFKLSVNDMVIKAYALALGSTPDANVSWTEESLLRHHFVDVGVAVSV 299

Query: 296 PGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFC 355
            GG++TPIIR A+ K++  IS E+K LA RA+  KLKP EYQGGT +ISN+GM G+  F 
Sbjct: 300 AGGLITPIIRHAESKTLSTISNEMKDLATRARSGKLKPAEYQGGTGAISNLGMFGVREFA 359

Query: 356 AVINPPQSTILAIGAGEKKVVFQNE-EIKVATIMNATLSADHRSVDGAIASKLLAKFKEY 414
           A+INPP STILA+G+GE++ V   E ++  AT+M  TLS DHR+VDGA+ ++LL KF+ +
Sbjct: 360 AIINPPHSTILAVGSGERRPVVNAEGDLSSATVMTVTLSTDHRAVDGALGAQLLGKFQAF 419

Query: 415 IENPVWMLM 423
           IENP+ ML+
Sbjct: 420 IENPMSMLI 428


>gi|154247814|ref|YP_001418772.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Xanthobacter autotrophicus Py2]
 gi|154161899|gb|ABS69115.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Xanthobacter autotrophicus Py2]
          Length = 448

 Score =  355 bits (912), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 182/444 (40%), Positives = 272/444 (61%), Gaps = 26/444 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM +G LAKW+K+EGD +  GD+L EIETDKA ME ES+DEGI+ +ILVP G
Sbjct: 5   ILMPALSPTMEKGNLAKWLKKEGDTVKSGDVLAEIETDKATMEVESIDEGILAKILVPEG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVR------------- 112
           ++++ VN  I  +  +  ++  +               +  +                  
Sbjct: 65  SQDVPVNQLIALLAGEGEDVAAAAAGGGAKAAAAPAAAAAPAAAAPAAAAPAAAPAPAAA 124

Query: 113 --EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
                   R  ASPLARR+A + GIDL++L+GSGPHGRIV  D+E            +  
Sbjct: 125 PASNGQGGRVFASPLARRIAKDKGIDLAALAGSGPHGRIVARDLEGAKPGAKPAAAPAAA 184

Query: 171 QSFGLVDESIDA----------NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
            +                     +  +F   SYE +  D +RKTIA RL +S+Q  P F+
Sbjct: 185 ATPAPAAAPAPKAAVASAPGAEQVKAMFEAGSYEEVQLDGMRKTIARRLVESEQVTPTFF 244

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHRE-EISNKISVNDIILKAFALAMIQVPEANVSWTTN 279
           +++DC++D+L++LREQ+N      ++ + S ++SVND I+KA ALA+ +VP AN  W  +
Sbjct: 245 LTVDCDLDDLMALREQVNANASKDKDGKPSYRVSVNDFIIKAMALALQKVPAANAVWAED 304

Query: 280 AMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
            ++R KH D+ VAV+I GG+  PI+++A+QK++  IS E++ LA RA+ +KLKP+EY GG
Sbjct: 305 RILRMKHSDVGVAVAIDGGLYAPIVKKAEQKTLSAISNEMRDLAGRARTKKLKPDEYSGG 364

Query: 340 TTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSV 399
           +TS+SN+GM+GI +F A+IN PQS+ILA+GA E++ V +N EIK    M  T++ DHR +
Sbjct: 365 STSVSNLGMMGIRNFTAIINAPQSSILAVGASEQRAVVRNGEIKAVMQMTVTMTCDHRVM 424

Query: 400 DGAIASKLLAKFKEYIENPVWMLM 423
           DGA+ ++LL+ FK +IE P+ ML+
Sbjct: 425 DGALGAELLSAFKGFIEKPMSMLV 448


>gi|146277139|ref|YP_001167298.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Rhodobacter sphaeroides ATCC 17025]
 gi|145555380|gb|ABP69993.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 438

 Score =  355 bits (911), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 195/441 (44%), Positives = 271/441 (61%), Gaps = 24/441 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+K+EGD++  GDIL EIETDKA MEFE+VDEGI+ +IL
Sbjct: 1   MATEILMPALSPTMEEGTLAKWLKKEGDEVRSGDILAEIETDKATMEFEAVDEGILGKIL 60

Query: 62  VPAGTENIAVNSPILNILMD-------STEIPPSPPLSKENIVEVREEHSHSSPVVVREK 114
           +  GT  + VN+PI  ++ +       S+   P+P   K+     +E    S        
Sbjct: 61  IAEGTAGVKVNTPIAVLVEEGESADAVSSGKTPAPEEPKDEAAPAQEAPKASPAASPAPA 120

Query: 115 HSK--NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE----------TLISTKT 162
                +R  ASPLARR+A E G+DL+++ GSGP GRIVK+D+E             +   
Sbjct: 121 AKPEGDRIFASPLARRIATEKGLDLATVKGSGPRGRIVKADVEGAQKPAAPAAKAEAAAP 180

Query: 163 NVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVS 222
                +   +      +  A++  LFA   +E I  D +RKTIA RL ++KQTIPHFY+ 
Sbjct: 181 QADAPAAAAAPVTSPAASAASVAKLFADREFEEITLDGMRKTIAARLSEAKQTIPHFYLR 240

Query: 223 IDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMI 282
            +  +D L++ R  +N  L    E    K+SVND I+KA A+A+ QVP AN  W  + ++
Sbjct: 241 REVALDALMAFRADLNAKL----ESRGVKLSVNDFIIKACAVALQQVPNANAVWAGDRIL 296

Query: 283 RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTS 342
           R K  D++VAV+I GG+ TP++R A QKS+  +S E+K LA RA+ +KL P EYQGG+ +
Sbjct: 297 RLKPSDVAVAVAIEGGLFTPVLRDAHQKSLSALSAEMKDLAARARTKKLAPHEYQGGSFA 356

Query: 343 ISNMGMLGINSFCAVINPPQSTILAIGAG-EKKVVFQNEEIKVATIMNATLSADHRSVDG 401
           ISN+GM GI +F AVINPP  +ILA+GAG  K VV ++  I  AT+M+ TLS DHR +DG
Sbjct: 357 ISNLGMFGIENFDAVINPPHGSILAVGAGIRKPVVAKDGAITTATMMSMTLSVDHRVIDG 416

Query: 402 AIASKLLAKFKEYIENPVWML 422
           A+ ++ L    E +ENP+ ML
Sbjct: 417 ALGAEFLKAIVENLENPIAML 437


>gi|167646719|ref|YP_001684382.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Caulobacter sp. K31]
 gi|167349149|gb|ABZ71884.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Caulobacter sp. K31]
          Length = 436

 Score =  355 bits (911), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 195/446 (43%), Positives = 271/446 (60%), Gaps = 42/446 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW  + GD +  GD++ EIETDKA ME E+VDEG+++ ILV AG
Sbjct: 5   ILMPALSPTMEEGTLAKWHVKVGDTVKAGDVIAEIETDKATMEVEAVDEGVVEAILVEAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVRE-------------EHSHSSPVVVR 112
           TEN+ VN+ I  +  +     P+P          +              E +  +   + 
Sbjct: 65  TENVKVNALIAKLAGEGESPAPAPAKPAPAAGAPKAAAPAPAAPVQAAGETAAPAKPALA 124

Query: 113 EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQS 172
              + +R  ASPLARRLA    +DL S++GSGPHGR+VK+D+E   +TK          +
Sbjct: 125 PAPAGDRVFASPLARRLASAANLDLKSIAGSGPHGRVVKADVEA--ATKGGAPAAKAASA 182

Query: 173 ---------------FGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIP 217
                            L  + I A         SY+++P D +RKTIA RL  S + +P
Sbjct: 183 SATASAPAAAAPRAHLSLEQQGIPAG--------SYDLVPLDGMRKTIARRLTDSFRDVP 234

Query: 218 HFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWT 277
           HF ++ID  ID LL+ R ++N  L+        K+SVNDII+KA A+A+ +VPEAN S+T
Sbjct: 235 HFPLTIDLEIDALLAARAKINHLLEGQ----GVKVSVNDIIIKAVAVALKRVPEANASYT 290

Query: 278 TNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQ 337
              +  H H DI+VAV+I GG++TPI+R A+ K +  IS EVK LA RAK +KLKPEE+Q
Sbjct: 291 PEGIALHHHADIAVAVAIDGGLITPIVRAAETKGLAQISAEVKDLAARAKSKKLKPEEFQ 350

Query: 338 GGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHR 397
           GGT S+SN+GM GI +F ++IN PQ  I+++GAGE++ V +N E+ VAT+M  TL+ DHR
Sbjct: 351 GGTFSVSNLGMFGIKAFASIINEPQGAIMSVGAGEQRPVVKNGELAVATVMTITLTCDHR 410

Query: 398 SVDGAIASKLLAKFKEYIENPVWMLM 423
            VDGAI ++ LA FK  IE P+ +L+
Sbjct: 411 VVDGAIGARFLAAFKPLIEEPLTLLV 436


>gi|163736627|ref|ZP_02144046.1| Dihydrolipoamide acetyltransferase, long form [Phaeobacter
           gallaeciensis BS107]
 gi|161390497|gb|EDQ14847.1| Dihydrolipoamide acetyltransferase, long form [Phaeobacter
           gallaeciensis BS107]
          Length = 441

 Score =  355 bits (910), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 185/440 (42%), Positives = 269/440 (61%), Gaps = 27/440 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD ++ GD+L EIETDKA MEFE+VDEG+I +IL+P G
Sbjct: 5   ILMPALSPTMEEGTLAKWLVKEGDTVASGDLLAEIETDKATMEFEAVDEGVIGKILIPEG 64

Query: 66  TENIAVNSPILNILMDS----------------TEIPPSPPLSKENIVEVREEHSHSSPV 109
           +E + VNSPI  +L D                           +      +   + +   
Sbjct: 65  SEGVKVNSPIAVLLEDGESADDIGATPAAPAAAANKAAPAASEEAASAPAQATTAATPAP 124

Query: 110 VVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIET------LISTKTN 163
              +    NR  ASPLARR+A + G+DLS L+GSGP GRIVK+D+E              
Sbjct: 125 AAPQGADGNRIFASPLARRIAADKGLDLSQLNGSGPRGRIVKADVENAKPQAAAAPAAAA 184

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
               +   +           +  ++   +YE +  D +RKTIA RL ++KQT+PHFY+  
Sbjct: 185 PATAAASAAAAAPTGPSADQVARMYEGRTYEEVKLDGMRKTIAARLTEAKQTVPHFYLRR 244

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           D  +D LL  R ++N+ L+        K+SVND I+KA ALA+  VP+AN  W  + +++
Sbjct: 245 DIQLDALLKFRGELNKQLEAR----GVKLSVNDFIIKACALALQAVPDANAVWAGDRVLK 300

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
            +  D++VAV+I GG+ TP+++ +D KS+  +S E+K LA+RA+ RKL P EYQGG+ +I
Sbjct: 301 MEASDVAVAVAIEGGLFTPVLQNSDTKSLSTLSTEMKDLAKRARDRKLAPHEYQGGSFAI 360

Query: 344 SNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGA 402
           SN+GM GI++F A++NPP + ILA+GAG KK VV  + E+ VAT+M+ T+S DHR +DGA
Sbjct: 361 SNLGMFGIDNFDAIVNPPHAGILAVGAGVKKPVVGADGELAVATVMSVTMSVDHRVIDGA 420

Query: 403 IASKLLAKFKEYIENPVWML 422
           + ++LL   K+ +ENP+ ML
Sbjct: 421 LGAELLNAIKDNLENPMMML 440


>gi|255263686|ref|ZP_05343028.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Thalassiobium sp. R2A62]
 gi|255106021|gb|EET48695.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Thalassiobium sp. R2A62]
          Length = 431

 Score =  355 bits (910), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 193/431 (44%), Positives = 274/431 (63%), Gaps = 19/431 (4%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+VDEG I +IL+  G
Sbjct: 5   ILMPALSPTMEEGTLAKWLVKEGDTVSSGDLLAEIETDKATMEFEAVDEGTIGKILIAEG 64

Query: 66  TENIAVNSPILNILMDS-----------TEIPPSPPLSKENIVEVREEHSHSSPVVVREK 114
           TE +AVN+ I  +L D                P+P    ++        + S+P      
Sbjct: 65  TEGVAVNTAIAVLLEDGESADDIGSAPAAAAAPAPAAKSDDAPGAPVAAAPSAPAAAPVA 124

Query: 115 HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFG 174
           ++  R  ASPLARR+A + G+DLS ++GSGP GRIVK+D++   +        +   +  
Sbjct: 125 NNGTRIFASPLARRIAADKGLDLSQMAGSGPKGRIVKADVQGAAAQPAKPAASAPAATTA 184

Query: 175 LVDE--SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232
            +    S DA ++ ++   S+E +P   +RK +A RL ++KQTIPHFY+  D  IDNLLS
Sbjct: 185 PMASGPSSDA-VIKMYEGRSFEEVPLSGMRKVVATRLTEAKQTIPHFYLRRDIQIDNLLS 243

Query: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVA 292
            R Q+N+ L    E    K+SVND I+KA ALA+   PEAN  W  +  ++ +  D++VA
Sbjct: 244 FRAQLNKQL----EARGVKLSVNDFIIKACALALQSNPEANAVWAGDRTLKMEASDVAVA 299

Query: 293 VSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGIN 352
           V+I GG+ TP+++ A+ +S+  +S E+K LA RA+ RKL P EYQGG+ +ISN+GM GI+
Sbjct: 300 VAIEGGLFTPVLQDAENRSLSALSAEMKDLASRARDRKLAPHEYQGGSFAISNLGMFGID 359

Query: 353 SFCAVINPPQSTILAIGAGEKKV-VFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKF 411
           +F AVINPP   ILA+GAG+K+  V  + E+ VATIM+ TLS DHR +DGA+ ++LL   
Sbjct: 360 NFDAVINPPHGAILAVGAGKKRPHVGADGELGVATIMSCTLSVDHRVIDGALGAELLQSI 419

Query: 412 KEYIENPVWML 422
            + +ENP+ ML
Sbjct: 420 VDNLENPMGML 430


>gi|167644549|ref|YP_001682212.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Caulobacter sp. K31]
 gi|167346979|gb|ABZ69714.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Caulobacter sp. K31]
          Length = 415

 Score =  355 bits (910), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 186/428 (43%), Positives = 268/428 (62%), Gaps = 19/428 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M  +I MP+LS  M E  + +W+K  GD I+PGD++ EIETDKA +E E+   G I  IL
Sbjct: 1   MAQSIVMPALSAGMEEATIVRWLKTVGDVIAPGDLIAEIETDKATIELEAEQTGKIGRIL 60

Query: 62  VPAGTENIAVNSPILNILM------DSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKH 115
              G   +AVN+ I  +L       D +E   + P +    V  R+  + +  +   +  
Sbjct: 61  AAEGA-TVAVNAEIALLLAEGEHVDDLSEAEKAAPETASVAVTSRDAAAAAGSM---DST 116

Query: 116 SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGL 175
              R  ASPLARR+A   G+ L +L GSGPHGRIV+ D+E  IS      D +  ++  +
Sbjct: 117 QHRRIAASPLARRIAQAKGVGLDTLRGSGPHGRIVRIDVEAAISALPQTVDGAPAEAASI 176

Query: 176 VDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLRE 235
              S  A+ L+L     Y  IP  NIRK IA RL ++K TIPHFY+ +DC ID LL  RE
Sbjct: 177 ---SPPASRLHLI-DTPYTEIPLTNIRKVIARRLTEAKATIPHFYLEVDCEIDELLKSRE 232

Query: 236 QMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSI 295
            +N      R +    +S+ND+++KA ALA+ QVPEAN +WT +A+I+ + +DISVAV+ 
Sbjct: 233 TLN-----ARSDGQYNLSLNDLVIKAAALALRQVPEANTAWTDDAIIQFQDVDISVAVAT 287

Query: 296 PGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFC 355
            GG++TPI+RQAD++ +  IS EV+ LA RA++ +L+P E+QGG+ +ISN+GM G+ +F 
Sbjct: 288 DGGLITPIVRQADRRGLASISAEVRTLAARAREGRLEPAEFQGGSFTISNLGMFGVRAFS 347

Query: 356 AVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYI 415
           A+INPPQS ILA+GA E++ V + E    AT+M  TLS DHR+VDG + ++ LA FK  I
Sbjct: 348 AIINPPQSCILAVGAAERRPVVRGEACVPATVMTCTLSVDHRAVDGVVGARYLAAFKSLI 407

Query: 416 ENPVWMLM 423
           E P+ +++
Sbjct: 408 EQPLRLML 415


>gi|254464390|ref|ZP_05077801.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodobacterales bacterium Y4I]
 gi|206685298|gb|EDZ45780.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodobacterales bacterium Y4I]
          Length = 440

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 189/439 (43%), Positives = 273/439 (62%), Gaps = 26/439 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD +S GD++ EIETDKA MEFE+VDEG+I +IL+  G
Sbjct: 5   ILMPALSPTMEEGTLAKWLVKEGDTVSSGDLIAEIETDKATMEFEAVDEGVIGKILIAEG 64

Query: 66  TENIAVNSPILNILMD----------STEIPPSPPLSKENIVEVREEHSHSSPVVVR--- 112
           +E + VN+PI  +L D          S +  P+    +E   E + E    +P       
Sbjct: 65  SEGVKVNTPIAVLLEDGESADDIGSSSADAAPAQEAKEEAPAEAKSEAKADAPKEEAKAA 124

Query: 113 ----EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYS 168
               +    NR  ASPLARR+A + G+DL+ ++GSGP GRIVK+D+              
Sbjct: 125 PAAPQGADGNRIFASPLARRIAADKGLDLARITGSGPKGRIVKADVIDAKPQAAAAPKAE 184

Query: 169 TIQSFGLVDESIDANILNLFAK----DSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
              +      +      ++ A+      YE +  D +RKTIA RL ++KQTIPHFY+  D
Sbjct: 185 ASAAPAPAAAAPSGPSADMVARMYEGRDYEEVKLDGMRKTIAARLTEAKQTIPHFYLRRD 244

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
             +D LL  R ++N+ L+        K+SVND I+KA ALA+  VP+AN  W  + +++ 
Sbjct: 245 IQLDALLKFRGELNKQLEGR----GVKLSVNDFIIKAVALALQAVPDANAVWAGDRVLKM 300

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           K  D++VAV+I GG+ TP+++ AD KS+  +S ++K LA+RA+ RKL P EYQGG+ +IS
Sbjct: 301 KASDVAVAVAIEGGLFTPVLQDADSKSLSALSAQMKDLAKRARDRKLAPHEYQGGSFAIS 360

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAI 403
           N+GM GI++F A++NPP + ILA+G+G KK VV  + E+KVAT+M+ T+S DHR +DGA+
Sbjct: 361 NLGMFGIDNFDAIVNPPHAGILAVGSGVKKPVVGADGELKVATLMSVTMSVDHRVIDGAL 420

Query: 404 ASKLLAKFKEYIENPVWML 422
            + LL    E +ENP+ ML
Sbjct: 421 GADLLKAIVENLENPMVML 439


>gi|77463040|ref|YP_352544.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Rhodobacter sphaeroides 2.4.1]
 gi|77387458|gb|ABA78643.1| Dihydrolipoamide acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [Rhodobacter sphaeroides 2.4.1]
          Length = 442

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 192/448 (42%), Positives = 273/448 (60%), Gaps = 34/448 (7%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+K+EGD++  GDI+ EIETDKA MEFE+VDEGI+ +IL
Sbjct: 1   MATEILMPALSPTMEEGTLAKWLKKEGDEVRSGDIIAEIETDKATMEFEAVDEGILGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPV------------ 109
           +  GT  + VN+PI  ++ +   +     +S   + E +E    ++P             
Sbjct: 61  IAEGTAGVKVNTPIAVLVEEGESVDA---VSSAKVPEPQEPADEAAPAQGAPKEAPAPAA 117

Query: 110 ----VVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE---------- 155
                   +    R  ASPLARR+A E GIDL+++ GSGP GRIVK+D+E          
Sbjct: 118 KAPAAQAARSEGERVFASPLARRIAKEKGIDLAAVQGSGPRGRIVKADVEGAQPSAAPAA 177

Query: 156 TLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQT 215
              +     +  +   +      +  A++  LFA   YE +  D +RKTIA RL ++KQT
Sbjct: 178 KADAAAPKAEAPAAAAAPVAAPAASAASVAKLFADRDYEEVTLDGMRKTIAARLSEAKQT 237

Query: 216 IPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVS 275
           IPHFY+  +  +D L++ R  +N  L    E    K+SVND I+KA A+A+ QVP AN  
Sbjct: 238 IPHFYLRREVALDALMAFRADLNAKL----ESRGVKLSVNDFIIKACAVALQQVPNANAV 293

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           W  + ++R K  D++VAV+I GG+ TP++R A QKS+  +S E+K LA RA+ +KL P E
Sbjct: 294 WAGDRILRLKPSDVAVAVAIEGGLFTPVLRDAHQKSLSALSAEMKDLAARARTKKLAPHE 353

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSA 394
           YQGG+ +ISN+GM G+ +F AVINPP  +ILA+GAG +K VV ++  I  AT+M+ TLS 
Sbjct: 354 YQGGSFAISNLGMFGVENFDAVINPPHGSILAVGAGIRKPVVGKDGAITTATMMSMTLSV 413

Query: 395 DHRSVDGAIASKLLAKFKEYIENPVWML 422
           DHR +DGA+ ++ L    E +ENP+ ML
Sbjct: 414 DHRVIDGALGAEFLKAIVENLENPIAML 441


>gi|254452451|ref|ZP_05065888.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Octadecabacter antarcticus 238]
 gi|198266857|gb|EDY91127.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Octadecabacter antarcticus 238]
          Length = 446

 Score =  354 bits (908), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 186/445 (41%), Positives = 278/445 (62%), Gaps = 32/445 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD++  GD++ EIETDKA MEFE+V+EGI+ ++LV  G
Sbjct: 5   ILMPALSPTMEEGTLAKWLVKEGDEVKSGDLIAEIETDKATMEFEAVEEGIVSKLLVAEG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSP-PLSKENIVEVREEHSHSSPVVVREKHSK------- 117
           TE + VN+PI  I  +  ++  +P P SKE++ +  +  S                    
Sbjct: 65  TEGVKVNTPICIIGEEGEDMSSAPAPKSKESVKDQGDTLSADKAESAAPASEPAAAPASA 124

Query: 118 ----------NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDY 167
                     +R  A+PLARR+A + G+DL+++ GSGPHGRI+K+D+E   +        
Sbjct: 125 PKAAPAAKDGSRLFATPLARRIAKDKGLDLATIKGSGPHGRIIKADVENASAQPAAALAA 184

Query: 168 STIQSFGLVDESIDA---------NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPH 218
           +   +      +  A          ++ ++   +++ +  D +RK IA RL ++KQT+PH
Sbjct: 185 AAAPASAAPAAATGAIAATGPSTEQVIKMYEGRTFKEVKLDGMRKIIASRLTEAKQTVPH 244

Query: 219 FYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTT 278
           FY+  D  +D LL  R Q+N+TL    E    K+SVND I+KA ALA+ ++PEAN  W  
Sbjct: 245 FYLRRDIELDALLKFRSQLNKTL----EPRGVKLSVNDFIIKACALALQEIPEANAVWAG 300

Query: 279 NAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQG 338
           + +++    D++VAV+I GG+ TP+++ A+ KS+  +S ++K LA RA+ RKL P EYQG
Sbjct: 301 DRVLQMTASDVAVAVAIEGGLFTPVLQDAETKSLSALSAQMKDLAARARDRKLAPHEYQG 360

Query: 339 GTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHR 397
           G+ +ISN+GM GI++F A+INPP S ILA+GAG KK +V  + +IKVAT+M+ TLS DHR
Sbjct: 361 GSFAISNLGMFGIDNFDAIINPPHSAILAVGAGAKKPIVGADGDIKVATVMSTTLSVDHR 420

Query: 398 SVDGAIASKLLAKFKEYIENPVWML 422
            +DGA+ + LL   K  +ENP+ ML
Sbjct: 421 VIDGAMGANLLNAIKANLENPMGML 445


>gi|83950476|ref|ZP_00959209.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Roseovarius
           nubinhibens ISM]
 gi|83838375|gb|EAP77671.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Roseovarius
           nubinhibens ISM]
          Length = 429

 Score =  354 bits (908), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 192/440 (43%), Positives = 270/440 (61%), Gaps = 37/440 (8%)

Query: 8   MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTE 67
           MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+VDEG+I +ILV  G+E
Sbjct: 1   MPALSPTMEEGTLAKWLVKEGDTVSSGDLLAEIETDKATMEFEAVDEGVIGKILVAEGSE 60

Query: 68  NIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK---------- 117
            + VN+PI  +L++  E       S ++I E     +       +   +           
Sbjct: 61  GVKVNTPI-AVLLEEGE-------SADDIGEASAPAAEPKAEAPKSDAAPKPEAAPAASA 112

Query: 118 ---------NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYS 168
                     R  ASPLARR+A + G+DLS +SGSGP GRIVK+D+E    +        
Sbjct: 113 APAAPKADGERIFASPLARRIAADKGLDLSQISGSGPRGRIVKADVENAQPSAAKPAAKD 172

Query: 169 TIQSFGLVDESI-----DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
              +              + ++ ++    YE IP + +RKTIA RL ++KQ+IPHFY+  
Sbjct: 173 QPAAAPAAAAPAATGPSSSQVIAMYEGREYEEIPLNGMRKTIAARLTEAKQSIPHFYLRR 232

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           D  +D LL  R Q+N+ L+      S K+SVND I+KA ALA+  VP AN  W  + +++
Sbjct: 233 DIRLDALLKFRGQLNKQLEAR----SVKLSVNDFIIKACALALQTVPAANAVWAGDRVLQ 288

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
            K  D++VAV+I GG+ TP+++ A+ KS+  +S E+K LA RA+ RKL P EYQGG+ +I
Sbjct: 289 LKPSDVAVAVAIEGGLFTPVLKDAEMKSLSALSSEMKDLASRARDRKLAPHEYQGGSFAI 348

Query: 344 SNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGA 402
           SN+GM GI++F AVINPP   ILA+GAG KK VV  + E+ VAT+M+ TLS DHR +DGA
Sbjct: 349 SNLGMFGIDNFDAVINPPHGAILAVGAGVKKPVVGADGELSVATVMSVTLSVDHRVIDGA 408

Query: 403 IASKLLAKFKEYIENPVWML 422
           + ++LL    + +ENP+ ML
Sbjct: 409 LGAQLLDAIVQNLENPMVML 428


>gi|332557916|ref|ZP_08412238.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Rhodobacter sphaeroides WS8N]
 gi|332275628|gb|EGJ20943.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Rhodobacter sphaeroides WS8N]
          Length = 438

 Score =  354 bits (908), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 192/444 (43%), Positives = 270/444 (60%), Gaps = 30/444 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+K+EGD++  GDI+ EIETDKA MEFE+VDEGI+ +IL
Sbjct: 1   MATEILMPALSPTMEEGTLAKWLKKEGDEVRSGDIIAEIETDKATMEFEAVDEGILGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPV------------ 109
           +  GT  + VN+PI  ++ +   +     +S     E +E    ++P             
Sbjct: 61  IAEGTAGVKVNTPIAVLVEEGESVDA---VSSAKAPEPQEPADEAAPAQGDPKEAPAPAA 117

Query: 110 ----VVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE------TLIS 159
                   +    R  ASPLARR+A E GIDL+++ GSGP GRIVK+D+E         +
Sbjct: 118 KAPAAQAARSEGERVFASPLARRIAKEKGIDLAAVQGSGPRGRIVKADVEGAQPSAAPAA 177

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
                   +   +      +  A++  LFA   YE +  D +RKTIA RL ++KQTIPHF
Sbjct: 178 KADVAAPKAEAPAAAAAPAASAASVAKLFADRDYEEVTLDGMRKTIAARLSEAKQTIPHF 237

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN 279
           Y+  +  +D L++ R  +N  L    E    K+SVND I+KA A+A+ QVP AN  W  +
Sbjct: 238 YLRREVALDALMAFRADLNAKL----ESRGVKLSVNDFIIKACAVALQQVPNANAVWAGD 293

Query: 280 AMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
            ++R K  D++VAV+I GG+ TP++R A QKS+  +S E+K LA RA+ +KL P EYQGG
Sbjct: 294 RILRLKPSDVAVAVAIEGGLFTPVLRDAHQKSLSALSAEMKDLAARARTKKLAPHEYQGG 353

Query: 340 TTSISNMGMLGINSFCAVINPPQSTILAIGAG-EKKVVFQNEEIKVATIMNATLSADHRS 398
           + +ISN+GM G+ +F AVINPP  +ILA+GAG  K VV ++  I  AT+M+ TLS DHR 
Sbjct: 354 SFAISNLGMFGVENFDAVINPPHGSILAVGAGIRKPVVGKDGAITTATMMSMTLSVDHRV 413

Query: 399 VDGAIASKLLAKFKEYIENPVWML 422
           +DGA+ ++ L    E +ENP+ ML
Sbjct: 414 IDGALGAEFLKAIVENLENPIAML 437


>gi|310815648|ref|YP_003963612.1| branched-chain alpha-keto acid dehydrogenase E2 subunit
           [Ketogulonicigenium vulgare Y25]
 gi|308754383|gb|ADO42312.1| branched-chain alpha-keto acid dehydrogenase E2 subunit
           [Ketogulonicigenium vulgare Y25]
          Length = 432

 Score =  354 bits (908), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 194/432 (44%), Positives = 275/432 (63%), Gaps = 20/432 (4%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG +AKW+  EGD +  GDIL EIETDKA MEFE+VD+G+I +IL+PAG
Sbjct: 5   ILMPALSPTMEEGTIAKWLVAEGDTVKSGDILAEIETDKATMEFEAVDDGVIGKILLPAG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVE---VREEHSHSSPVVVREKHSKNRPIA 122
           +E + VN+P + IL++  E   + P +    VE   V    +             +R  A
Sbjct: 65  SEGVKVNTP-MAILLEDGETEAAAPKAAAPKVEAAPVEAPKAAPVAAAAAPVEKGDRVFA 123

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE------TLISTKTNVKDYSTIQSFGLV 176
           SPLARR+A + G+DL++++GSGP GRIV++D+E         + K       T  +   V
Sbjct: 124 SPLARRIAADKGLDLNAIAGSGPKGRIVRADVEGATAAKPAEAAKAPAAAAPTPAAPAPV 183

Query: 177 DESIDAN-ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLRE 235
             S  A+ IL ++    Y  +  D +RKTIA RL ++KQT+PHFY+    N+D L++ R 
Sbjct: 184 PTSSSADQILKMYQGRDYTEVKLDGMRKTIAARLTEAKQTVPHFYLRRSVNLDALMAFRA 243

Query: 236 QMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSI 295
            +N  L         KISVND ++KA A+A+ QVP+AN  W  + +++ K  D+S+AV++
Sbjct: 244 DLNAKLGPR----GIKISVNDFVIKACAIALQQVPKANAIWAGDRVLQMKASDVSIAVAV 299

Query: 296 PGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFC 355
            GG+ TP+IR AD KSI  +S E+K LA+RA+ +KL+P++YQGG+ SISN+GM G+ +F 
Sbjct: 300 EGGLFTPVIRDADAKSISALSAEMKDLAKRARDKKLQPQDYQGGSFSISNLGMFGVENFD 359

Query: 356 AVINPPQSTILAIGAGEKK-VVFQNEEIKV----ATIMNATLSADHRSVDGAIASKLLAK 410
           AVINPPQ  ILA+GAG KK +V  + EI      AT+M+ TLS DHR +DGA+ + LL  
Sbjct: 360 AVINPPQGAILAVGAGIKKPIVGDDGEITTETPPATLMSLTLSVDHRVIDGALGAHLLTA 419

Query: 411 FKEYIENPVWML 422
             E +ENP+ ML
Sbjct: 420 IVENLENPLSML 431


>gi|254294048|ref|YP_003060071.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Hirschia baltica ATCC 49814]
 gi|254042579|gb|ACT59374.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Hirschia baltica ATCC 49814]
          Length = 434

 Score =  354 bits (908), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 195/439 (44%), Positives = 276/439 (62%), Gaps = 30/439 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTM EG LAKW+ + GD + PGD++ EIETDKA ME E+VDEG +  ILV  G
Sbjct: 5   ITMPALSPTMEEGTLAKWLVKPGDAVGPGDVIAEIETDKATMEVEAVDEGRVAVILVDEG 64

Query: 66  TENIAVNSPILNILMDSTE-----------IPPS-------PPLSKENIVEVREEHSHSS 107
           +E + VNS ++ +L +  E            PP+        P+ K +  E     S  +
Sbjct: 65  SEGVKVNS-VIAVLAEEGEDAESIKGPAETSPPTSAVASKEAPVEKTSAPEKTPPQSSPA 123

Query: 108 PVVVREKHSKN--RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           P       SKN  R  ASPLA+R+A E GIDLS++SGSGP GRI++SD+E    +     
Sbjct: 124 PTTSSAAPSKNGDRIFASPLAKRIAAEKGIDLSTVSGSGPRGRIIRSDVENAKPSAGKAV 183

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             S +   GL+   I  +   ++A +SYE+ P D + K +A RL +S   IPHF +++D 
Sbjct: 184 -ASAVSPDGLILPQILDD--RVYAPESYELKPLDGMAKVVAKRLTESFMQIPHFPLNVDI 240

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
            +D LLS R+ +N +     E +  KISVND ++KA ALA++  P+ N S+T N    HK
Sbjct: 241 QLDKLLSARKSINDSAP---EGV--KISVNDFLIKASALALMDEPDCNASYTDNGFAYHK 295

Query: 286 HIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
             +ISVAV+I GG++TP+I+ A  K +  IS E+K LA+RA++RKL P+EY GGT SISN
Sbjct: 296 SANISVAVAIDGGLITPVIKDAQSKGLATISAEMKDLAKRARERKLAPQEYMGGTFSISN 355

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIA 404
           +GM GI SF ++INPP+  I+++G+GEK+ VV ++ ++  AT+M  TL+ DHR V GA  
Sbjct: 356 LGMFGIKSFSSIINPPEGMIMSVGSGEKRPVVGKDGQLTTATVMTVTLTCDHRVVGGAEG 415

Query: 405 SKLLAKFKEYIENPVWMLM 423
           +K L  FK Y+E+P  ML+
Sbjct: 416 AKWLQAFKRYVESPESMLL 434


>gi|182678483|ref|YP_001832629.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634366|gb|ACB95140.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 452

 Score =  353 bits (906), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 173/319 (54%), Positives = 228/319 (71%), Gaps = 18/319 (5%)

Query: 119 RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ------- 171
           R  ASPLARRLA E G+DL++++GSGPHGRI++ D++  I+     K             
Sbjct: 138 RVFASPLARRLAKEGGLDLTAVAGSGPHGRIIERDVKAAIAAGPQPKAAPAPAAAPAPVA 197

Query: 172 ------SFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
                 S G+ DE+I       F   SYE +PHD++RKTIA RL ++KQTIPHFY+S+DC
Sbjct: 198 ASARAPSVGMSDETIK----KFFPAGSYEELPHDSMRKTIARRLVEAKQTIPHFYLSVDC 253

Query: 226 NIDNLLSLREQMNRTLQFHRE-EISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
            +D L++LREQ+N +    +E + + K+SVND I+K  ALA+IQVP+ NV+WT  AM+RH
Sbjct: 254 ELDALMALREQVNASAAKDKEGKPAFKVSVNDFIIKGLALALIQVPDTNVTWTEGAMLRH 313

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           KH D+ VAVSIPGG++TPIIR AD KS+  IS E+K  A RAK RKLKPEEYQGGT+++S
Sbjct: 314 KHADVGVAVSIPGGLITPIIRSADTKSLSAISNEMKDYAARAKARKLKPEEYQGGTSAVS 373

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIA 404
           N+GM GI +F AVINPP +TILA+GAGE++VV +N    VAT+M ATLS DHR+VDG + 
Sbjct: 374 NLGMFGIKNFQAVINPPHATILAVGAGEQRVVVKNGAPAVATLMTATLSTDHRAVDGVLG 433

Query: 405 SKLLAKFKEYIENPVWMLM 423
           ++LL  FK  IENP+ ML+
Sbjct: 434 AQLLGAFKSLIENPMGMLV 452


>gi|163844231|ref|YP_001621886.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           suis ATCC 23445]
 gi|254691519|ref|ZP_05154773.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           abortus bv. 6 str. 870]
 gi|254706404|ref|ZP_05168232.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           pinnipedialis M163/99/10]
 gi|254711306|ref|ZP_05173117.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           pinnipedialis B2/94]
 gi|254711907|ref|ZP_05173718.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           ceti M644/93/1]
 gi|254714977|ref|ZP_05176788.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           ceti M13/05/1]
 gi|256014828|ref|YP_003104837.1| acetoin dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase, putative [Brucella microti CCM 4915]
 gi|256030064|ref|ZP_05443678.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           pinnipedialis M292/94/1]
 gi|256059715|ref|ZP_05449910.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           neotomae 5K33]
 gi|256158236|ref|ZP_05456145.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           ceti M490/95/1]
 gi|256252823|ref|ZP_05458359.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           ceti B1/94]
 gi|256256705|ref|ZP_05462241.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           abortus bv. 9 str. C68]
 gi|260757144|ref|ZP_05869492.1| dihydrolipoamide acetyltransferase [Brucella abortus bv. 6 str.
           870]
 gi|260882954|ref|ZP_05894568.1| dihydrolipoamide acetyltransferase [Brucella abortus bv. 9 str.
           C68]
 gi|261216672|ref|ZP_05930953.1| dihydrolipoamide acetyltransferase [Brucella ceti M13/05/1]
 gi|261219905|ref|ZP_05934186.1| dihydrolipoamide acetyltransferase [Brucella ceti B1/94]
 gi|261313854|ref|ZP_05953051.1| dihydrolipoamide acetyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|261318906|ref|ZP_05958103.1| dihydrolipoamide acetyltransferase [Brucella pinnipedialis B2/94]
 gi|261319541|ref|ZP_05958738.1| dihydrolipoamide acetyltransferase [Brucella ceti M644/93/1]
 gi|261323692|ref|ZP_05962889.1| dihydrolipoamide acetyltransferase [Brucella neotomae 5K33]
 gi|265987091|ref|ZP_06099648.1| dihydrolipoamide acetyltransferase [Brucella pinnipedialis
           M292/94/1]
 gi|265996752|ref|ZP_06109309.1| dihydrolipoamide acetyltransferase [Brucella ceti M490/95/1]
 gi|297250065|ref|ZP_06933766.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus bv. 5 str. B3196]
 gi|163674954|gb|ABY39064.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella suis ATCC 23445]
 gi|255997488|gb|ACU49175.1| acetoin dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase, putative [Brucella microti CCM 4915]
 gi|260677252|gb|EEX64073.1| dihydrolipoamide acetyltransferase [Brucella abortus bv. 6 str.
           870]
 gi|260872482|gb|EEX79551.1| dihydrolipoamide acetyltransferase [Brucella abortus bv. 9 str.
           C68]
 gi|260918489|gb|EEX85142.1| dihydrolipoamide acetyltransferase [Brucella ceti B1/94]
 gi|260921761|gb|EEX88329.1| dihydrolipoamide acetyltransferase [Brucella ceti M13/05/1]
 gi|261292231|gb|EEX95727.1| dihydrolipoamide acetyltransferase [Brucella ceti M644/93/1]
 gi|261298129|gb|EEY01626.1| dihydrolipoamide acetyltransferase [Brucella pinnipedialis B2/94]
 gi|261299672|gb|EEY03169.1| dihydrolipoamide acetyltransferase [Brucella neotomae 5K33]
 gi|261302880|gb|EEY06377.1| dihydrolipoamide acetyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|262551049|gb|EEZ07210.1| dihydrolipoamide acetyltransferase [Brucella ceti M490/95/1]
 gi|264659288|gb|EEZ29549.1| dihydrolipoamide acetyltransferase [Brucella pinnipedialis
           M292/94/1]
 gi|297173934|gb|EFH33298.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus bv. 5 str. B3196]
          Length = 421

 Score =  353 bits (906), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 188/426 (44%), Positives = 271/426 (63%), Gaps = 17/426 (3%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LS  M +  +A+W+K EGD +S GD++ E+ETDKA ME E+  +G I ++LV  G
Sbjct: 5   VVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKATMELEAEVDGRIGQLLVKDG 64

Query: 66  TENIAVNSPILNIL--------MDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK 117
                VN  I  +L        M    +  SP    E    V      ++P V      +
Sbjct: 65  A-RANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAETPVAASPVPAAPAVSAPASGE 123

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
            R  ASPLARRLA E G+ L  L+GSG  GRIV+ D+E   ++K      +        +
Sbjct: 124 VRHKASPLARRLAAELGVSLDGLAGSGARGRIVRIDVERAAASKPVPVAAAAAPVAAPAE 183

Query: 178 ESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
            S  A  + +     YE +PH ++R+TIA RL ++K T+PHFY+++DC ID LL+LR Q+
Sbjct: 184 ASSKAIPVGI---GEYEAVPHTSMRRTIARRLLEAKTTVPHFYLNVDCEIDALLALRSQI 240

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
           N      + E S +ISVND ++KA A A+ +VP+ANV WT  A+++ K +DI+VAV+  G
Sbjct: 241 N-----EKREGSARISVNDFVIKASAAALRRVPDANVIWTDEALLKLKDVDIAVAVATEG 295

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G++TPIIR ADQ S+  IS ++K LA RA++ +LKPEE+QGG  SISN+GM G+ SF A+
Sbjct: 296 GLITPIIRSADQMSLGAISAQMKSLAARARENRLKPEEFQGGGFSISNLGMYGVKSFSAI 355

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           INPPQS ILA+GAGE++ + +N E+  AT+M+ TLS DHR+VDGA+ ++LLA FK  IE+
Sbjct: 356 INPPQSAILAVGAGERRPIERNGELAFATMMSVTLSVDHRAVDGALGAQLLAAFKAGIED 415

Query: 418 PVWMLM 423
           P+ +L+
Sbjct: 416 PMSLLV 421


>gi|126735934|ref|ZP_01751678.1| Dihydrolipoamide acetyltransferase, long form [Roseobacter sp.
           CCS2]
 gi|126714491|gb|EBA11358.1| Dihydrolipoamide acetyltransferase, long form [Roseobacter sp.
           CCS2]
          Length = 441

 Score =  353 bits (906), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 191/446 (42%), Positives = 272/446 (60%), Gaps = 31/446 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW  +EGD +S GDI+ EIETDKA MEFE+VDEG++ +I+
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWHVKEGDTVSSGDIMAEIETDKATMEFEAVDEGVMGKIV 60

Query: 62  VPAGTENIAVNSPILNILMD-----------------STEIPPSPPLSK---ENIVEVRE 101
           V  GTE + VN  I  +L D                 S+   P+    K   E      E
Sbjct: 61  VAEGTEGVKVNDVIAVLLEDGESADDIGDVSAKSDDASSNAAPAKASDKTAPEQGYGRGE 120

Query: 102 EHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTK 161
             +  +P   +    K R  A+PLARR+A + G+DL+ + GSGPHGRI+K+D+E     +
Sbjct: 121 TDATPAPASSKGADGK-RIFATPLARRIAADKGLDLADIEGSGPHGRIIKADVENAKPGE 179

Query: 162 ----TNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIP 217
                + K  +          S DA ++  +A   +E +  D +RKTIA RL ++KQ++P
Sbjct: 180 KPATASAKPEAAATPAMAAGPSTDA-VMKTYADRPFEEVQLDGMRKTIAARLTEAKQSVP 238

Query: 218 HFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWT 277
           HFY+  D  +D LL  R Q+N+ L+        K+SVND I+KA ALA+ Q PEAN  W 
Sbjct: 239 HFYLRRDIQLDALLKFRSQLNKQLETR----GVKLSVNDFIIKACALALQQEPEANAVWA 294

Query: 278 TNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQ 337
            +  ++ +  D++VAV+I GG+ TP+++ A+ KS+  +S E+K LA RA+ RKL P EY 
Sbjct: 295 GDRTLKFEKSDVAVAVAIEGGLFTPVLKDAEMKSLSALSAEMKDLATRARDRKLAPHEYV 354

Query: 338 GGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADH 396
           GG+ +ISN+GM GI++F A+INPP + ILA+GAG KK +V  + E+ V T+M+ TLS DH
Sbjct: 355 GGSFAISNLGMFGIDNFDAIINPPHAAILAVGAGTKKPIVGADGELTVGTVMSTTLSVDH 414

Query: 397 RSVDGAIASKLLAKFKEYIENPVWML 422
           R +DGA+ + LL   K+ +ENP+ ML
Sbjct: 415 RVIDGALGANLLNAIKDNLENPMTML 440


>gi|254720711|ref|ZP_05182522.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           sp. 83/13]
 gi|265985763|ref|ZP_06098498.1| dihydrolipoamide acetyltransferase [Brucella sp. 83/13]
 gi|306839336|ref|ZP_07472152.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella sp. NF 2653]
 gi|264664355|gb|EEZ34616.1| dihydrolipoamide acetyltransferase [Brucella sp. 83/13]
 gi|306405584|gb|EFM61847.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella sp. NF 2653]
          Length = 421

 Score =  353 bits (905), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 187/437 (42%), Positives = 271/437 (62%), Gaps = 39/437 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LS  M +  +A+W+K EGD +S GD++ E+ETDKA ME E+  +G I ++LV  G
Sbjct: 5   VVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKATMELEAEVDGRIGQLLVKDG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKN------- 118
                VN  I  +L +            E+   +      SSPV V E  +         
Sbjct: 65  A-RANVNQVIALLLKEG-----------EDASAIAGFAVGSSPVAVAEAETPVAASPVPA 112

Query: 119 ------------RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKD 166
                       R  ASPLARRLA E G+ L  L+GSG  GRIV+ D+E   ++K     
Sbjct: 113 APAVSAPASGEVRHKASPLARRLAAELGVSLEGLAGSGARGRIVRIDVERAAASKPVPVA 172

Query: 167 YSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
            +        + S  A  + +     YE +PH ++R+TIA RL ++K T+PHFY+++DC 
Sbjct: 173 AAAAPVAAPAEASSKAIPVGI---GEYEAVPHTSMRRTIARRLLEAKTTVPHFYLNVDCE 229

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           ID LL+LR Q+N      + E S +ISVND ++KA A A+ +VP+ANV WT  A+++ K 
Sbjct: 230 IDALLALRSQIN-----EKREGSARISVNDFVIKASAAALRRVPDANVIWTDEALLKLKD 284

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
           +DI+VAV+  GG++TPIIR ADQ S+  IS ++K LA RA++ +LKPEE+QGG  SISN+
Sbjct: 285 VDIAVAVATEGGLITPIIRSADQMSLGAISAQMKSLAARARENRLKPEEFQGGGFSISNL 344

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASK 406
           GM G+ SF A+INPPQS ILA+GAGE++ + +N E+  AT+M+ TLS DHR+VDGA+ ++
Sbjct: 345 GMYGVKSFSAIINPPQSAILAVGAGERRPIERNGELAFATMMSVTLSVDHRAVDGALGAQ 404

Query: 407 LLAKFKEYIENPVWMLM 423
           LLA FK  +E+P+ +L+
Sbjct: 405 LLAAFKAGVEDPMSLLV 421


>gi|225628516|ref|ZP_03786550.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella ceti str. Cudo]
 gi|260166885|ref|ZP_05753696.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           sp. F5/99]
 gi|261756266|ref|ZP_05999975.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella sp. F5/99]
 gi|225616362|gb|EEH13410.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella ceti str. Cudo]
 gi|261736250|gb|EEY24246.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella sp. F5/99]
          Length = 421

 Score =  353 bits (905), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 188/426 (44%), Positives = 270/426 (63%), Gaps = 17/426 (3%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LS  M +  +A+W K EGD +S GD++ E+ETDKA ME E+  +G I ++LV  G
Sbjct: 5   VVLPALSAGMEDAVIARWFKAEGDAVSKGDLIAEVETDKATMELEAEVDGRIGQLLVKDG 64

Query: 66  TENIAVNSPILNIL--------MDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK 117
                VN  I  +L        M    +  SP    E    V      ++P V      +
Sbjct: 65  A-RANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAETPVAASPVPAAPAVSAPASGE 123

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
            R  ASPLARRLA E G+ L  L+GSG  GRIV+ D+E   ++K      +        +
Sbjct: 124 VRHKASPLARRLAAELGVSLDGLAGSGARGRIVRIDVERAAASKPVPVAAAAAPVAAPAE 183

Query: 178 ESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
            S  A  + +     YE +PH ++R+TIA RL ++K T+PHFY+++DC ID LL+LR Q+
Sbjct: 184 ASSKAIPVGI---GEYEAVPHTSMRRTIARRLLEAKTTVPHFYLNVDCEIDALLALRSQI 240

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
           N      + E S +ISVND ++KA A A+ +VP+ANV WT  A+++ K +DI+VAV+  G
Sbjct: 241 N-----EKREGSARISVNDFVIKASAAALRRVPDANVIWTDEALLKLKDVDIAVAVATEG 295

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G++TPIIR ADQ S+  IS ++K LA RA++ +LKPEE+QGG  SISN+GM G+ SF A+
Sbjct: 296 GLITPIIRSADQMSLGAISAQMKSLAARARENRLKPEEFQGGGFSISNLGMYGVKSFSAI 355

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           INPPQS ILA+GAGE++ + +N E+  AT+M+ TLS DHR+VDGA+ ++LLA FK  IE+
Sbjct: 356 INPPQSAILAVGAGERRPIERNGELAFATMMSVTLSVDHRAVDGALGAQLLAAFKAGIED 415

Query: 418 PVWMLM 423
           P+ +L+
Sbjct: 416 PMSLLV 421


>gi|254474944|ref|ZP_05088330.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Ruegeria sp. R11]
 gi|214029187|gb|EEB70022.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Ruegeria sp. R11]
          Length = 442

 Score =  352 bits (903), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 189/441 (42%), Positives = 273/441 (61%), Gaps = 28/441 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD ++ GD+L EIETDKA MEFE+VDEG+I +IL+  G
Sbjct: 5   ILMPALSPTMEEGTLAKWLVKEGDTVASGDLLAEIETDKATMEFEAVDEGVIGKILIAEG 64

Query: 66  TENIAVNSPILNILMDS--------------TEIPPSPPLSKENIVEVREEHSHSSPVVV 111
           +E + VNSPI  +L D                    +P  SK+      +  + ++P   
Sbjct: 65  SEGVKVNSPIAILLEDGESADDIGATPAAPAAAEDTAPAASKDASPAPAQAAAAATPAPA 124

Query: 112 REKH-SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
                  +R  ASPLARR+A + G+DL+ +SGSGP GRIVK+D+E   +           
Sbjct: 125 APAGADGSRIFASPLARRIAADKGLDLADISGSGPRGRIVKADVENATAAPKAAAAAPAA 184

Query: 171 QSFGLVDESIDA--------NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVS 222
            +      +  A         +  ++    YE +  D +RKTIA RL ++KQTIPHFY+ 
Sbjct: 185 AAPAAAAPAAAAAASGPTADQVARMYEGRDYEEVALDGMRKTIAARLSEAKQTIPHFYLR 244

Query: 223 IDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMI 282
            D  +D LL  R ++N+ L+        K+SVND I+KA ALA+  VP+AN  W  + ++
Sbjct: 245 RDIQLDALLKFRAELNKQLEGR----GVKLSVNDFIIKAVALALQAVPDANAVWAGDRVL 300

Query: 283 RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTS 342
           + K  D++VAV+I GG+ TP+++ +D KS+  +S E+K LA+RA+ RKL P EYQGG+ +
Sbjct: 301 KMKSSDVAVAVAIEGGLFTPVLQDSDMKSLSTLSAEMKDLAKRARDRKLAPHEYQGGSFA 360

Query: 343 ISNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDG 401
           ISN+GM GI++F A++NPP + ILA+G+G KK VV  + E+KVAT+M+ T+S DHR +DG
Sbjct: 361 ISNLGMFGIDNFDAIVNPPHAGILAVGSGVKKPVVGADGELKVATVMSVTMSVDHRVIDG 420

Query: 402 AIASKLLAKFKEYIENPVWML 422
           A+ + LL    E +ENP+ ML
Sbjct: 421 ALGADLLKAIVENLENPMTML 441


>gi|119386597|ref|YP_917652.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Paracoccus
           denitrificans PD1222]
 gi|119377192|gb|ABL71956.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Paracoccus denitrificans PD1222]
          Length = 434

 Score =  352 bits (903), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 189/433 (43%), Positives = 267/433 (61%), Gaps = 20/433 (4%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD++  GDIL EIETDKA MEFE+VDEG + +IL+  G
Sbjct: 5   ILMPALSPTMEEGTLAKWLVKEGDEVKSGDILAEIETDKATMEFEAVDEGKLGKILIAEG 64

Query: 66  TENIAVNSPILNIL-----MDSTEIPPSP-PLSKENIVEVREEHSHSSPVVVREKHSK-- 117
           T  + VN+PI  +L      D     P+P P +K      + E + +         +   
Sbjct: 65  TAGVKVNTPIAVLLEEGESADDIGAAPAPKPEAKAEADAPKAEAAAAPAAAAAPAPAAPK 124

Query: 118 ----NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSF 173
                R  ASPLARR+A E GIDL+S++GSGPHGRIVK+D+E            +   + 
Sbjct: 125 SADGGRIFASPLARRIAAEKGIDLASVAGSGPHGRIVKADVEGAKPGAAKPAAEAPKAAP 184

Query: 174 GLVDESIDA----NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
                +        IL ++A    E +  D +R+TIA RL ++KQTIPHFY+     +D 
Sbjct: 185 APAAAAPAGPSAETILKMYADRETEEVALDGMRRTIAARLSEAKQTIPHFYLRRSAKLDE 244

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDI 289
           L+  R  +N+ L    E    K+SVND I+KA ALA+ +VP+AN  W  + +++ K  D+
Sbjct: 245 LMKFRAMLNKQL----ESRGVKLSVNDFIIKACALALQEVPDANAVWAGDRILKLKPSDV 300

Query: 290 SVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGML 349
           +VAV+I GG+ TP+++ A QK++  +S E+K LA RAK +KL P EYQGG+ +ISN+GM 
Sbjct: 301 AVAVAIEGGLFTPVLKDAQQKTLSALSAEMKDLANRAKTKKLAPHEYQGGSFAISNLGMF 360

Query: 350 GINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLA 409
           GI +F AVINPP   ILA+GAG +  V +N E+ V  +M+ TLS DHR +DGA+ ++LL 
Sbjct: 361 GIENFDAVINPPHGAILAVGAGIQTPVVENGEVVVRNVMSMTLSVDHRVIDGALGAQLLE 420

Query: 410 KFKEYIENPVWML 422
              +++ENP+ ML
Sbjct: 421 AIVKHLENPMGML 433


>gi|23499800|ref|NP_699240.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           suis 1330]
 gi|23463366|gb|AAN33245.1| acetoin dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase, putative [Brucella suis 1330]
          Length = 421

 Score =  352 bits (903), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 188/426 (44%), Positives = 271/426 (63%), Gaps = 17/426 (3%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LS  M +  +A+W+K EGD +S GD++ E+ETDKA ME E+  +G I ++LV  G
Sbjct: 5   VVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKATMELEAEVDGRIGQLLVKDG 64

Query: 66  TENIAVNSPILNIL--------MDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK 117
                VN  I  +L        M    +  SP    E    V      ++P V      +
Sbjct: 65  A-RANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAETPVAASPVPAAPAVSAPASGE 123

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
            R  ASPLARRLA E G+ L  L+GSG  GRIV+ D+E   ++K      +        +
Sbjct: 124 VRHKASPLARRLAAELGVSLDGLAGSGARGRIVRIDVERAAASKPVPVAAAAAPVAAPAE 183

Query: 178 ESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
            S  A  + +     YE +PH ++R+TIA RL ++K T+PHFY+++DC ID LL+LR Q+
Sbjct: 184 ASSKAIPVGI---GEYEAVPHTSMRRTIARRLLEAKITVPHFYLNVDCEIDALLALRSQI 240

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
           N      + E S +ISVND ++KA A A+ +VP+ANV WT  A+++ K +DI+VAV+  G
Sbjct: 241 N-----EKREGSARISVNDFVIKASAAALRRVPDANVIWTDEALLKLKDVDIAVAVATEG 295

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G++TPIIR ADQ S+  IS ++K LA RA++ +LKPEE+QGG  SISN+GM G+ SF A+
Sbjct: 296 GLITPIIRSADQMSLGAISAQMKSLAARARENRLKPEEFQGGGFSISNLGMYGVKSFSAI 355

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           INPPQS ILA+GAGE++ + +N E+  AT+M+ TLS DHR+VDGA+ ++LLA FK  IE+
Sbjct: 356 INPPQSAILAVGAGERRPIERNGELAFATMMSVTLSVDHRAVDGALGAQLLAAFKAGIED 415

Query: 418 PVWMLM 423
           P+ +L+
Sbjct: 416 PMSLLV 421


>gi|294853063|ref|ZP_06793735.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella sp. NVSL 07-0026]
 gi|294818718|gb|EFG35718.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella sp. NVSL 07-0026]
          Length = 421

 Score =  352 bits (903), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 188/426 (44%), Positives = 270/426 (63%), Gaps = 17/426 (3%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LS  M +  +A+W+K EGD +S GD++ E+ETDKA ME E+  +G I ++LV  G
Sbjct: 5   VVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKATMELEAEVDGRIGQLLVKDG 64

Query: 66  TENIAVNSPILNIL--------MDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK 117
                VN  I  +L        M    +  SP    E    V      ++P V      +
Sbjct: 65  A-RANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAETPVAASPVPAAPAVSAPASGE 123

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
            R  ASPLARRLA E G+ L  L+GSG  GRIV+ D+E   ++K      +        +
Sbjct: 124 VRHKASPLARRLAAELGVSLDGLAGSGARGRIVRIDVERAAASKPVPVAAAAAPVAAPAE 183

Query: 178 ESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
            S  A  + +     YE +PH ++R+TIA RL ++K T+PHFY+++DC ID LL+LR Q+
Sbjct: 184 ASSKAIPVGI---GEYEAVPHTSMRRTIARRLLEAKTTVPHFYLNVDCEIDALLALRSQI 240

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
           N      + E S +ISVND ++KA A A+ +VP+ANV WT  A+++ K +DI+VAV+  G
Sbjct: 241 N-----EKREGSARISVNDFVIKASAAALRRVPDANVIWTDEALLKLKDVDIAVAVATEG 295

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G++TPIIR ADQ S+  IS ++K LA RA++ +LKPEE+QGG  SISN+GM G+ SF A+
Sbjct: 296 GLITPIIRSADQMSLGAISAQMKSLAARARENRLKPEEFQGGGFSISNLGMYGVKSFSAI 355

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           INPPQS ILA+GAGE++ + +N E+  AT+M+ TLS DHR+VDGA+  +LLA FK  IE+
Sbjct: 356 INPPQSAILAVGAGERRPIERNGELAFATMMSVTLSVDHRAVDGALGVQLLAAFKAGIED 415

Query: 418 PVWMLM 423
           P+ +L+
Sbjct: 416 PMSLLV 421


>gi|56697105|ref|YP_167468.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Ruegeria
           pomeroyi DSS-3]
 gi|56678842|gb|AAV95508.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Ruegeria pomeroyi DSS-3]
          Length = 437

 Score =  352 bits (902), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 187/437 (42%), Positives = 267/437 (61%), Gaps = 25/437 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+VDEGI+ +ILVP G
Sbjct: 5   ILMPALSPTMEEGTLAKWLVKEGDSVSSGDLLAEIETDKATMEFEAVDEGIVGKILVPEG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKN------- 118
           TE + VN+PI  +L+D  E       +           + +S     +  ++        
Sbjct: 65  TEGVKVNTPI-AVLLDEGESAGDIASASSGATAPSSAPAAASAEKAPQGAAEAPAAAPAA 123

Query: 119 -------RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDI-----ETLISTKTNVKD 166
                  R  ASPLARR+A + G+DLS ++GSGPHGRIVK+D+                 
Sbjct: 124 PKAADGARVFASPLARRIAADKGLDLSQIAGSGPHGRIVKADVIGATAPAAAPASAAPAP 183

Query: 167 YSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
            +               +  ++    YE +  D +RKTIA RL ++KQTIPHFY+  D  
Sbjct: 184 AAAAAPAAAPSGPGADMVARMYEGREYEEVKLDGMRKTIAARLSEAKQTIPHFYLRRDIK 243

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           +D L+  R Q+N+ L+        K+SVND I+KA A A+ QVP+ N  W  + +++ K 
Sbjct: 244 LDALMKFRAQLNKQLEGR----GVKLSVNDFIIKAVANALQQVPDCNAVWAGDRVLKLKP 299

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
            D++VAV+I GG+ TP+++ AD KS+  +S E+K LA RA+ RKL P EYQGG+ +ISN+
Sbjct: 300 SDVAVAVAIEGGLFTPVLKDADMKSLSALSTEMKDLATRARDRKLAPHEYQGGSFAISNL 359

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIAS 405
           GM GI++F A++NPP + ILA+G+G KK VV  + E+ VAT+M+ T+S DHR +DGA+ +
Sbjct: 360 GMFGIDNFDAIVNPPHAGILAVGSGVKKPVVGADGELTVATVMSVTMSVDHRVIDGALGA 419

Query: 406 KLLAKFKEYIENPVWML 422
           +LL    + +ENP+ ML
Sbjct: 420 QLLQAIVDNLENPMVML 436


>gi|260576745|ref|ZP_05844730.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodobacter sp. SW2]
 gi|259020997|gb|EEW24308.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodobacter sp. SW2]
          Length = 425

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 191/429 (44%), Positives = 267/429 (62%), Gaps = 13/429 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LA+W+ + GD +  G IL EIETDKA MEFE+ D+G++ E+L
Sbjct: 1   MATQILMPALSPTMEEGTLARWLVKVGDAVKSGQILAEIETDKATMEFEAADDGVVGELL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHS---HSSPVVVREKHSKN 118
           V  G   + VN+PI  +L +   +  S  ++      V  + +   +  P  V  K +  
Sbjct: 61  VAEGAAGVKVNTPIAVLLEEGEALSESSSVAAAPSSPVAAQSAAPANDKPAPVVAKPAGA 120

Query: 119 RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE----TLISTKTNVKDYSTIQSFG 174
           R  ASPLARR+A + G+DLS++ GSGPHGRIVKSD+E        T         + +  
Sbjct: 121 RVFASPLARRIAADKGLDLSAVQGSGPHGRIVKSDVEGAKPVAAQTPAAAAPAPAMAAPM 180

Query: 175 LVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLR 234
               S DA +   +A  +Y  +P D +R+TIA RL ++KQTIPHFY+  +  +D LL+ R
Sbjct: 181 PTGASADA-VKKQYADRAYTEVPLDGMRRTIAARLTEAKQTIPHFYLRREVRLDALLAFR 239

Query: 235 EQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVS 294
           E +N  L       + KISVND I+KA ALA+  VP+AN  W  + ++R    D++VAV+
Sbjct: 240 EALNAQLAPR----NIKISVNDFIIKACALALQAVPDANAVWAGDRILRLTPSDVAVAVA 295

Query: 295 IPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSF 354
           + GG+ TP++R A  KS+  +S E+K LA RAK RKL P EY GG+ +ISN+GM+GI+SF
Sbjct: 296 VEGGLFTPVLRDAHLKSLTALSAEMKDLAARAKTRKLAPVEYIGGSFAISNLGMMGIDSF 355

Query: 355 CAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKE 413
            AVINPP   ILA+GAG KK VV ++  +K AT+M  TLS DHR +DGA+ ++LL     
Sbjct: 356 DAVINPPHGAILAVGAGVKKPVVAEDGSLKAATLMTLTLSVDHRVIDGALGAELLKAIVG 415

Query: 414 YIENPVWML 422
           ++E P+ ML
Sbjct: 416 HLEAPLAML 424


>gi|221638898|ref|YP_002525160.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Rhodobacter sphaeroides KD131]
 gi|221159679|gb|ACM00659.1| Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodobacter sphaeroides KD131]
          Length = 442

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 193/445 (43%), Positives = 275/445 (61%), Gaps = 28/445 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+K+EGD++  GDI+ EIETDKA MEFE+VDEGI+ +IL
Sbjct: 1   MATEILMPALSPTMEEGTLAKWLKKEGDEVRSGDIIAEIETDKATMEFEAVDEGILGKIL 60

Query: 62  VPAGTENIAVNSPILNIL--------MDSTEIP-PSPPLSKENIVEVREEHSHSSPVVVR 112
           +  GT  + VN+PI  ++        + S ++P P  P  +    +   + + +      
Sbjct: 61  IAEGTAGVKVNTPIAVLVEEGESVDAVSSAKVPEPQEPADEAAPAQGAPKAAPAPAAKAP 120

Query: 113 E----KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE----------TLI 158
           E    +    R  ASPLARR+A E GIDL+++ GSGP GRIVK+D+E             
Sbjct: 121 EAQAARSEGGRVFASPLARRIAKEKGIDLAAVQGSGPRGRIVKADVEGAQPVAAPAAKAD 180

Query: 159 STKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPH 218
           +     +  +   +      +  A++  LFA   YE +  D +RKTIA RL ++KQTIPH
Sbjct: 181 AAAPKAEAPAAAAAPVAAPAASAASVAKLFADRDYEEVTLDGMRKTIAARLSEAKQTIPH 240

Query: 219 FYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTT 278
           FY+  +  +D L++ R  +N  L    E    K+SVND I+KA A+A+ QVP AN  W  
Sbjct: 241 FYLRREVALDALMAFRADLNAKL----ESRGVKLSVNDFIIKACAVALQQVPNANAVWAG 296

Query: 279 NAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQG 338
           + ++R K  D++VAV+I GG+ TP++R A QKS+  +S E+K LA RA+ +KL P EYQG
Sbjct: 297 DRILRLKPSDVAVAVAIEGGLFTPVLRDAHQKSLSALSAEMKDLAARARTKKLAPHEYQG 356

Query: 339 GTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHR 397
           G+ +ISN+GM G+ +F AVINPP  +ILA+GAG +K VV ++  I  AT+M+ TLS DHR
Sbjct: 357 GSFAISNLGMFGVENFDAVINPPHGSILAVGAGIRKPVVGKDGAITTATMMSMTLSVDHR 416

Query: 398 SVDGAIASKLLAKFKEYIENPVWML 422
            +DGA+ ++ L    E +ENP+ ML
Sbjct: 417 VIDGALGAEFLKAIVENLENPIAML 441


>gi|126461915|ref|YP_001043029.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Rhodobacter sphaeroides ATCC 17029]
 gi|126103579|gb|ABN76257.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 442

 Score =  351 bits (900), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 193/445 (43%), Positives = 274/445 (61%), Gaps = 28/445 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+K+EGD++  GDI+ EIETDKA MEFE+VDEGI+ +IL
Sbjct: 1   MATEILMPALSPTMEEGTLAKWLKKEGDEVRSGDIIAEIETDKATMEFEAVDEGILGKIL 60

Query: 62  VPAGTENIAVNSPILNIL--------MDSTEIP-PSPPLSKENIVEVREEHSHSSPVVVR 112
           +  GT  + VN+PI  ++        + S ++P P  P  +    +   + + +      
Sbjct: 61  IAEGTAGVKVNTPIAVLVEEGESVDAVSSAKVPEPQEPADEAAPAQEAPKAAPAPAAKAP 120

Query: 113 E----KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE----------TLI 158
           E    +    R  ASPLARR+A E GIDL+++ GSGP GRIVK+D+E             
Sbjct: 121 EAQAARSEGERVFASPLARRIAKEKGIDLAAVQGSGPRGRIVKADVEGARPSAAPAAKAD 180

Query: 159 STKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPH 218
                 +  +   +      +  A++  LFA   YE +  D +RKTIA RL ++KQTIPH
Sbjct: 181 VAAPKAEAPAAAAAPVAAPAASAASVAKLFADRDYEEVTLDGMRKTIAARLSEAKQTIPH 240

Query: 219 FYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTT 278
           FY+  +  +D L++ R  +N  L    E    K+SVND I+KA A+A+ QVP AN  W  
Sbjct: 241 FYLRREVALDALMAFRADLNAKL----ESRGVKLSVNDFIIKACAVALQQVPNANAVWAG 296

Query: 279 NAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQG 338
           + ++R K  D++VAV+I GG+ TP++R A QKS+  +S E+K LA RA+ +KL P EYQG
Sbjct: 297 DRILRLKPSDVAVAVAIEGGLFTPVLRDAHQKSLSALSAEMKDLAARARTKKLAPHEYQG 356

Query: 339 GTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHR 397
           G+ +ISN+GM G+ +F AVINPP  +ILA+GAG +K VV ++  I  AT+M+ TLS DHR
Sbjct: 357 GSFAISNLGMFGVENFDAVINPPHGSILAVGAGIRKPVVGKDGAITTATMMSMTLSVDHR 416

Query: 398 SVDGAIASKLLAKFKEYIENPVWML 422
            +DGA+ ++ L    E +ENP+ ML
Sbjct: 417 VIDGALGAEFLKAIVENLENPIAML 441


>gi|62316993|ref|YP_222846.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           abortus bv. 1 str. 9-941]
 gi|83268987|ref|YP_418278.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           melitensis biovar Abortus 2308]
 gi|189022265|ref|YP_001932006.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           abortus S19]
 gi|237816556|ref|ZP_04595548.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus str. 2308 A]
 gi|254698284|ref|ZP_05160112.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|260544233|ref|ZP_05820054.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus NCTC 8038]
 gi|260762730|ref|ZP_05875062.1| dihydrolipoamide acetyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|62197186|gb|AAX75485.1| hypothetical acetoin dehydrogenase complex, E2 component,
           dihydrolipoamide acetyltransferase [Brucella abortus bv.
           1 str. 9-941]
 gi|82939261|emb|CAJ12198.1| Biotin/lipoyl attachment:Catalytic domain of components of various
           dehydrogenase complexes:2-oxo acid dehydrogenase,
           acyltran [Brucella melitensis biovar Abortus 2308]
 gi|189020839|gb|ACD73560.1| hypothetical acetoin dehydrogenase complex, E2 component,
           dihydrolipoamide acetyltransferase [Brucella abortus
           S19]
 gi|237787369|gb|EEP61585.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus str. 2308 A]
 gi|260097504|gb|EEW81378.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella abortus NCTC 8038]
 gi|260673151|gb|EEX59972.1| dihydrolipoamide acetyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 421

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 187/426 (43%), Positives = 270/426 (63%), Gaps = 17/426 (3%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LS  M +  +A+W+K EGD +S GD++ E+ETDKA ME E+  +G I ++LV  G
Sbjct: 5   VVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKATMELEAEVDGRIGQLLVKDG 64

Query: 66  TENIAVNSPILNIL--------MDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK 117
                VN  I  +L        M    +  SP    E    V      ++P V      +
Sbjct: 65  A-RANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAETPVAASPVPAAPAVSAPASGE 123

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
            R  ASPLARRLA E G+ L   +GSG  GRIV+ D+E   ++K      +        +
Sbjct: 124 VRHKASPLARRLAAELGVSLDGRAGSGARGRIVRIDVERAAASKPVPVAAAAAPVAAPAE 183

Query: 178 ESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
            S  A  + +     YE +PH ++R+TIA RL ++K T+PHFY+++DC ID LL+LR Q+
Sbjct: 184 ASSKAIPVGI---GEYEAVPHTSMRRTIARRLLEAKTTVPHFYLNVDCEIDALLALRSQI 240

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
           N      + E S +ISVND ++KA A A+ +VP+ANV WT  A+++ K +DI+VAV+  G
Sbjct: 241 N-----EKREGSARISVNDFVIKASAAALRRVPDANVIWTDEALLKLKDVDIAVAVATEG 295

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G++TPIIR ADQ S+  IS ++K LA RA++ +LKPEE+QGG  SISN+GM G+ SF A+
Sbjct: 296 GLITPIIRSADQMSLGAISAQMKSLAARARENRLKPEEFQGGGFSISNLGMYGVKSFSAI 355

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           INPPQS ILA+GAGE++ + +N E+  AT+M+ TLS DHR+VDGA+ ++LLA FK  IE+
Sbjct: 356 INPPQSAILAVGAGERRPIERNGELAFATMMSVTLSVDHRAVDGALGAQLLAAFKAGIED 415

Query: 418 PVWMLM 423
           P+ +L+
Sbjct: 416 PMSLLV 421


>gi|259418599|ref|ZP_05742516.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Silicibacter sp. TrichCH4B]
 gi|259344821|gb|EEW56675.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Silicibacter sp. TrichCH4B]
          Length = 441

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 185/440 (42%), Positives = 269/440 (61%), Gaps = 27/440 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD +S GD++ EIETDKA MEFE+VDEG++ +IL+  G
Sbjct: 5   ILMPALSPTMEEGTLAKWLVKEGDTVSSGDLIAEIETDKATMEFEAVDEGVVGKILIAEG 64

Query: 66  TENIAVNSPILNILMD---STEIPPSPPLSKENIVEVREEHSHS---------------- 106
           +E + VN+PI  +L D   + +I  S    +        + + S                
Sbjct: 65  SEGVKVNTPIAVLLEDGESADDIDTSAATPEAAPAADAAQEAASEGGSDAAAAPAAASAT 124

Query: 107 SPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST---KTN 163
                      +R  ASPLARR+A + G+DLS++ GSGP GRI+K D+E   +    +T 
Sbjct: 125 PAPAAPAAADGSRIFASPLARRIAADKGLDLSAIKGSGPRGRIIKVDVENATAAPKAETK 184

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
               +   +           +  ++    YE +  D +RKTIA RL ++KQTIPHFY+  
Sbjct: 185 AAPAAAPAAAVAPAGPSADAVAKMYEGRDYEEVKLDGMRKTIAARLTEAKQTIPHFYLRR 244

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           D  +D LL  R Q+N+ L    E    K+SVND I+KA ALA+  VP+AN  W  + +++
Sbjct: 245 DIQLDALLKFRSQLNKQL----EPRGVKLSVNDFIIKAVALALQSVPDANAVWAGDRVLK 300

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
            K  D++VAV+I GG+ TP+++ +D KS+  +S E+K LA RA+ RKL P EYQGG+ +I
Sbjct: 301 MKASDVAVAVAIEGGLFTPVLQDSDMKSLSALSAEMKDLASRARDRKLAPHEYQGGSFAI 360

Query: 344 SNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGA 402
           SN+GM GI++F A++NPP + ILA+G+G KK VV  + E+ VAT+M+ T+S DHR +DGA
Sbjct: 361 SNLGMFGIDNFDAIVNPPHAGILAVGSGVKKPVVGADGELTVATVMSVTMSVDHRVIDGA 420

Query: 403 IASKLLAKFKEYIENPVWML 422
           + + LL    + +ENP+ ML
Sbjct: 421 LGADLLKAIVDNLENPMVML 440


>gi|254731726|ref|ZP_05190304.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           abortus bv. 4 str. 292]
 gi|260759486|ref|ZP_05871834.1| dihydrolipoamide acetyltransferase [Brucella abortus bv. 4 str.
           292]
 gi|260669804|gb|EEX56744.1| dihydrolipoamide acetyltransferase [Brucella abortus bv. 4 str.
           292]
          Length = 421

 Score =  350 bits (897), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 186/426 (43%), Positives = 270/426 (63%), Gaps = 17/426 (3%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LS  M +  +A+W+K EGD +S GD++ E+ETDKA ME E+  +G I ++LV  G
Sbjct: 5   VVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKATMELEAEVDGRIGQLLVKDG 64

Query: 66  TENIAVNSPILNIL--------MDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK 117
                VN  I  +L        M    +  SP    E    V      ++P V      +
Sbjct: 65  A-RANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAETPVAASPVPAAPAVSAPASGE 123

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
            R  ASPLARRLA E G+ L   +GSG  GRIV+ D+E   ++K      +        +
Sbjct: 124 VRHKASPLARRLAAELGVSLDGRAGSGARGRIVRIDVERAAASKPVPVAAAAAPVAAPAE 183

Query: 178 ESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
            S  A  + +     YE +PH ++R+TIA RL ++K T+PHFY+++DC ID LL+LR Q+
Sbjct: 184 ASSKAIPVGI---GEYEAVPHTSMRRTIARRLLEAKTTVPHFYLNVDCEIDALLALRSQI 240

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
           N      + E S +IS+ND ++KA A A+ +VP+ANV WT  A+++ K +DI+VAV+  G
Sbjct: 241 N-----EKREGSARISINDFVIKASAAALRRVPDANVIWTDEALLKLKDVDIAVAVATEG 295

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G++TPIIR ADQ S+  IS ++K LA RA++ +LKPEE+QGG  SISN+GM G+ SF A+
Sbjct: 296 GLITPIIRSADQMSLGAISAQMKSLAARARENRLKPEEFQGGGFSISNLGMYGVKSFSAI 355

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           INPPQS ILA+GAGE++ + +N E+  AT+M+ TLS DHR+VDGA+ ++LLA FK  IE+
Sbjct: 356 INPPQSAILAVGAGERRPIERNGELAFATMMSVTLSVDHRAVDGALGAQLLAAFKAGIED 415

Query: 418 PVWMLM 423
           P+ +L+
Sbjct: 416 PMSLLV 421


>gi|89054179|ref|YP_509630.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Jannaschia
           sp. CCS1]
 gi|88863728|gb|ABD54605.1| Dihydrolipoamide acetyltransferase long form [Jannaschia sp. CCS1]
          Length = 441

 Score =  350 bits (897), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 195/440 (44%), Positives = 275/440 (62%), Gaps = 27/440 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM EG LAKW+ +EGD ++ GD+L EIETDKA MEFE+VDEGII +ILVP G
Sbjct: 5   LLMPALSPTMEEGTLAKWLVKEGDTVNSGDLLAEIETDKATMEFEAVDEGIIGKILVPEG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENI-----------VEVREEHSHSSPVVVREK 114
           TEN+ VN+ I  I  +  +   +P    E+            V   E    ++       
Sbjct: 65  TENVKVNTAIALIGEEGDDFSAAPAAPAEDAAAEEASPEAEEVTPSEAAPAAASSAPAAP 124

Query: 115 HSKN--RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST--------KTNV 164
            +K+  R  ASPLARR+A + G+DLS + GSGPHGRIVK D+E   +         K+  
Sbjct: 125 VTKDGGRIFASPLARRIAKDKGLDLSQIKGSGPHGRIVKVDVEGASAAPKSEAPTAKSEA 184

Query: 165 KDYSTIQSFGLVDESIDA-NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
              +     G +     A  +L ++    +E +  + +RKT+A RL ++KQTIPHFY+  
Sbjct: 185 PKAAAPAGGGAMPTGPSAEQVLKMYEGREFEEVKLNGMRKTVAARLTEAKQTIPHFYLRR 244

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           D  +D LL  R Q+N+ L+        K+SVND ++KA ALA+  VP+AN  W  + MI+
Sbjct: 245 DIQLDALLKFRSQLNKQLEGR----GVKLSVNDFVIKACALALQAVPDANAVWAGDRMIK 300

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
            K  D++VAV++ GG+ TP+++ +D KS+  +S E+K LA RA+  KL P EY GG+ +I
Sbjct: 301 LKPSDVAVAVAVDGGLFTPVLKDSDSKSLSALSAEMKDLATRARDGKLAPHEYVGGSFAI 360

Query: 344 SNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGA 402
           SN+GM+GI +F AVINPP   ILA+GAG KK VV  + E+ VAT+M+ TLS DHR +DGA
Sbjct: 361 SNLGMMGIENFDAVINPPHGAILAVGAGVKKPVVGADGELAVATVMSTTLSVDHRVIDGA 420

Query: 403 IASKLLAKFKEYIENPVWML 422
           + ++LLA  K+ +ENP+ ML
Sbjct: 421 LGAELLAAIKDNLENPMVML 440


>gi|56551406|ref|YP_162245.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Zymomonas mobilis subsp. mobilis ZM4]
 gi|59802985|sp|O66119|ODP2_ZYMMO RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component of pyruvate dehydrogenase complex; AltName:
           Full=Dihydrolipoamide acetyltransferase component of
           pyruvate dehydrogenase complex; AltName: Full=E2
 gi|56542980|gb|AAV89134.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 440

 Score =  350 bits (897), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 191/449 (42%), Positives = 273/449 (60%), Gaps = 47/449 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTMTEG LAKW+ +EGD +  GDIL EIETDKAIMEFE+VD GII +ILVP G
Sbjct: 5   VKMPALSPTMTEGTLAKWLVKEGDAVKAGDILAEIETDKAIMEFETVDAGIIAKILVPEG 64

Query: 66  TENIAVNSPI---------LNILMDSTEIPPSPPLSKENIVEVREEHSHSSPV------- 109
           +ENIAV   I         ++ +  S     S P  K ++ +     S +  +       
Sbjct: 65  SENIAVGQVIAVMAEAGEDVSQVAASASSQISEPSEKADVAQKETADSETISIDASLDKA 124

Query: 110 -------------VVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIET 156
                            +    R  ASPLA+RLA ++ +DL  ++GSGPHGRI+K+DIE 
Sbjct: 125 ISNAGYGNKTENMTASYQEKAGRIKASPLAKRLAKKNHVDLKQVNGSGPHGRIIKADIEA 184

Query: 157 LISTKTNVK---DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSK 213
            I+           ST ++ G +      N + L            N+R+ IA RL +SK
Sbjct: 185 FIAEANQASSNPSVSTPEASGKITHDTPHNSIKL-----------SNMRRVIARRLTESK 233

Query: 214 QTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEAN 273
           Q IPH Y+++D  +D LL LR ++N +L       + KISVND+++KA ALA+   P  N
Sbjct: 234 QNIPHIYLTVDVQMDALLKLRSELNESLAVQ----NIKISVNDMLIKAQALALKATPNVN 289

Query: 274 VSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKP 333
           V++  + M++    DISVAVS+ GG++TPI++QAD KS+  +S+E+K+L  RA++ +L+P
Sbjct: 290 VAFDGDQMLQFSQADISVAVSVEGGLITPILKQADTKSLSALSVEMKELIARAREGRLQP 349

Query: 334 EEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLS 393
           +EYQGGT+SISNMGM GI  F AVINPPQ++ILAIG+GE++    ++ I +AT+   T S
Sbjct: 350 QEYQGGTSSISNMGMFGIKQFNAVINPPQASILAIGSGERRPWVIDDAITIATVATITGS 409

Query: 394 ADHRSVDGAIASKLLAKFKEYIENPVWML 422
            DHR +DGA A+  ++ FK  +E P+ +L
Sbjct: 410 FDHRVIDGADAAAFMSAFKHLVEKPLGIL 438


>gi|83954325|ref|ZP_00963045.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Sulfitobacter sp.
           NAS-14.1]
 gi|83841362|gb|EAP80532.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Sulfitobacter sp.
           NAS-14.1]
          Length = 434

 Score =  350 bits (897), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 188/438 (42%), Positives = 272/438 (62%), Gaps = 35/438 (7%)

Query: 15  MTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSP 74
           M EG LAKW+  EGD +S GDILCEIETDKA MEFE+VDEG I +IL+  G+E + VN+P
Sbjct: 1   MEEGTLAKWLVSEGDSVSSGDILCEIETDKATMEFEAVDEGTIGKILIGDGSEGVKVNTP 60

Query: 75  ILNIL--------MDSTEIPPSPPLSKENIVEV---------REEH-----SHSSPVVVR 112
           I  +L        +DS   P +   +KE+  +          R E        S+P   +
Sbjct: 61  IAVLLEEGEEASDIDSAPAPAAKDSAKEDAPDQDAAPEKGYGRGESDANDTGKSAPAAPK 120

Query: 113 EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQS 172
               K R   +PLARR+A + G+DL+ LSGSGPHGRI+K+D+E   +     K   + Q+
Sbjct: 121 GSDGK-RLFVTPLARRIAADKGVDLTELSGSGPHGRIIKADVEAASAGGAKAKPAESTQT 179

Query: 173 FGLVDESIDAN-------ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
                             ++ ++   ++E I  + +RKTIA RL ++KQ+IPHFY+  D 
Sbjct: 180 ASAPAAMAAPAAGPSADAVMKIYEGRAFEEISLNGMRKTIAARLTEAKQSIPHFYLRRDI 239

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
            +D LL  R ++N+ L+        K+SVND I+KA ALA+  V +AN  W  + +++ K
Sbjct: 240 ELDALLKFRGELNKQLEAR----DVKLSVNDFIIKACALALQTVSDANAVWAGDRILKLK 295

Query: 286 HIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
             D++VAV+I GG+ TP+++ A+ KS+  +S E+K LA RA+ RKL P EYQGG+ +ISN
Sbjct: 296 PSDVAVAVAIEGGLFTPVLKDAEMKSLSTLSAEMKDLATRARDRKLAPHEYQGGSFAISN 355

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIA 404
           +GM GI++F AVINPP   ILA+GAG KK +V ++ E+ VAT+M+ TLS DHR +DGA+ 
Sbjct: 356 LGMFGIDNFDAVINPPHGAILAVGAGVKKPIVGKDGELAVATVMSVTLSVDHRVIDGALG 415

Query: 405 SKLLAKFKEYIENPVWML 422
           ++LL+  K+ +ENP+ ML
Sbjct: 416 AQLLSAIKDNLENPMMML 433


>gi|103486722|ref|YP_616283.1| dihydrolipoamide acetyltransferase, long form [Sphingopyxis
           alaskensis RB2256]
 gi|98976799|gb|ABF52950.1| Dihydrolipoamide acetyltransferase, long form [Sphingopyxis
           alaskensis RB2256]
          Length = 436

 Score =  350 bits (897), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 196/436 (44%), Positives = 271/436 (62%), Gaps = 24/436 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM EG LAKW+ +EGD++  GD+L EIETDKA MEFE+VDEG+I +ILV  G
Sbjct: 5   LKMPALSPTMEEGTLAKWLVKEGDEVKSGDLLAEIETDKATMEFEAVDEGVISQILVAEG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH-----------SHSSPVVVREK 114
           T+ + V + I  I  +  +   +          V  +            S   P V+   
Sbjct: 65  TDGVKVGTVIAVIAGEGEDAGEAKATPAAAPAPVPAKDVAPAEAGAATVSAPPPAVLASA 124

Query: 115 HSKN---RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
            + N   R  ASPLARRLA E GIDL  L+G+GP GRIVK+D+E   +        +  Q
Sbjct: 125 GTTNVGDRIKASPLARRLAAEQGIDLKKLTGTGPGGRIVKADLEGAPTGAAASTAVAPAQ 184

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDN-----IRKTIACRLQQSKQTIPHFYVSIDCN 226
           +   V  +  A          +  IPH++     +RKTIA RL QS Q  PH Y+++D  
Sbjct: 185 AGAAVGTAPAAAPEPAGPIPDFG-IPHEDEKLSGMRKTIARRLSQSMQDAPHIYLTVDIR 243

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           +D LL LR ++N +L    E    K+SVND+++KA A+A+ +VP+ NVS+  + M  +K 
Sbjct: 244 LDALLKLRGELNASL----ESRGVKLSVNDMLIKALAVALERVPQCNVSFGGDVMRFYKR 299

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
            DISVAVSIPGG++TPII  A  KS+  IS E+ +LA RAK+ KL+P EYQGGT SISNM
Sbjct: 300 ADISVAVSIPGGLITPIITDAGAKSLSKISTEMAELAGRAKEGKLQPHEYQGGTASISNM 359

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASK 406
           GM+GI  F AVINPPQ+ I+AIGAGEK+    ++ + +AT+M+AT S DHR++DGA  + 
Sbjct: 360 GMMGIKQFTAVINPPQAMIMAIGAGEKRPYVVDDALAIATVMSATGSFDHRAIDGADGAL 419

Query: 407 LLAKFKEYIENPVWML 422
           L+  FKE +E+P+ ++
Sbjct: 420 LMKTFKELVESPLGLV 435


>gi|254699352|ref|ZP_05161180.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           suis bv. 5 str. 513]
 gi|261749798|ref|ZP_05993507.1| dihydrolipoamide acetyltransferase [Brucella suis bv. 5 str. 513]
 gi|261739551|gb|EEY27477.1| dihydrolipoamide acetyltransferase [Brucella suis bv. 5 str. 513]
          Length = 421

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 187/426 (43%), Positives = 270/426 (63%), Gaps = 17/426 (3%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LS  M +  +A+W+K EGD +S GD++ E+ETDKA ME E+  +G I ++LV  G
Sbjct: 5   VVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKATMELEAEVDGRIGQLLVKDG 64

Query: 66  TENIAVNSPILNIL--------MDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK 117
                VN  I  +L        M    +  SP    E    V      ++P V      +
Sbjct: 65  A-RANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAETPVAASPVPAAPAVSAPASGE 123

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
            R  ASPLARRLA E G+ L  L+GSG  GRIV+ D+E   ++K      +        +
Sbjct: 124 VRHKASPLARRLAAELGVSLDGLAGSGARGRIVRIDVERAAASKPVPVAAAAAPVAAPAE 183

Query: 178 ESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
            S  A  + +     YE +PH ++R+TIA  L ++K T+PHFY+++DC ID LL+LR Q+
Sbjct: 184 ASSKAIPVGI---GEYEAVPHTSMRRTIARLLLEAKTTVPHFYLNVDCEIDALLALRSQI 240

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
           N      + E S +ISVND ++KA A A+ +VP+ANV WT  A+++ K +DI+VAV+  G
Sbjct: 241 N-----EKREGSARISVNDFVIKASAAALRRVPDANVIWTDEALLKLKDVDIAVAVATEG 295

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G++TPIIR ADQ S+  IS ++K LA RA++ +LKPEE+QGG  SISN+GM G+ SF A+
Sbjct: 296 GLITPIIRSADQMSLGAISAQMKSLAARARENRLKPEEFQGGGFSISNLGMYGVKSFSAI 355

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           INPPQS ILA+GAGE++ + +N E+  AT+M+ TLS DHR+VDGA+ ++LLA FK  IE+
Sbjct: 356 INPPQSAILAVGAGERRPIERNGELAFATMMSVTLSVDHRAVDGALGAQLLAAFKAGIED 415

Query: 418 PVWMLM 423
           P+ +L+
Sbjct: 416 PMSLLV 421


>gi|2995391|emb|CAA63808.1| dihydrolipoamide S-acetyltransferase [Zymomonas mobilis subsp.
           mobilis ATCC 29191]
          Length = 440

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 191/449 (42%), Positives = 272/449 (60%), Gaps = 47/449 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTMTEG LAKW+ +EGD +  GDIL EIETDKAIMEFE+VD GII +ILVP G
Sbjct: 5   VKMPALSPTMTEGTLAKWLVKEGDAVKAGDILAEIETDKAIMEFETVDAGIIAKILVPEG 64

Query: 66  TENIAVNSPI---------LNILMDSTEIPPSPPLSKENIVEVREEHSHSSPV------- 109
           +ENIAV   I         ++ +  S     S P  K ++ +     S +  +       
Sbjct: 65  SENIAVGQVIAVMAEAGEDVSQVAASASSQISEPSEKADVAQKETADSETISIDASLDKA 124

Query: 110 -------------VVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIET 156
                            +    R  ASPLA+RLA ++ +DL  +SGSGPHGRI+K+DIE 
Sbjct: 125 ISNAGYGNKTENMTASYQEKAGRIKASPLAKRLAKKNHVDLKQVSGSGPHGRIIKADIEA 184

Query: 157 LISTKTNVK---DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSK 213
            ++           ST +  G +      N + L            N+R+ IA RL +SK
Sbjct: 185 FVTGANQASSNPSVSTPEVSGKITHDTPHNSIKL-----------SNMRRVIARRLTESK 233

Query: 214 QTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEAN 273
           Q IPH Y+++D  +D LL LR ++N +L       + KISVND+++KA ALA+   P  N
Sbjct: 234 QNIPHIYLTVDVQMDALLKLRSELNESLAVQ----NIKISVNDMLIKAQALALKATPNVN 289

Query: 274 VSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKP 333
           V++  + M++    DISVAVS+ GG++TPI++QAD KS+  +S+E+K+L  RA++ +L+P
Sbjct: 290 VAFDGDQMLQFSQADISVAVSVEGGLITPILKQADTKSLSALSVEMKELIARAREGRLQP 349

Query: 334 EEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLS 393
           +EYQGGT+SISNMGM GI  F AVINPPQ++ILAIG+GE++    ++ I +AT+   T S
Sbjct: 350 QEYQGGTSSISNMGMFGIKQFNAVINPPQASILAIGSGERRPWVIDDAITIATVATITGS 409

Query: 394 ADHRSVDGAIASKLLAKFKEYIENPVWML 422
            DHR +DGA A+  ++ FK  +E P+ +L
Sbjct: 410 FDHRVIDGADAAAFMSAFKHLVEKPLGIL 438


>gi|17988404|ref|NP_541037.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           melitensis bv. 1 str. 16M]
 gi|225685900|ref|YP_002733872.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           melitensis ATCC 23457]
 gi|256042962|ref|ZP_05445908.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|256112063|ref|ZP_05452999.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           melitensis bv. 3 str. Ether]
 gi|256261883|ref|ZP_05464415.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella melitensis bv. 2 str. 63/9]
 gi|260564196|ref|ZP_05834681.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella melitensis bv. 1 str. 16M]
 gi|265989394|ref|ZP_06101951.1| dihydrolipoamide acetyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993506|ref|ZP_06106063.1| dihydrolipoamide acetyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|17984185|gb|AAL53301.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex [Brucella melitensis bv. 1 str.
           16M]
 gi|225642005|gb|ACO01918.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella melitensis ATCC 23457]
 gi|260151839|gb|EEW86932.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella melitensis bv. 1 str. 16M]
 gi|262764376|gb|EEZ10408.1| dihydrolipoamide acetyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263000063|gb|EEZ12753.1| dihydrolipoamide acetyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263091364|gb|EEZ15900.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella melitensis bv. 2 str. 63/9]
 gi|326410221|gb|ADZ67285.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           melitensis M28]
 gi|326553514|gb|ADZ88153.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           melitensis M5-90]
          Length = 421

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 187/426 (43%), Positives = 270/426 (63%), Gaps = 17/426 (3%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LS  M +  +A+W+K EGD +S GD++ E+ETDKA ME E+  +G I ++LV  G
Sbjct: 5   VVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKATMELEAEVDGRIGQLLVKDG 64

Query: 66  TENIAVNSPILNIL--------MDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK 117
                VN  I  +L        M    +  SP    E    V      ++P V      +
Sbjct: 65  A-RANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAETPVAASPVPAAPAVSAPASGE 123

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
            R  ASPLARRLA E G+ L  L+GSG  GRIV+ D+E   ++K      +        +
Sbjct: 124 VRHKASPLARRLAAELGVSLDGLAGSGARGRIVRIDVERAAASKPVPVAAAAAPVAAPAE 183

Query: 178 ESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
            S  A  + +     YE +PH ++R+TIA RL ++K T+PHFY+++DC ID LL+LR Q+
Sbjct: 184 VSSKAIPVGI---GEYEAVPHTSMRRTIARRLLEAKTTVPHFYLNVDCEIDALLALRSQI 240

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
           N      + E S +ISVND ++KA A A+ +VP+ANV WT  A+++ K +DI+VAV+  G
Sbjct: 241 N-----EKREGSARISVNDFVIKASAAALRRVPDANVIWTDEALLKLKDVDIAVAVATEG 295

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G++TPIIR ADQ S+  IS ++K LA RA++ +LKPEE+QGG  SISN+ M G+ SF A+
Sbjct: 296 GLITPIIRSADQMSLGAISAQMKSLAARARENRLKPEEFQGGGFSISNLSMYGVKSFSAI 355

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           INPPQS ILA+GAGE++ + +N E+  AT+M+ TLS DHR+VDGA+ ++LLA FK  IE+
Sbjct: 356 INPPQSAILAVGAGERRPIERNGELAFATMMSVTLSVDHRAVDGALGAQLLAAFKAGIED 415

Query: 418 PVWMLM 423
           P+ +L+
Sbjct: 416 PMSLLV 421


>gi|241761051|ref|ZP_04759140.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260752983|ref|YP_003225876.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|241374670|gb|EER64131.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258552346|gb|ACV75292.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 440

 Score =  349 bits (895), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 190/449 (42%), Positives = 273/449 (60%), Gaps = 47/449 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTMTEG LAKW+ +EGD +  GDIL EIETDKAIMEFE+VD GII +ILVP G
Sbjct: 5   VKMPALSPTMTEGTLAKWLVKEGDAVKAGDILAEIETDKAIMEFETVDAGIIAKILVPEG 64

Query: 66  TENIAVNSPI---------LNILMDSTEIPPSPPLSKENIVEVREEHSHSSPV------- 109
           +ENIAV   I         ++ +  S     S P  K ++ +     S +  +       
Sbjct: 65  SENIAVGQVIAVMAEAGEDVSQVAASASSQISEPSEKADVAQKETADSETISIDASLDKA 124

Query: 110 -------------VVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIET 156
                            +    R  ASPLA+RLA ++ +DL  ++GSGPHGRI+K+DIE 
Sbjct: 125 ISNAGYGNKTENMTASYQEKAGRIKASPLAKRLAKKNHVDLKQVNGSGPHGRIIKADIEA 184

Query: 157 LISTKTNVK---DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSK 213
            ++           ST ++ G +      N + L            N+R+ IA RL +SK
Sbjct: 185 FVAEANQASSNPSVSTPEASGKITHDTPHNSIKL-----------SNMRRVIARRLTESK 233

Query: 214 QTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEAN 273
           Q IPH Y+++D  +D LL LR ++N +L       + KISVND+++KA ALA+   P  N
Sbjct: 234 QNIPHIYLTVDVQMDALLKLRSELNESLAVQ----NIKISVNDMLIKAQALALKATPNVN 289

Query: 274 VSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKP 333
           V++  + M++    DISVAVS+ GG++TPI++QAD KS+  +S+E+K+L  RA++ +L+P
Sbjct: 290 VAFDGDQMLQFSQADISVAVSVEGGLITPILKQADTKSLSALSVEMKELIARAREGRLQP 349

Query: 334 EEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLS 393
           +EYQGGT+SISNMGM GI  F AVINPPQ++ILAIG+GE++    ++ I +AT+   T S
Sbjct: 350 QEYQGGTSSISNMGMFGIKQFNAVINPPQASILAIGSGERRPWVIDDAITIATVATITGS 409

Query: 394 ADHRSVDGAIASKLLAKFKEYIENPVWML 422
            DHR +DGA A+  ++ FK  +E P+ +L
Sbjct: 410 FDHRVIDGADAAAFMSAFKHLVEKPLGIL 438


>gi|315499904|ref|YP_004088707.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Asticcacaulis excentricus CB 48]
 gi|315417916|gb|ADU14556.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Asticcacaulis excentricus CB 48]
          Length = 423

 Score =  349 bits (895), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 190/424 (44%), Positives = 269/424 (63%), Gaps = 12/424 (2%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW  + GD +S GD++ EIETDKA ME E+VDEG+++ IL+ AG
Sbjct: 4   ILMPALSPTMEEGILAKWHVKVGDTVSAGDVIAEIETDKATMEVEAVDEGVVEAILIEAG 63

Query: 66  TENIAVNSPILNILMDS-----TEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           TE + VN+PI  +  +           +P  ++            ++PV         R 
Sbjct: 64  TEGVKVNTPIARLAGEGGSAAPAPKAEAPKAAEAPKPAAAPAPVVAAPVAAPAVSGGARV 123

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
            ASPLARRLA  + +DL  L G+GPHGRI+K DIE  +++ T  K  S   +     E  
Sbjct: 124 AASPLARRLAEINKLDLKLLKGTGPHGRIIKRDIEAALASGTG-KAGSAPAATTAAAEPR 182

Query: 181 DANILNLF--AKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMN 238
               L     A  SY+++P +N+RK IA RL +S + IPHF +++D  +DNLL+ R ++N
Sbjct: 183 KVQSLEQMGIAPGSYDLVPLNNMRKVIARRLTESFRDIPHFPLTVDIELDNLLAARTKIN 242

Query: 239 RTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGG 298
             L    E    K+SVNDI++KA ALA+ QVPEAN S+T   +  H + DI++AV+I GG
Sbjct: 243 TAL----ESQGIKVSVNDIVIKAVALALKQVPEANASFTPEGIAMHHNADIAMAVAIDGG 298

Query: 299 IVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVI 358
           ++TPIIR+A+ KS+  I+ E K LA RA+  KLKPEE+QGGT S+SN+GM GI  F ++I
Sbjct: 299 LITPIIRKAETKSLAQIAKETKDLAARARDMKLKPEEFQGGTFSVSNLGMFGIKQFASII 358

Query: 359 NPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENP 418
           N PQ  IL++GAGE++ V +N ++ VAT+M  TL+ DHR VDG++ +K +   K  +E+P
Sbjct: 359 NEPQGCILSVGAGEQRPVVKNGQLAVATVMTVTLTCDHRVVDGSVGAKYITALKGLLEDP 418

Query: 419 VWML 422
           + ML
Sbjct: 419 IKML 422


>gi|254695184|ref|ZP_05157012.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           abortus bv. 3 str. Tulya]
 gi|261215542|ref|ZP_05929823.1| dihydrolipoamide acetyltransferase [Brucella abortus bv. 3 str.
           Tulya]
 gi|260917149|gb|EEX84010.1| dihydrolipoamide acetyltransferase [Brucella abortus bv. 3 str.
           Tulya]
          Length = 421

 Score =  348 bits (894), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 187/426 (43%), Positives = 270/426 (63%), Gaps = 17/426 (3%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LS  M +  +A+W+K EGD +S GD++ E+ETDKA ME E+  +G I ++LV  G
Sbjct: 5   VVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKATMELEAEVDGRIGQLLVKDG 64

Query: 66  TENIAVNSPILNIL--------MDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK 117
                VN  I  +L        M    +  SP    E    V      ++P V      +
Sbjct: 65  A-RANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAETPVAASPVPAAPAVSAPASGE 123

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
            R  ASPLARRLA E G+ L  L+GSG  GRIV+ D+E   ++K      +        +
Sbjct: 124 VRHKASPLARRLAAELGVSLDGLAGSGARGRIVRIDVERAAASKPVPVAAAAAPVAAPAE 183

Query: 178 ESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
            S  A  + +     YE +PH ++R+TIA RL ++K T+PHFY+++D  ID LL+LR Q+
Sbjct: 184 ASSKAIPVGI---GEYEAVPHTSMRRTIARRLLEAKTTVPHFYLNVDFEIDALLALRSQI 240

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
           N      + E S +ISVND ++KA A A+ +VP+ANV WT  A+++ K +DI+VAV+  G
Sbjct: 241 N-----EKREGSARISVNDFVIKASAAALRRVPDANVIWTDEALLKLKDVDIAVAVATEG 295

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G++TPIIR ADQ S+  IS ++K LA RA++ +LKPEE+QGG  SISN+GM G+ SF A+
Sbjct: 296 GLITPIIRSADQMSLGAISAQMKSLAARARENRLKPEEFQGGGFSISNLGMYGVKSFSAI 355

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           INPPQS ILA+GAGE++ + +N E+  AT+M+ TLS DHR+VDGA+ ++LLA FK  IE+
Sbjct: 356 INPPQSAILAVGAGERRPIERNGELAFATMMSVTLSVDHRAVDGALGAQLLAAFKAGIED 415

Query: 418 PVWMLM 423
           P+ +L+
Sbjct: 416 PMSLLV 421


>gi|99036080|ref|ZP_01315114.1| hypothetical protein Wendoof_01000033 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 463

 Score =  348 bits (893), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 191/473 (40%), Positives = 285/473 (60%), Gaps = 84/473 (17%)

Query: 6   ITMPSLSPTMTE--GKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
           I MP+LSPTM++  GK+ KW K+E DK+  GD++ EIETDKAIMEFES+DEG++ +ILV 
Sbjct: 14  ILMPALSPTMSKAGGKIVKWHKKEQDKVEVGDVIAEIETDKAIMEFESIDEGVLAKILVT 73

Query: 64  AGTENIAVNSPILNILMD-----------STEIPPS--PPLSKENIVEVREEH------- 103
            GT  + VN PI  +L +           ST I  +    ++K  +   + EH       
Sbjct: 74  EGTSGVPVNQPIALMLEEGEDESALNNYTSTSINSAVKKEVTKSAVDNQKSEHQDLNGKP 133

Query: 104 -SHSSPVVVR--------------------------------EKHSKNRPIASPLARRLA 130
            SHSS    R                                E +++ R   SPLA+++A
Sbjct: 134 ISHSSVSFQRVTLESNPSMSSQCLTLGSRKEEWIPVSATQMTEGYAEGRTKISPLAKKIA 193

Query: 131 GEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAK 190
              G+++  L G+GP+GRI+K+D+   + +             G+  ES +        K
Sbjct: 194 QNEGVNVQQLKGTGPYGRIIKADVLEFLGS-------------GIHTESPE--------K 232

Query: 191 DSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISN 250
           D+  ++   N+R+ IA RL +SKQ +PHFY+++DC +D L+SL+ ++N   +      +N
Sbjct: 233 DT--IVEVSNMRQVIAQRLTESKQNVPHFYLTVDCQVDKLISLKNEINSADE------NN 284

Query: 251 KISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQK 310
           K+++ND+I+KA A +M + P+ N SW  N ++R+ +IDIS+AV++  G++TPI++ AD+K
Sbjct: 285 KVTINDLIIKAAAFSMKKFPDINSSWIDNKILRYSNIDISIAVALEDGLITPIVKNADKK 344

Query: 311 SILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGA 370
            IL IS EVK L  RA+  KLKPEE+QGG  +ISN+GM GI +F A+INPPQS I+A+GA
Sbjct: 345 GILSISKEVKDLVSRARSGKLKPEEFQGGGFTISNLGMFGIKAFSAIINPPQSCIMAVGA 404

Query: 371 GEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            +K+ +  NE+I++A IM  TLS DHR+VDGA+ +K L  FK YIENP+ ML+
Sbjct: 405 SKKQPIVMNEKIEIAEIMTVTLSVDHRAVDGALGAKFLNAFKHYIENPLVMLI 457


>gi|58696818|ref|ZP_00372345.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Wolbachia endosymbiont of Drosophila simulans]
 gi|225630846|ref|YP_002727637.1| pyruvate dehydrogenase complex, E2 component [Wolbachia sp. wRi]
 gi|58536976|gb|EAL60133.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Wolbachia endosymbiont of Drosophila simulans]
 gi|225592827|gb|ACN95846.1| pyruvate dehydrogenase complex, E2 component [Wolbachia sp. wRi]
          Length = 454

 Score =  348 bits (893), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 192/473 (40%), Positives = 284/473 (60%), Gaps = 84/473 (17%)

Query: 6   ITMPSLSPTM--TEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
           I MP+LSPTM  T GK+ KW K+E DK+  GD++ EIETDKAIMEFES+DEG++ +ILV 
Sbjct: 5   ILMPALSPTMSKTGGKIVKWHKKEQDKVEVGDVIAEIETDKAIMEFESIDEGVLAKILVT 64

Query: 64  AGTENIAVNSPILNILMD-----------STEIPPS--PPLSKENIVEVREEH------- 103
            GT  + VN PI  +L +           ST I  +    ++K  +   + EH       
Sbjct: 65  EGTSGVPVNQPIALMLEEGEDESALNNYTSTSINSAVKKEVTKSAVDNQKSEHQDLNGKP 124

Query: 104 -SHSSPVVVR--------------------------------EKHSKNRPIASPLARRLA 130
            SHSS    R                                E +++ R   SPLA+++A
Sbjct: 125 ISHSSVSFQRVTLESNPSMSSQCLTLGSRKEEWIPVSATQMTEGYAEGRTKISPLAKKIA 184

Query: 131 GEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAK 190
              G+++  L G+GP+GRI+K+D+   + +             G+  ES +        K
Sbjct: 185 QNEGVNVQQLKGTGPYGRIIKADVLEFLGS-------------GIHTESPE--------K 223

Query: 191 DSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISN 250
           D+  ++   N+R+ IA RL +SKQ +PHFY+++DC +D L+SL+ ++N   +      +N
Sbjct: 224 DT--IVEVSNMRQVIAQRLTESKQNVPHFYLTVDCQVDKLISLKNEINSADE------NN 275

Query: 251 KISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQK 310
           K+++ND+I+KA A +M + P+ N SW  N ++R+ +IDIS+AV++  G++TPI++ AD+K
Sbjct: 276 KVTINDLIIKAAAFSMKKFPDINSSWIDNKILRYSNIDISIAVALEDGLITPIVKNADKK 335

Query: 311 SILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGA 370
            IL IS EVK L  RA+  KLKPEE+QGG  +ISN+GM GI +F A+INPPQS I+A+GA
Sbjct: 336 GILSISKEVKDLVSRARSGKLKPEEFQGGGFTISNLGMFGIKAFSAIINPPQSCIMAVGA 395

Query: 371 GEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            +K+ +  NE+I++A IM  TLS DHR+VDGA+ +K L  FK YIENP+ ML+
Sbjct: 396 SKKQPIVMNEKIEIAEIMTVTLSVDHRAVDGALGAKFLNAFKHYIENPLVMLI 448


>gi|161620123|ref|YP_001594009.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           canis ATCC 23365]
 gi|254702472|ref|ZP_05164300.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella
           suis bv. 3 str. 686]
 gi|260568622|ref|ZP_05839091.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella suis bv. 4 str. 40]
 gi|261753041|ref|ZP_05996750.1| dihydrolipoamide acetyltransferase [Brucella suis bv. 3 str. 686]
 gi|161336934|gb|ABX63238.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella canis ATCC 23365]
 gi|260155287|gb|EEW90368.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brucella suis bv. 4 str. 40]
 gi|261742794|gb|EEY30720.1| dihydrolipoamide acetyltransferase [Brucella suis bv. 3 str. 686]
          Length = 421

 Score =  348 bits (893), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 187/426 (43%), Positives = 270/426 (63%), Gaps = 17/426 (3%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LS  M +  +A+W+K EGD +S GD++ E+ETDKA ME E+  +G I ++LV  G
Sbjct: 5   VVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKATMELEAEVDGRIGQLLVKDG 64

Query: 66  TENIAVNSPILNIL--------MDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK 117
                VN  I  +L        M    +  SP    E    V      ++P V      +
Sbjct: 65  A-RANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAETPVAASPVPAAPAVSAPASGE 123

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
            R  ASPLARRLA E G+ L  L+GSG  GRIV+ D+E   ++K      +        +
Sbjct: 124 VRHKASPLARRLAAELGVSLDGLAGSGARGRIVRIDVERAAASKPVPVAAAAAPVAAPAE 183

Query: 178 ESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
            S  A  + +     YE +PH ++R+TIA  L ++K T+PHFY+++DC ID LL+LR Q+
Sbjct: 184 ASSKAIPVGI---GEYEAVPHTSMRRTIARCLLEAKITVPHFYLNVDCEIDALLALRSQI 240

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
           N      + E S +ISVND ++KA A A+ +VP+ANV WT  A+++ K +DI+VAV+  G
Sbjct: 241 N-----EKREGSARISVNDFVIKASAAALRRVPDANVIWTDEALLKLKDVDIAVAVATEG 295

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G++TPIIR ADQ S+  IS ++K LA RA++ +LKPEE+QGG  SISN+GM G+ SF A+
Sbjct: 296 GLITPIIRSADQMSLGAISAQMKSLAARARENRLKPEEFQGGGFSISNLGMYGVKSFSAI 355

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           INPPQS ILA+GAGE++ + +N E+  AT+M+ TLS DHR+VDGA+ ++LLA FK  IE+
Sbjct: 356 INPPQSAILAVGAGERRPIERNGELAFATMMSVTLSVDHRAVDGALGAQLLAAFKAGIED 415

Query: 418 PVWMLM 423
           P+ +L+
Sbjct: 416 PMSLLV 421


>gi|190571193|ref|YP_001975551.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018594|ref|ZP_03334402.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357465|emb|CAQ54899.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995545|gb|EEB56185.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 420

 Score =  348 bits (892), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 185/442 (41%), Positives = 277/442 (62%), Gaps = 55/442 (12%)

Query: 6   ITMPSLSPTM--TEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
           I MP+LSPTM  T GK+ KW K+E DK+  GD++ EIETDKAIMEFESVDEG++ +ILV 
Sbjct: 5   ILMPALSPTMSKTGGKIVKWCKKEQDKVEIGDVIAEIETDKAIMEFESVDEGVLAKILVS 64

Query: 64  AGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVV------------ 111
            GT  + VN  ++ ++++  E   +  L+     +V +E      V              
Sbjct: 65  EGTSGVPVNQ-LIALMLEEGEDKSALDLASAINTKVEKEVEADFSVSSNPSISSSSLMSS 123

Query: 112 ---------REKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDI-ETLISTK 161
                     ++ ++NR   SPLA+++A   G+D+  L G+GP+GRI+K+D+ E L  TK
Sbjct: 124 QCVTLGSKKEDRATENRIKVSPLAKKIAQNEGVDIKRLKGTGPYGRIIKADVLEFLDQTK 183

Query: 162 TNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYV 221
           +    Y   +    V+ S                    N+R+ IA RL +SKQ IPHFY+
Sbjct: 184 S----YERFEENTTVEVS--------------------NMRQVIAQRLVESKQNIPHFYL 219

Query: 222 SIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAM 281
           ++DC++D L+SL+ ++N   +      +NK+++ND+I+KA A +M + P+ N SW    +
Sbjct: 220 TVDCHVDKLISLKNEVNSANE------NNKVTINDLIIKAVAFSMKKFPDINSSWIDTKI 273

Query: 282 IRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTT 341
           +R+ +IDIS+AV++  G++TPI++ AD+KS+L IS EVK L  RA+  KL+PEE+QGG  
Sbjct: 274 VRYSNIDISIAVALEDGLITPIVKNADEKSVLSISKEVKDLVNRARSGKLRPEEFQGGGF 333

Query: 342 SISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDG 401
           +ISN+GM GI +F A+INPPQS I+A+GA +K+ V  +E+I++A +M  TLS DHR+VDG
Sbjct: 334 TISNLGMFGIKTFSAIINPPQSCIMAVGASKKQPVVISEKIEIAEVMTVTLSVDHRAVDG 393

Query: 402 AIASKLLAKFKEYIENPVWMLM 423
           A+ +K L  FK YIENP  ML+
Sbjct: 394 ALGAKFLNAFKYYIENPTVMLL 415


>gi|42520975|ref|NP_966890.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|42410716|gb|AAS14824.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 454

 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 191/473 (40%), Positives = 285/473 (60%), Gaps = 84/473 (17%)

Query: 6   ITMPSLSPTMTE--GKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
           I MP+LSPTM++  GK+ KW K+E DK+  GD++ EIETDKAIMEFES+DEG++ +ILV 
Sbjct: 5   ILMPALSPTMSKAGGKIVKWHKKEQDKVEVGDVIAEIETDKAIMEFESIDEGVLAKILVT 64

Query: 64  AGTENIAVNSPILNILMD-----------STEIPPS--PPLSKENIVEVREEH------- 103
            GT  + VN PI  +L +           ST I  +    ++K  +   + EH       
Sbjct: 65  EGTSGVPVNQPIALMLEEGEDESALNNYTSTSINSAVKKEVTKSAVDNQKSEHQDLNGKP 124

Query: 104 -SHSSPVVVR--------------------------------EKHSKNRPIASPLARRLA 130
            SHSS    R                                E +++ R   SPLA+++A
Sbjct: 125 ISHSSVSFQRVTLESNPSMSSQCLTLGSRKEEWIPVSATQMTEGYAEGRTKISPLAKKIA 184

Query: 131 GEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAK 190
              G+++  L G+GP+GRI+K+D+   + +             G+  ES +        K
Sbjct: 185 QNEGVNVQQLKGTGPYGRIIKADVLEFLGS-------------GIHTESPE--------K 223

Query: 191 DSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISN 250
           D+  ++   N+R+ IA RL +SKQ +PHFY+++DC +D L+SL+ ++N   +      +N
Sbjct: 224 DT--IVEVSNMRQVIAQRLTESKQNVPHFYLTVDCQVDKLISLKNEINSADE------NN 275

Query: 251 KISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQK 310
           K+++ND+I+KA A +M + P+ N SW  N ++R+ +IDIS+AV++  G++TPI++ AD+K
Sbjct: 276 KVTINDLIIKAAAFSMKKFPDINSSWIDNKILRYSNIDISIAVALEDGLITPIVKNADKK 335

Query: 311 SILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGA 370
            IL IS EVK L  RA+  KLKPEE+QGG  +ISN+GM GI +F A+INPPQS I+A+GA
Sbjct: 336 GILSISKEVKDLVSRARSGKLKPEEFQGGGFTISNLGMFGIKAFSAIINPPQSCIMAVGA 395

Query: 371 GEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            +K+ +  NE+I++A IM  TLS DHR+VDGA+ +K L  FK YIENP+ ML+
Sbjct: 396 SKKQPIVMNEKIEIAEIMTVTLSVDHRAVDGALGAKFLNAFKHYIENPLVMLI 448


>gi|114766444|ref|ZP_01445409.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Pelagibaca bermudensis HTCC2601]
 gi|114541301|gb|EAU44350.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Roseovarius sp. HTCC2601]
          Length = 446

 Score =  347 bits (889), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 191/445 (42%), Positives = 273/445 (61%), Gaps = 32/445 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD ++ GDIL EIETDKA MEFE+VDEG I +IL+  G
Sbjct: 5   ILMPALSPTMEEGTLAKWLVKEGDTVNSGDILAEIETDKATMEFEAVDEGTIGKILIEDG 64

Query: 66  TENIAVNSPILNIL--------MDSTEIPPSPPLSKENIVEVREEHSHSSPVVVR----- 112
           TE + VN+PI  +L        +DS    P+P  + E+    ++E   ++          
Sbjct: 65  TEGVKVNTPIAVLLEEGESADDIDSASASPAPAPAAEDKAPAKDEAKAAAATPAAASASA 124

Query: 113 -----EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIET---------LI 158
                +     R  A+PLARR+A + G+DL+ + GSGPHGRIVK+D+E+           
Sbjct: 125 APAAPQGSDGKRIFATPLARRIAADKGLDLAQIKGSGPHGRIVKADVESAKPGAAEAPKS 184

Query: 159 STKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPH 218
           +     K        G+        +L ++    +E +  D +R+T+  RL +SKQTIPH
Sbjct: 185 AEAPAAKAAPAASGGGMPTGPSAEQVLKMYEGRDFEEVKLDGMRRTVGARLTESKQTIPH 244

Query: 219 FYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTT 278
           FY+  D  +D LL  R Q+N+ L+        K+SVND I+KA ALA+  VP+AN  W  
Sbjct: 245 FYLRRDIKLDALLKFRSQLNKQLEGR----GVKLSVNDFIIKACALALQAVPDANAVWAG 300

Query: 279 NAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQG 338
           + M++ K  D++VAV+I GG+ TP+++ A+ KS+  +S E+K LA RA+ +KL P EY G
Sbjct: 301 DRMLKLKPSDVAVAVAIDGGLFTPVLKDAEMKSLSALSTEMKDLASRARGKKLAPHEYVG 360

Query: 339 GTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHR 397
           G+ +ISN+GM GI++F AVINPP   ILA+GAG KK +V  + E+ VAT+M+ TLS DHR
Sbjct: 361 GSFAISNLGMFGIDNFDAVINPPHGAILAVGAGVKKPIVGDDGELTVATVMSVTLSVDHR 420

Query: 398 SVDGAIASKLLAKFKEYIENPVWML 422
            +DGA+ ++LL    E +ENP+ ML
Sbjct: 421 VIDGALGAELLKAIVENLENPMVML 445


>gi|241116886|ref|XP_002401656.1| dihydrolipoamide acetyltransferase, putative [Ixodes scapularis]
 gi|215493200|gb|EEC02841.1| dihydrolipoamide acetyltransferase, putative [Ixodes scapularis]
          Length = 391

 Score =  347 bits (889), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 185/420 (44%), Positives = 272/420 (64%), Gaps = 50/420 (11%)

Query: 24  IKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNILMDST 83
           +K+  DK++PG+++ EIETDKA ME E+VDEGI+ +I++P  ++N+ VNS ++ +L +  
Sbjct: 2   VKKRRDKVNPGEVIVEIETDKATMEVEAVDEGILAKIVIPQNSQNVPVNS-LIAVLSEEG 60

Query: 84  E--------------IPPSP------PLSKENIVEVREEHSHSSPVVVREKHSKNRPIAS 123
           E              + P P      P   ENI  V E+ +     V+  KH  ++   S
Sbjct: 61  EEKTDIDAFIAKNNSVSPLPKTDTNLPKPHENIANVEEQGA-----VI--KHDTSKIFTS 113

Query: 124 PLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDAN 183
           PLA+RLA    I L S+ GSGPHGRIVK DI +  S+  + K  S               
Sbjct: 114 PLAKRLAKMGNIRLESVKGSGPHGRIVKQDILSYTSSTVHNKIVSR-------------- 159

Query: 184 ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQF 243
                  + Y ++P++NIRK IA RL +SKQT+PHFY+SI+CN+D LL +RE +N++   
Sbjct: 160 -----NPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKSFS- 213

Query: 244 HREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPI 303
             E+ S KISVND I+ A A A+ +VP AN SW  +A+  + ++DISVAV+I  G+VTPI
Sbjct: 214 --EDKSTKISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISVAVAIENGLVTPI 271

Query: 304 IRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQS 363
           ++ A+QK+I+++S E+K+L ++AK  KL PEE+QGG  +ISN+GM GI +F A+INPPQS
Sbjct: 272 VKNANQKNIIELSREMKELIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPPQS 331

Query: 364 TILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            I+ +G+  K+ + +N++I +ATIM+ TLSADHR VDGA  ++ LA FK++IE+P  ML+
Sbjct: 332 CIMGVGSSSKRAIVKNDQITIATIMDVTLSADHRVVDGAAGAEFLAAFKKFIESPALMLI 391


>gi|163731357|ref|ZP_02138804.1| branched-chain alpha-keto acid dehydrogenase E2 subunit
           [Roseobacter litoralis Och 149]
 gi|161394811|gb|EDQ19133.1| branched-chain alpha-keto acid dehydrogenase E2 subunit
           [Roseobacter litoralis Och 149]
          Length = 416

 Score =  347 bits (889), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 184/423 (43%), Positives = 271/423 (64%), Gaps = 23/423 (5%)

Query: 15  MTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSP 74
           M EG LAKW+ +EGD ++ GDI+ EIETDKA MEFE+VDEG I +IL+  G+E + VN+P
Sbjct: 1   MEEGTLAKWLVKEGDVVASGDIMAEIETDKATMEFEAVDEGTIGKILIEEGSEGVKVNTP 60

Query: 75  ILNILMD-------STEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASPLAR 127
           I  +L D       S+    +P  ++          + +      +    +R  ASPLAR
Sbjct: 61  IAVLLEDGESADDISSAPAATPAAAEAPAPAADPAPAATPAPAAPQSSDGSRIFASPLAR 120

Query: 128 RLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSF-------GLVDESI 180
           R+A  +G+DL++++GSGPHGRIVK+D+E L ++       +   +        G   E++
Sbjct: 121 RIAANNGVDLATVNGSGPHGRIVKADVEGLSASAAAPAKAAPAPAAAAPVVASGPAAEAV 180

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
               + ++   +YE I  + +RKTIA RL ++KQ+IPHFY+  D  +D LL+ R Q+N+ 
Sbjct: 181 ----MAMYEGRAYEEISLNGMRKTIAARLTEAKQSIPHFYLRRDIELDALLAFRGQLNKQ 236

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
           L    E    K+SVND I+KA ALA+  VP+AN  W  + M++    D++VAV+I GG+ 
Sbjct: 237 L----ESRGVKLSVNDFIIKACALALQTVPDANAVWAGDRMLKLTPSDVAVAVAIEGGLF 292

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP+++ A+ KS+  +S E+K LA RA+ RKL P EYQGG+ +ISN+GM GI++F AVINP
Sbjct: 293 TPVLKDAEMKSLSALSAEMKDLAARARDRKLAPHEYQGGSFAISNLGMFGIDNFDAVINP 352

Query: 361 PQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPV 419
           P   ILA+GAG KK +V ++ E+ VAT+M+ TLS DHR +DGA+ ++L+   KE +ENP+
Sbjct: 353 PHGAILAVGAGVKKPIVGKDGELGVATVMSVTLSVDHRVIDGALGAQLITAIKENLENPM 412

Query: 420 WML 422
            ML
Sbjct: 413 TML 415


>gi|58616785|ref|YP_195984.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Ehrlichia
           ruminantium str. Gardel]
 gi|58416397|emb|CAI27510.1| Dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex [Ehrlichia ruminantium str.
           Gardel]
          Length = 406

 Score =  346 bits (888), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 190/443 (42%), Positives = 267/443 (60%), Gaps = 58/443 (13%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDE-GIIDEI 60
           M   + MP+LSPTMT G + KW K EG+++  GDI+ +IETDKA+MEFE  DE GI+ +I
Sbjct: 1   MFVEVLMPALSPTMTSGIIRKWYKSEGEEVKSGDIIADIETDKAVMEFEYTDEDGIMGKI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEI---------PPSPPLSKENIVEVREEHSHSSPVVV 111
           +V  GT+N+ VN  I  I+ D  ++           +    K ++V   EE   +  V +
Sbjct: 61  IVAEGTKNVLVNQLIALIVTDKLDLKEIDTYVSSSTASKTEKASVVLQGEEEIKNDVVTI 120

Query: 112 REKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
            E     R   SPLA+++A +  ID++S+ G+GP+GRIVK+D+    S K N        
Sbjct: 121 SEPK---RIKISPLAKKIASDFAIDINSIQGTGPYGRIVKADVLDAASKKEN-------- 169

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDN----------IRKTIACRLQQSKQTIPHFYV 221
                               + E+IP  N          +RK IA RL  SKQ IPHFYV
Sbjct: 170 --------------------NVEIIPTSNGENTFIEVSSMRKVIAERLVYSKQMIPHFYV 209

Query: 222 SIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN-A 280
           S+DC +D+LL +R      L+ + E    KI++ND I+KA ++++ + PE NVSW  N  
Sbjct: 210 SVDCKVDDLLKVR------LEINAENFGTKITINDFIIKAVSMSIKKFPEINVSWDDNDK 263

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           +I   +IDISVAVSI  G++TPIIR AD+KS+L+IS EVK LA +AK  KLKPEE+QGG 
Sbjct: 264 IIAFANIDISVAVSIDDGLITPIIRNADKKSLLEISNEVKMLASKAKTGKLKPEEFQGGG 323

Query: 341 TSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVD 400
            +ISN+GM GI  F A+INPPQS I+A+G  +K+ +  +++I ++ +M  TLS DHR +D
Sbjct: 324 FTISNLGMFGIKEFNAIINPPQSCIMAVGCSDKRAIIVDDQICISNVMTVTLSVDHRVID 383

Query: 401 GAIASKLLAKFKEYIENPVWMLM 423
           G +A+K L  FK YIE P  ML+
Sbjct: 384 GVLAAKFLNCFKSYIEKPYLMLI 406


>gi|57238798|ref|YP_179934.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58578725|ref|YP_196937.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Ehrlichia
           ruminantium str. Welgevonden]
 gi|57160877|emb|CAH57779.1| dihydrolipoamide acetyltransferase, E2 component of pyruvate
           dehydrogenase complex [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417351|emb|CAI26555.1| Dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 406

 Score =  346 bits (887), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 190/443 (42%), Positives = 267/443 (60%), Gaps = 58/443 (13%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDE-GIIDEI 60
           M   + MP+LSPTMT G + KW K EG++I  GDI+ +IETDKA+MEFE  DE GI+ +I
Sbjct: 1   MFIEVLMPALSPTMTSGIIRKWYKSEGEEIKSGDIIADIETDKAVMEFEYTDEDGIMGKI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEI---------PPSPPLSKENIVEVREEHSHSSPVVV 111
           +V  GT+N+ VN  I  I+ D  ++           +    K ++V   EE   +  V +
Sbjct: 61  IVAEGTKNVLVNQLIALIVTDKLDLKEVDAYVSSSTASKTEKASVVLQGEEEIKNDVVTI 120

Query: 112 REKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
            E     R   SPLA+++A +  ID++S+ G+GP+GRIVK+D+    S K N        
Sbjct: 121 SEPK---RIKISPLAKKIASDFAIDINSIQGTGPYGRIVKADVLDAASKKEN-------- 169

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDN----------IRKTIACRLQQSKQTIPHFYV 221
                               + E+IP  N          +RK IA RL  SKQ IPHFYV
Sbjct: 170 --------------------NVEIIPTSNGENTFIEVSSMRKVIAERLVYSKQMIPHFYV 209

Query: 222 SIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN-A 280
           S+DC +D+LL +R      L+ + E    KI++ND I+KA ++++ + PE NVSW  N  
Sbjct: 210 SVDCKVDDLLKVR------LEINAENFGTKITINDFIIKAVSMSIKKFPEINVSWDDNDK 263

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           +I   ++DISVAVSI  G++TPIIR AD+KS+L+IS EVK LA +AK  KLKPEE+QGG 
Sbjct: 264 IIAFANVDISVAVSIDDGLITPIIRNADKKSLLEISNEVKMLASKAKTGKLKPEEFQGGG 323

Query: 341 TSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVD 400
            +ISN+GM GI  F A+INPPQS I+A+G  +K+ +  +++I ++ +M  TLS DHR +D
Sbjct: 324 FTISNLGMFGIKEFNAIINPPQSCIMAVGCSDKRAIIVDDQICISNVMTVTLSVDHRVID 383

Query: 401 GAIASKLLAKFKEYIENPVWMLM 423
           G +A+K L  FK YIE P  ML+
Sbjct: 384 GVLAAKFLNCFKSYIEKPYLMLI 406


>gi|117956077|gb|ABK58622.1| dihydrolipoamide acetyltransferase [Azoarcus anaerobius]
          Length = 421

 Score =  345 bits (885), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 184/430 (42%), Positives = 260/430 (60%), Gaps = 23/430 (5%)

Query: 8   MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTE 67
           MPS+S +MTEG LA+W+K++G+ ++ G+++ EIETDKAI+E E+  EGI    +    T 
Sbjct: 1   MPSVSTSMTEGTLARWLKKDGETVAKGEVIAEIETDKAILEVEAEAEGIFKAFVADGAT- 59

Query: 68  NIAVNSPILNILMDS----TEIPPSPPLSKENIVEVREEHSHSSPVVVR----------E 113
            + V  P+  +L         I  +   +      V  E + +  V              
Sbjct: 60  -VKVGEPMGALLAPGETLGGTISAAQSAAAPTAAAVGGETAVAVAVAAPAAAPSTGHAPA 118

Query: 114 KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSF 173
            H   R  ASPLAR LA  HG+DL ++SGSGP GRIVK DIE  +S +            
Sbjct: 119 AHDGTRIFASPLARSLALLHGLDLVNISGSGPQGRIVKRDIEAAMSAQRPASGAVAAPVA 178

Query: 174 GLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSL 233
               ++             YE+IPH ++R+ IA RL +SKQ +PHFY+++DC +D LL+L
Sbjct: 179 EAPVKAPQPAAPQAAGA-GYELIPHSSMRRVIAQRLSESKQQVPHFYLTVDCRLDKLLAL 237

Query: 234 REQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAV 293
           R+Q+N +L         K+SVND I+KA A AM +VP  N SW+   + R++ IDISVAV
Sbjct: 238 RQQVNGSLP------DVKVSVNDFIVKAVAAAMKRVPATNASWSDEGVRRYRDIDISVAV 291

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
           + P G++TP++RQAD KS+  IS EVK LA+RA+Q KLKP+EYQGG  +ISN+GM G+  
Sbjct: 292 ATPNGLITPVVRQADAKSVGTISAEVKDLAERARQGKLKPDEYQGGGFTISNLGMYGVRD 351

Query: 354 FCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKE 413
           F A+INPPQ+ ILA+G  EK+ V ++  I  AT+M  TLS DHR VDGA+ ++ LA FK 
Sbjct: 352 FAAIINPPQACILAVGTAEKRPVIEDGAIVPATVMTCTLSVDHRVVDGAVGAEFLAAFKA 411

Query: 414 YIENPVWMLM 423
            +E P+ +L+
Sbjct: 412 LLETPLGLLV 421


>gi|99080918|ref|YP_613072.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Ruegeria
           sp. TM1040]
 gi|99037198|gb|ABF63810.1| Dihydrolipoamide acetyltransferase long form [Ruegeria sp. TM1040]
          Length = 446

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 184/445 (41%), Positives = 267/445 (60%), Gaps = 32/445 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+ +EGD +S GD++ EIETDKA MEFE+VDEG++ +IL+  G
Sbjct: 5   ILMPALSPTMEEGTLAKWLVKEGDTVSSGDLIAEIETDKATMEFEAVDEGVVGKILIAEG 64

Query: 66  TENIAVNSPILNILMD---STEIPPSPPLSKENIVEVREEHSHSSPVVVREKH------- 115
           +E + VN+PI  +L D   + +I  S    +             +               
Sbjct: 65  SEGVKVNTPIAVLLEDGESADDIDTSAATPEAAPAADAAAEEAPAAAEKAAAPAAATPAP 124

Query: 116 ------SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYST 169
                   +R  ASPLARR+A + G+DLS++ GSGP GRI+K D+E   +          
Sbjct: 125 AAPAAADGSRIFASPLARRIAADKGLDLSAIKGSGPRGRIIKVDVENATAAPKADAQTDA 184

Query: 170 IQSFGLVDESIDA-----------NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPH 218
             +      +  A            +  ++   S+E +  D +RKTIA RL ++KQTIPH
Sbjct: 185 QAAAAPAASASPAPVAAPAGPSADQVAKMYEGRSFEEVKLDGMRKTIAARLTEAKQTIPH 244

Query: 219 FYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTT 278
           FY+  D  +D LL  R Q+N+ L+        K+SVND I+KA ALA+  VP+AN  W  
Sbjct: 245 FYLRRDIQLDALLKFRAQLNKQLEGR----GVKLSVNDFIIKAVALALQSVPDANAVWAG 300

Query: 279 NAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQG 338
           + +++ K  D++VAV+I GG+ TP+++ AD KS+  +S E+K LA RA+ RKL P EYQG
Sbjct: 301 DRVLKMKASDVAVAVAIDGGLFTPVLQDADMKSLSALSSEMKDLATRARDRKLAPHEYQG 360

Query: 339 GTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHR 397
           G+ +ISN+GM GI++F A++NPP + ILA+G+G KK VV  + E+ VAT+M+ T+S DHR
Sbjct: 361 GSFAISNLGMFGIDNFDAIVNPPHAGILAVGSGVKKPVVGADGELTVATVMSVTMSVDHR 420

Query: 398 SVDGAIASKLLAKFKEYIENPVWML 422
            +DGA+ + LL    + +ENP+ ML
Sbjct: 421 VIDGALGADLLKAIVDNLENPMVML 445


>gi|296284117|ref|ZP_06862115.1| pyruvate dehydrogenase E2 component [Citromicrobium bathyomarinum
           JL354]
          Length = 440

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 187/455 (41%), Positives = 270/455 (59%), Gaps = 48/455 (10%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LA+W+ + GD ++ GD+L EIETDKA MEFE+VDEG I  I 
Sbjct: 1   MPTPIKMPALSPTMEEGTLARWLVKVGDSVAAGDLLAEIETDKATMEFEAVDEGTIASIE 60

Query: 62  VPAGTENIAVNSPILNILMDS--------------------------------TEIPPSP 89
           +  GTE +AV + I  +  D                                 +E P  P
Sbjct: 61  IDEGTEGVAVGTVIAMLAADGESVEDAAKAAPGDKPEAKKAEETKADDSDKKKSEAPAEP 120

Query: 90  PLSKENIVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRI 149
             +K    E  E    SS  +   +    R  ASPLARR+A + G+DL+ L GSGPHGRI
Sbjct: 121 --AKAQPRESAEPQKASSKDLAAPEKDGERVFASPLARRIADQKGLDLTQLKGSGPHGRI 178

Query: 150 VKSDIETLISTK-TNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACR 208
           VK+D+E     +  N      +   G  + S+D +         +E      +RK +A R
Sbjct: 179 VKADVEGAEGGRPANEAKPGAVA--GSANASMDGDA-------PFEEEKVSGVRKVVAKR 229

Query: 209 LQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQ 268
           L  +KQ +PH+Y+S+D N+D LL+ R  +N+ L+        K+SVND+++KA A A+++
Sbjct: 230 LTAAKQEVPHYYLSVDINLDALLAARADLNKMLEAE----GVKLSVNDLLIKALAKALMR 285

Query: 269 VPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQ 328
            P+A+VS+  + + R++  DISVAV+ P G++TPIIR AD+KS+ +I+ E+K+LA +A++
Sbjct: 286 TPQAHVSFQGDTLHRYQRADISVAVASPKGLITPIIRGADRKSLAEIATEMKELAGKARE 345

Query: 329 RKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIM 388
            KL+P EYQGGT SISN+GM GI  F AVINPPQ  I+A+GAGE++    + +I  ATIM
Sbjct: 346 GKLQPHEYQGGTASISNLGMFGIKQFDAVINPPQGMIMAVGAGEQRPWVIDGQIAPATIM 405

Query: 389 NATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            A+ S DHR++DGA  ++L+  FK   E P+ M++
Sbjct: 406 TASGSFDHRAIDGAEGAQLMEAFKRMCEQPMGMML 440


>gi|304321324|ref|YP_003854967.1| dihydrolipoamide s-acetyltransferase protein [Parvularcula
           bermudensis HTCC2503]
 gi|303300226|gb|ADM09825.1| dihydrolipoamide s-acetyltransferase protein [Parvularcula
           bermudensis HTCC2503]
          Length = 461

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 199/469 (42%), Positives = 274/469 (58%), Gaps = 55/469 (11%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+  EGDKIS GD++ EIETDKA ME E+VD+GI+ +IL
Sbjct: 1   MPMPILMPALSPTMEEGTLAKWMVAEGDKISSGDVIAEIETDKATMEVEAVDDGIVGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTE-------------IPP--------------------- 87
           V +GTE + VN  ++ +L++  E             +P                      
Sbjct: 61  VESGTEAVKVNQ-MIGVLLEEGESADDIDLEALRSSVPTDAGEDNGAAKKDAAQSSKEAT 119

Query: 88  SPPLSKENIVEVRE---EHSHSSPVV---------VREKHSKNRPIASPLARRLAGEHGI 135
           SPP  KE+  E +E   + S  SP              K    R  ASPLARR+A + G+
Sbjct: 120 SPP--KESPSESQEPSADRSAPSPTSTPSGSQSSSADAKAEGERLFASPLARRIAEQEGL 177

Query: 136 DLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEV 195
            L  + G+GP GRIVK D+E  +       D     +       +D     L++ ++Y  
Sbjct: 178 SLPLIEGTGPRGRIVKRDVEKALEEGQAQPDGKGAVA--GAGGGLDPR---LYSPETYTA 232

Query: 196 IPHDNIRKTIACRLQQS-KQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISV 254
           I +D +RKTIA RL QS  Q +PHF ++ID ++  LL+ RE++N        E + KISV
Sbjct: 233 IKNDGMRKTIAKRLNQSFNQEVPHFPLNIDIDLTQLLAARERINAASPEKGSEGTYKISV 292

Query: 255 NDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILD 314
           ND I+KA A A++ VP AN S+T  A++RH H DI VAV+I GG++TPI+ +A+ K +  
Sbjct: 293 NDFIVKASAQALMVVPGANASFTEEAILRHHHADIGVAVAIDGGLITPIVWRAETKGLQA 352

Query: 315 ISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKK 374
           IS E++ LA RA+ +KLKPEEYQGGT ++SN+GM GI SF +++N P   IL++GAGE +
Sbjct: 353 ISEEIRDLAGRARDKKLKPEEYQGGTFAVSNLGMFGIKSFASIVNTPHGAILSVGAGEDR 412

Query: 375 VVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            V +N EI V  IM  TL+ DHR VDGA  ++ LA FK + E P  ML+
Sbjct: 413 PVVRNGEIVVRPIMTVTLTCDHRVVDGATGAEFLAAFKRFCEEPASMLL 461


>gi|255560715|ref|XP_002521371.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase, putative [Ricinus communis]
 gi|223539449|gb|EEF41039.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase, putative [Ricinus communis]
          Length = 543

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 193/438 (44%), Positives = 273/438 (62%), Gaps = 38/438 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +A+W+K+EGDKISPG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 124 IGMPSLSPTMTEGNIARWLKKEGDKISPGEVLCEVETDKATVEMECMEEGFLAKIIKGDG 183

Query: 66  TENIAVNSPILNILMDSTEIPP----SPPLSKENIV---------EVREEHSHSSPVVVR 112
           ++ I V   I   + D  +I      SP +S              EV EE + SSP    
Sbjct: 184 SKEIKVGEVIAITVEDEEDIGKFKDYSPSVSDGAAAASPPPPSKKEVAEE-TVSSPEPKT 242

Query: 113 EK----HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYS 168
            K     S +R  ASPLA++LA +H + LSS+ G+GP G IVK+DIE  ++++      +
Sbjct: 243 SKPSAASSGDRIFASPLAKKLAEDHNVTLSSIKGTGPDGHIVKADIEDYLASRGKEVSAT 302

Query: 169 TIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNID 228
           T ++      SID           Y  IPH  IRK  A RL  SKQTIPH+Y+++D  +D
Sbjct: 303 TPKA---TAASID-----------YVDIPHTQIRKVTASRLLLSKQTIPHYYLTVDTRVD 348

Query: 229 NLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHID 288
            L+ LR ++N            +ISVND+++KA ALA+ +VP+ N SWT N + ++ +++
Sbjct: 349 KLMDLRGKLN---SLQEASGGKRISVNDLVIKAAALALKRVPQCNSSWTDNYIRQYNNVN 405

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           I+VAV    G+  P++R AD+K +  I+ EVK LAQ+AK   LKPE+Y+GGT ++SN+G 
Sbjct: 406 INVAVQTDNGLYVPVVRDADKKGLSKIAEEVKHLAQKAKDNSLKPEDYEGGTFTVSNLGG 465

Query: 349 -LGINSFCAVINPPQSTILAIGAGEKKVVFQN--EEIKVATIMNATLSADHRSVDGAIAS 405
             GI  FCA+INPPQS ILA+G+ EK+V+  +  +E K A+ M  TLS DHR +DGAI +
Sbjct: 466 PFGIKQFCAIINPPQSGILAVGSAEKRVIPGSGPDEFKFASFMLVTLSCDHRVIDGAIGA 525

Query: 406 KLLAKFKEYIENPVWMLM 423
           + L  FK YIENP  ML+
Sbjct: 526 EWLKAFKGYIENPESMLL 543


>gi|225677457|ref|ZP_03788420.1| pyruvate dehydrogenase complex, E2 component [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
 gi|225590503|gb|EEH11767.1| pyruvate dehydrogenase complex, E2 component [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
          Length = 454

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 188/473 (39%), Positives = 280/473 (59%), Gaps = 84/473 (17%)

Query: 6   ITMPSLSPTM--TEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
           I MP+LSPTM  T GK+ KW K+E DK+  GD++ EIETDKAIMEFES+DEG++ +ILV 
Sbjct: 5   ILMPALSPTMSKTGGKIVKWHKKEPDKVEVGDVIAEIETDKAIMEFESIDEGVLAKILVT 64

Query: 64  AGTENIAVNSPILNILMDSTEIPP-------------SPPLSKENIVEVREEH------- 103
            G   + VN PI  +L +  +  P                ++K  +   + EH       
Sbjct: 65  EGASGVPVNQPIALMLEEGEDESPLNNYTSTSINSAVKKEVTKSAVDNQKSEHQDLNGKP 124

Query: 104 -SHSSPVVVR--------------------------------EKHSKNRPIASPLARRLA 130
            SHSS    R                                E +++ R   SPLA+++A
Sbjct: 125 ISHSSVSFQRVTLESNPSMSSQCLTLGSRKEEWIPVSATQMTEGYAEGRTKISPLAKKIA 184

Query: 131 GEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAK 190
              G+++  L G+GP+GRI+K+D+   + +             G+  ES +        K
Sbjct: 185 QNEGVNVQQLKGTGPYGRIIKADVLEFLGS-------------GIHTESPE--------K 223

Query: 191 DSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISN 250
           D+  ++   N+R+ IA RL +SKQ +PHFY+++DC +D L+SL+ ++N   +      +N
Sbjct: 224 DT--IVEVSNMRQVIAQRLTESKQNVPHFYLTVDCQVDKLISLKNEINSADE------NN 275

Query: 251 KISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQK 310
           K+++ND+I+KA A +M + P+ N SW  N ++R+ +IDIS+AV++  G++TPI++ AD+K
Sbjct: 276 KVTINDLIIKAAAFSMKKFPDINSSWIDNKILRYSNIDISIAVALEDGLITPIVKNADKK 335

Query: 311 SILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGA 370
            IL IS EVK L  RA+  KLKPEE+QGG  +ISN+GM GI +F A+IN PQS I+A+GA
Sbjct: 336 GILSISKEVKDLVSRARSGKLKPEEFQGGGFTISNLGMFGIKAFSAIINSPQSCIMAVGA 395

Query: 371 GEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            +K+ +  NE+I++A IM  TLS DHR+VDGA+ +K L  FK YIENP+ ML+
Sbjct: 396 SKKQPIVMNEKIEIAEIMTVTLSVDHRAVDGALGAKFLNAFKHYIENPLVMLI 448


>gi|114778873|ref|ZP_01453672.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide
           acyltransferase (E2) component, and related enzyme
           [Mariprofundus ferrooxydans PV-1]
 gi|114550908|gb|EAU53473.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide
           acyltransferase (E2) component, and related enzyme
           [Mariprofundus ferrooxydans PV-1]
          Length = 429

 Score =  343 bits (880), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 188/431 (43%), Positives = 264/431 (61%), Gaps = 23/431 (5%)

Query: 8   MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTE 67
           M  LSPTMTEGK+A+W+K+EGD +  GD++ EIETDKA ME E VDEGI+  I+   G  
Sbjct: 7   MTQLSPTMTEGKIARWLKKEGDALVSGDVMAEIETDKATMEMEVVDEGILHRIIADEGA- 65

Query: 68  NIAVNSPILNILMDSTEIPPS---------------PPLSKENIVEVREEHSHSSPVVVR 112
            + V + I  I  D  E+P                 P  +           +  +     
Sbjct: 66  TVGVGTAIAVIAEDGEEVPADYQPASAQDAPAAASEPAPAPTEPTPPAATPAPQATAPAA 125

Query: 113 EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQS 172
            + S  R  ASPLARRLA + GI+L++++GSGP+GRIV++DIE  +    N+   +   +
Sbjct: 126 PERSSGRIKASPLARRLAKQKGINLAAITGSGPNGRIVRADIEQAMRRGINIGGAAAATT 185

Query: 173 FGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232
              V   + A  L  + +D +E I +  +RK IA RL +SKQ +PHFY+S+D  +D L+ 
Sbjct: 186 PPPV-RPLPAGPLP-YHEDEFERIENSMMRKAIARRLSESKQHVPHFYLSVDVAMDRLMD 243

Query: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVA 292
           LR Q+N          + K+SVND I+KA A A++ VP AN +WT    + HKH  ISVA
Sbjct: 244 LRAQLNDAANG-----TFKLSVNDFIIKAVAKALVDVPAANAAWTETHTLMHKHAHISVA 298

Query: 293 VSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGIN 352
           V+I GG++TP+IR A+QK I+DIS EVK+LA RA++  LKPEEY GGT SISN+GM GI+
Sbjct: 299 VAINGGLITPVIRFAEQKGIVDISAEVKELAGRAREGLLKPEEYSGGTFSISNLGMYGIS 358

Query: 353 SFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFK 412
            F A++NPP+  ILA+GA E++ V +N  + V  +M  TLS DHR VDGA+ ++ +A  K
Sbjct: 359 QFSAIVNPPEGAILAVGATEERAVAENGVVVVKKMMTLTLSCDHRVVDGAVGAEFMAALK 418

Query: 413 EYIENPVWMLM 423
           + IE P  +L+
Sbjct: 419 KQIECPAGLLI 429


>gi|225442225|ref|XP_002277871.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297743048|emb|CBI35915.3| unnamed protein product [Vitis vinifera]
          Length = 555

 Score =  342 bits (878), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 198/446 (44%), Positives = 273/446 (61%), Gaps = 48/446 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +A+W+K+EGDKISPG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 130 IGMPSLSPTMTEGNIARWLKKEGDKISPGEVLCEVETDKATVEMECMEEGYLAKIIQGDG 189

Query: 66  TENIAVNSPILNILMDSTEIP------PSP--------------PLSKENIVEVREEHSH 105
            + I V   I   + +  +I       PSP              P  KE   EV+EE + 
Sbjct: 190 AKEIKVGEVIAITVEEEEDIAKFKDYKPSPSDAAAESKGSSDSTPPKKE---EVKEEPT- 245

Query: 106 SSPVVVREKHS-----KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST 160
           SSP     K S     + R  ASPLAR+LA EH + LSS+ G+G  G IVK+DIE     
Sbjct: 246 SSPEPKSSKASAAPSTEGRIFASPLARKLAEEHNVPLSSIKGTGTGGSIVKADIE----- 300

Query: 161 KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
                DY  + S G         + +  A D Y  +PH  IRK  A RL  SKQTIPH+Y
Sbjct: 301 -----DY--LASRGKEGSLTAPKVTDTMALD-YTDLPHSQIRKITASRLLLSKQTIPHYY 352

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           +++D  +D L+ LR Q+N            +IS+ND+++KA ALA+ +VP+ N SWT + 
Sbjct: 353 LTVDTCVDKLMDLRSQLN---SIQEASGGKRISINDLVIKAAALALRKVPQCNSSWTNDY 409

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           + ++ +++I+VAV    G+  P+I+ AD+K +  IS EVKQLAQ+AK+  LKP +Y+GGT
Sbjct: 410 IRQYHNVNINVAVQTDNGLFVPVIKDADKKGLSKISEEVKQLAQKAKENNLKPVDYEGGT 469

Query: 341 TSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQN--EEIKVATIMNATLSADHR 397
            ++SN+G   GI  FCA+INPPQS ILAIG+ +K+VV     +E K A+ M+ TLS DHR
Sbjct: 470 FTVSNLGGPFGIKQFCAIINPPQSGILAIGSADKRVVPGTGPDEFKFASFMSVTLSCDHR 529

Query: 398 SVDGAIASKLLAKFKEYIENPVWMLM 423
            +DGAI ++ L  FK YIENP  ML+
Sbjct: 530 VIDGAIGAEWLKAFKSYIENPESMLL 555


>gi|294083777|ref|YP_003550534.1| dihydrolipoamide acetyltransferase [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663349|gb|ADE38450.1| Dihydrolipoamide acetyltransferase, long form [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 437

 Score =  342 bits (877), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 187/448 (41%), Positives = 269/448 (60%), Gaps = 45/448 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM  G L+KW+   GD +  GD++ EIETDKA ME E+VD+G + +I V  G
Sbjct: 5   IKMPALSPTMEVGTLSKWMVAVGDDVRSGDVIAEIETDKATMEVEAVDDGKMAQIAVADG 64

Query: 66  TENIAVNSPILNILMDSTEIP------PSPPLSK-----------ENIVEVRE------- 101
           TENI V + I  +  D  ++       P P  SK           E+    +E       
Sbjct: 65  TENIPVGTVIALLAEDGEDVATVSSASPKPAASKLAPPKEDAAGEESGSAAKEAVADDAT 124

Query: 102 ------EHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE 155
                 + S  +PV  R      R  ASPLARR+A + G+DL+SL+GSGPHGRI++ D+E
Sbjct: 125 KQEPAMDTSKPAPVSPRTSADTKRIFASPLARRIAADKGVDLASLTGSGPHGRILRRDVE 184

Query: 156 TLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQT 215
                       +++Q+  L   +    + +   K +  ++P++ +RK IA RLQ+SKQT
Sbjct: 185 GA---------PASMQA-SLATTAPSRAVTSSAEKGASTLVPNNQMRKIIASRLQESKQT 234

Query: 216 IPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVS 275
            PHFY++IDCNID LL  R+ +N       E I  KISVND++++A A+A+++VP AN S
Sbjct: 235 APHFYLTIDCNIDTLLESRKALN---ALADEGI--KISVNDMVIRAAAMALMKVPAANAS 289

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           W  +      + DI +AV++ GG+VTP+I  A+ K + ++S     LA RA+  KL  EE
Sbjct: 290 WEGDNTRLFHNADICMAVAVDGGLVTPVIWAAESKGLSELSTISSDLATRARDGKLAAEE 349

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSAD 395
           + GG+ +ISN+GM G+  F AVINPPQ  ILA+GAGE++ V  +  + VAT+M  TLS D
Sbjct: 350 FTGGSFTISNLGMFGVREFAAVINPPQGAILAVGAGEQRPVVIDGALSVATMMTVTLSCD 409

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR+VDGA+ ++ L  FK ++ENPV ML+
Sbjct: 410 HRAVDGAVGAEWLQAFKGFVENPVTMLL 437


>gi|85374053|ref|YP_458115.1| pyruvate dehydrogenase E2 component [Erythrobacter litoralis
           HTCC2594]
 gi|84787136|gb|ABC63318.1| pyruvate dehydrogenase E2 component [Erythrobacter litoralis
           HTCC2594]
          Length = 437

 Score =  342 bits (876), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 189/447 (42%), Positives = 277/447 (61%), Gaps = 35/447 (7%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ + GD I  GDI+ EIETDKA MEFE+VDEG + EIL
Sbjct: 1   MPTPIKMPALSPTMEEGTLAKWLVKVGDTIGAGDIMAEIETDKATMEFEAVDEGTVAEIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEI----PPSPPLSKENIVEVREE-----HSHSSPVVVR 112
           +  G+EN+ V   I+ +  +  +I      +P  S      VR E      S S+P   +
Sbjct: 61  IDEGSENVKVGEVIMILAEEGEDIEEAKAAAPQKSDATSETVRAEPVEALSSTSAPPATK 120

Query: 113 EKH----------------SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIET 156
           +                  S +R IASPLA+R+A + G+DLS+++GSGP+GRI+K+D+E 
Sbjct: 121 KDDPSTGSGRTESGGSASSSGDRIIASPLAKRIAEQKGLDLSTVTGSGPNGRIIKADVEG 180

Query: 157 LISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTI 216
             +      D +   +     +      L+      YE    +N+RK IA RL ++KQTI
Sbjct: 181 --AEAGEAPDKADAPAPAQAKQPSLGGDLDA----PYEAEKLNNVRKVIARRLTEAKQTI 234

Query: 217 PHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSW 276
           PH Y+++D  +D LL LR+Q+N +L    E    K+SVND+++KA A A+ +VP+ NVS+
Sbjct: 235 PHIYLTVDVRLDALLDLRKQLNASL----EADGVKLSVNDLLIKALARALQRVPKCNVSF 290

Query: 277 TTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEY 336
             + + ++   DISVAV+ P G++TPIIR A +K +  IS E+K+LA +AK  KL+P+EY
Sbjct: 291 QGDELYQYTREDISVAVAAPSGLITPIIRDAGRKGLAQISTEMKELAGKAKDGKLQPQEY 350

Query: 337 QGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADH 396
           QGGT S+SN+GM G   F AVINPPQ+ ILA+GAGE++    +  + VA +M+AT S DH
Sbjct: 351 QGGTASLSNLGMFGTKQFDAVINPPQAMILAVGAGEQRPHVIDGALGVAMVMSATGSFDH 410

Query: 397 RSVDGAIASKLLAKFKEYIENPVWMLM 423
           R++DGA  ++L+  F++  ENP+ +++
Sbjct: 411 RAIDGADGAQLMEAFQQLCENPMGLVV 437


>gi|118487464|gb|ABK95559.1| unknown [Populus trichocarpa]
          Length = 539

 Score =  341 bits (875), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 193/451 (42%), Positives = 271/451 (60%), Gaps = 55/451 (12%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +A+W+K+EGDKIS G++LCE+ETDKA +E E ++EG + +IL   G
Sbjct: 111 IGMPSLSPTMTEGNIARWLKKEGDKISTGEVLCEVETDKATVEMECMEEGYLAKILKGDG 170

Query: 66  TENIAVNSPILNILMDSTEIP----------------------PSPPLSKENIVEVREEH 103
            + I +   I   + D  +I                       P+PP S +   EV +  
Sbjct: 171 AKEIKLGEVIAITVEDEEDIAKFKDYNPSASGSGATSANEASAPTPPASHKE--EVEKPA 228

Query: 104 SHSSPVVVREKHS--KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTK 161
           S   P + +   +   +R  ASPLAR+LA +H + LSS+ G+GP G IVK+DIE      
Sbjct: 229 SLPEPKISKPSAAPDGDRTFASPLARKLAEDHNVPLSSIKGTGPDGNIVKADIE------ 282

Query: 162 TNVKDYSTIQSFGLVDESIDANILNLFAKDS------YEVIPHDNIRKTIACRLQQSKQT 215
               DY       L     +A      AKD+      Y  IPH  IRK  A RL  SKQT
Sbjct: 283 ----DY-------LASRGKEAPATKPVAKDTSAPALDYVDIPHSQIRKVTASRLLLSKQT 331

Query: 216 IPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVS 275
           IPH+Y+++D  +D L+ LR Q+N            +ISVND+++KA ALA+ +VP+ N S
Sbjct: 332 IPHYYLTVDTCVDKLMGLRSQLNL---IQETSGGKRISVNDLVIKAAALALRKVPQCNSS 388

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           WT + + ++ +++I+VAV    G+  P+IR AD+K +  I+ EVK LAQ+AK+  LKPE+
Sbjct: 389 WTDSYIRQYNNVNINVAVQTDNGLYVPVIRDADKKGLSKIADEVKNLAQKAKENSLKPED 448

Query: 336 YQGGTTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQN--EEIKVATIMNATL 392
           Y+GGT ++SN+G   GI  FCA+INPPQS ILAIG+ EK+V+  +  ++ K A+ M+ TL
Sbjct: 449 YEGGTFTVSNLGGPFGIKQFCAIINPPQSGILAIGSAEKRVIPGSGPDDFKFASFMSVTL 508

Query: 393 SADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           S DHR +DGAI ++ L  FK YIENP  ML+
Sbjct: 509 SCDHRVIDGAIGAEWLKAFKGYIENPESMLL 539


>gi|302383096|ref|YP_003818919.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302193724|gb|ADL01296.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 440

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 188/440 (42%), Positives = 268/440 (60%), Gaps = 27/440 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW  + GD +  GD++ EIETDKA ME E+VDEG I +ILV  G
Sbjct: 4   ILMPALSPTMEEGVLAKWHVKVGDTVKAGDVIAEIETDKATMEVEAVDEGTITDILVAEG 63

Query: 66  TENIAVNSPILNILMDSTEIPPSPPL----------------SKENIVEVREEHSHSSPV 109
           +E + VN+PI  +  +     P+P                    E+   V       S  
Sbjct: 64  SEGVKVNTPIARLAEEGGSAAPAPKAAEPAKAEAPKAAPAPAGHESGDAVATPDGIKSAE 123

Query: 110 VVREKHSKN------RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
            V  K S        R  +SPLARRLA + G+DLS+L G+GPHGRIVK+D+E        
Sbjct: 124 AVLPKTSGTAASTGARVFSSPLARRLAKDAGLDLSTLKGTGPHGRIVKADVEAAAKGGAR 183

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAKD-SYEVIPHDNIRKTIACRLQQSKQTIPHFYVS 222
                   +   ++     ++ ++   D SY++IP D +RK IA R+  S Q +PHF + 
Sbjct: 184 PAAAPATTAASGIEARKVQSLADMGIPDGSYDLIPLDGMRKAIARRMVGSIQNVPHFPLF 243

Query: 223 IDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMI 282
           ID  ID LL+ R ++N  L    E+   K+SVND ++KA A+A+  VPEAN S++   + 
Sbjct: 244 IDVEIDALLAARAKVNAML----EKSGVKVSVNDFVIKAAAMALKLVPEANASYSPEGIA 299

Query: 283 RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTS 342
            H + D+++AV+I GG++TPII +A+ KS+  I++E K LA+RA+ +KLKPEE+QGGT S
Sbjct: 300 MHHNADVAMAVAIDGGLITPIIFKAETKSLSQIAVESKDLAKRARDKKLKPEEFQGGTFS 359

Query: 343 ISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGA 402
           +SN+GM GI +F ++IN PQ  I+++GAGE++ V +N ++ VAT+M  TL+ DHR VDGA
Sbjct: 360 VSNLGMFGIKAFSSIINEPQGAIMSVGAGEQRPVVKNGQLAVATVMTVTLTCDHRVVDGA 419

Query: 403 IASKLLAKFKEYIENPVWML 422
             ++ L  FK  IE+PV ML
Sbjct: 420 TGARFLQAFKPLIEDPVTML 439


>gi|68171330|ref|ZP_00544728.1| Dihydrolipoamide acetyltransferase, long form [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|67999257|gb|EAM85909.1| Dihydrolipoamide acetyltransferase, long form [Ehrlichia
           chaffeensis str. Sapulpa]
          Length = 416

 Score =  340 bits (872), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 182/440 (41%), Positives = 269/440 (61%), Gaps = 50/440 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDE-GIIDEILVPA 64
           + MP+LSPTM  G + KW K EGD +  GD++ +IETDKA+MEFE  DE GI+ +I    
Sbjct: 5   VLMPALSPTMKSGTIRKWYKAEGDVVKSGDVIADIETDKAVMEFEYTDEDGIMGKIFFAE 64

Query: 65  GTENIAVNSPILNILMDSTEIPP--------------------SPPLSKENIV-EVREEH 103
           G++NI VN  I  I +D  ++                      S P   E++V ++ ++ 
Sbjct: 65  GSKNIEVNQLIALIAVDEQDLAKVHSYEKGDNVVKNELVALQDSQPAQDESVVLQMNQQI 124

Query: 104 SHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
            ++S V+V   +S  R   SPLA+++A   G+D++ + G+GP+GRI+K+DI  +I+   +
Sbjct: 125 VNASEVLVNSSNSSERVKVSPLAKKIASNLGVDVNLVKGTGPYGRIIKADILDVINQHGH 184

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
           + +     SF  +                       ++R+ IA RL  SKQTIPHFYVSI
Sbjct: 185 IANSPEDASFTEIS----------------------SMRRVIAERLVYSKQTIPHFYVSI 222

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           DC +D+LL LR      L+ + E    K++VND I+KA A+++ + PE NVSW+ + ++ 
Sbjct: 223 DCLVDSLLKLR------LEINAENPDTKVTVNDFIIKAVAMSIKKFPEINVSWSDDKIVV 276

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
              IDISVAVSI  G++TPII  AD+KS+L+IS EVK LA +AK  KLKPEE+QGG  ++
Sbjct: 277 FPSIDISVAVSIDNGLITPIIFGADKKSLLEISREVKALASKAKSGKLKPEEFQGGGFTV 336

Query: 344 SNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAI 403
           SN+GM GI  F A++NPPQS I+++G  EK+ +  NE+I ++ ++  TLS DHR +DG +
Sbjct: 337 SNLGMFGIKEFYAIVNPPQSCIMSVGCSEKRAMVVNEQICISNVVTVTLSVDHRVIDGVL 396

Query: 404 ASKLLAKFKEYIENPVWMLM 423
           A+K L  FK Y+E P  ML+
Sbjct: 397 AAKFLNCFKSYLEKPFLMLI 416


>gi|260461619|ref|ZP_05809866.1| catalytic domain of component of various dehydrogenase complexes
           [Mesorhizobium opportunistum WSM2075]
 gi|259032689|gb|EEW33953.1| catalytic domain of component of various dehydrogenase complexes
           [Mesorhizobium opportunistum WSM2075]
          Length = 380

 Score =  340 bits (872), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 182/422 (43%), Positives = 255/422 (60%), Gaps = 50/422 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P +   M  G++++W  +EG  +  GD+L EIETDKA ME ++   G++ ++    G
Sbjct: 5   VILPKVDMDMATGQISRWFAEEGAHVKKGDVLFEIETDKAAMEIDAPASGVLRDVTGKEG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASPL 125
             +IAV + +  I  D                               E +    PI SPL
Sbjct: 65  V-DIAVGAAVAWIYADG------------------------------EAYGDKAPI-SPL 92

Query: 126 ARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANIL 185
                GE       +S     G +       L   +    D  +     L  E    ++L
Sbjct: 93  E----GE-------MSAKPTEGVVSGGTAPALSPVEPTPPDRPSAGHPPLKGEG---HVL 138

Query: 186 NLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHR 245
            LF   SYE++PHDN+RKTIA RL ++K TIPHFY+++DC +D LL+LR Q+N      +
Sbjct: 139 RLFEPGSYELVPHDNMRKTIARRLVEAKTTIPHFYLTLDCELDALLALRTQINAAAPVKK 198

Query: 246 ----EEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
               E  + K+SVND+++KA ALA+  VP+AN SWT +AM++HKH D+ VAVSIPGG++T
Sbjct: 199 TEKGEAPAYKLSVNDMVIKAMALALKAVPDANASWTESAMVKHKHADVGVAVSIPGGLIT 258

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PIIR AD+K++  IS E+K LA RA+ RKLKPEEYQGGTT++SN+GM GI  F AVINPP
Sbjct: 259 PIIRHADEKTLSVISNEMKDLASRARSRKLKPEEYQGGTTAVSNLGMFGIKDFAAVINPP 318

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
            +TILA+GAGE++ V +N EIK+AT+M+ TLS DHR+VDGA+ ++LL  FK  IENP+ M
Sbjct: 319 HATILAVGAGEERAVVKNGEIKIATVMSVTLSTDHRAVDGALGAELLVAFKRLIENPMGM 378

Query: 422 LM 423
           L+
Sbjct: 379 LV 380


>gi|18404837|ref|NP_564654.1| dihydrolipoamide S-acetyltransferase, putative [Arabidopsis
           thaliana]
 gi|79319911|ref|NP_001031186.1| dihydrolipoamide S-acetyltransferase, putative [Arabidopsis
           thaliana]
 gi|75285553|sp|Q5M729|OPD23_ARATH RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component 3 of pyruvate dehydrogenase complex,
           mitochondrial; AltName: Full=Dihydrolipoamide
           S-acetyltransferase component 3 of pyruvate
           dehydrogenase complex; AltName: Full=Pyruvate
           dehydrogenase complex component E2 3; Short=PDC-E2 3;
           Short=PDCE2 3; Flags: Precursor
 gi|56550713|gb|AAV97810.1| At1g54220 [Arabidopsis thaliana]
 gi|332194946|gb|AEE33067.1| dihydrolipoyllysine-residue acetyltransferase component 3 of
           pyruvate dehydrogenase complex [Arabidopsis thaliana]
 gi|332194947|gb|AEE33068.1| dihydrolipoyllysine-residue acetyltransferase component 3 of
           pyruvate dehydrogenase complex [Arabidopsis thaliana]
          Length = 539

 Score =  340 bits (872), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 185/442 (41%), Positives = 272/442 (61%), Gaps = 40/442 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +A+W+K+EGDK++PG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 114 IGMPSLSPTMTEGNIARWLKKEGDKVAPGEVLCEVETDKATVEMECMEEGYLAKIVKAEG 173

Query: 66  TENIAVNSPILNILMDS-------------------TEIPPSPPLSKENIVEVREEHSHS 106
           ++ I V   I   + D                    T+  P+P   KE   +V++  S  
Sbjct: 174 SKEIQVGEVIAITVEDEEDIGKFKDYTPSSTADAAPTKAEPTPAPPKEE--KVKQPSSPP 231

Query: 107 SPVVVREKH--SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNV 164
            P   +     + +R  ASPLAR+LA ++ + LS + G+GP GRIVK+DI+  +++    
Sbjct: 232 EPKASKPSTPPTGDRVFASPLARKLAEDNNVPLSDIEGTGPEGRIVKADIDEYLAS---- 287

Query: 165 KDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
              S   +     +S D+    L     Y  IPH  IRK  A RL  SKQTIPH+Y+++D
Sbjct: 288 ---SGKGATAKPSKSTDSKAPAL----DYVDIPHSQIRKVTASRLAFSKQTIPHYYLTVD 340

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
             +D L++LR Q+N    F       +ISVND+++KA ALA+ +VP+ N SWT + + + 
Sbjct: 341 TCVDKLMALRSQLN---SFKEASGGKRISVNDLVVKAAALALRKVPQCNSSWTDDYIRQF 397

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           K+++I+VAV    G+  P+++ AD+K +  I  EV+ LAQ+AK+  LKPE+Y+GGT ++S
Sbjct: 398 KNVNINVAVQTENGLYVPVVKDADRKGLSTIGEEVRLLAQKAKENSLKPEDYEGGTFTVS 457

Query: 345 NMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQN--EEIKVATIMNATLSADHRSVDG 401
           N+G   GI  FCAV+NPPQ+ ILA+G+ EK+VV  N  ++   A+ M  TLS DHR VDG
Sbjct: 458 NLGGPFGIKQFCAVVNPPQAAILAVGSAEKRVVPGNGPDQFNFASYMPVTLSCDHRVVDG 517

Query: 402 AIASKLLAKFKEYIENPVWMLM 423
           AI ++ L  FK YIENP  ML+
Sbjct: 518 AIGAEWLKAFKGYIENPKSMLL 539


>gi|22531144|gb|AAM97076.1| dihydrolipoamide S-acetyltransferase, putative [Arabidopsis
           thaliana]
          Length = 539

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 185/442 (41%), Positives = 272/442 (61%), Gaps = 40/442 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +A+W+K+EGDK++PG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 114 IGMPSLSPTMTEGNIARWLKKEGDKVAPGEVLCEVETDKATVEMECMEEGYLAKIVKAEG 173

Query: 66  TENIAVNSPILNILMDS-------------------TEIPPSPPLSKENIVEVREEHSHS 106
           ++ I V   I   + D                    T+  P+P   KE   +V++  S  
Sbjct: 174 SKEIQVGEVIAITVEDEEDIGKFKDYTPSSTADAAPTKAEPTPAPPKEE--KVKQPSSPP 231

Query: 107 SPVVVREKH--SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNV 164
            P   +     + +R  ASPLAR+LA ++ + LS + G+GP GRIVK+DI+  +++    
Sbjct: 232 EPKASKPSTPPTGDRVFASPLARKLAEDNNVPLSDIEGTGPEGRIVKADIDEYLAS---- 287

Query: 165 KDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
              S   +     +S D+    L     Y  IPH  IRK  A RL  SKQTIPH+Y+++D
Sbjct: 288 ---SGKGATAKPSKSTDSKAPAL----DYVDIPHSQIRKVTASRLAFSKQTIPHYYLTVD 340

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
             +D L++LR Q+N    F       +ISVND+++KA ALA+ +VP+ N SWT + + + 
Sbjct: 341 TCVDKLMALRSQLN---SFKEASGGKRISVNDLVVKAAALALRKVPQCNSSWTDDYIRQF 397

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           K+++I+VAV    G+  P+++ AD+K +  I  EV+ LAQ+AK+  LKPE+Y+GGT ++S
Sbjct: 398 KNVNINVAVQTENGLYVPVVKDADRKGLSTIGEEVRLLAQKAKESSLKPEDYEGGTFTVS 457

Query: 345 NMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQN--EEIKVATIMNATLSADHRSVDG 401
           N+G   GI  FCAV+NPPQ+ ILA+G+ EK+VV  N  ++   A+ M  TLS DHR VDG
Sbjct: 458 NLGGPFGIKQFCAVVNPPQAAILAVGSAEKRVVPGNGPDQFNFASYMPVTLSCDHRVVDG 517

Query: 402 AIASKLLAKFKEYIENPVWMLM 423
           AI ++ L  FK YIENP  ML+
Sbjct: 518 AIGAEWLKAFKGYIENPKSMLL 539


>gi|218197407|gb|EEC79834.1| hypothetical protein OsI_21298 [Oryza sativa Indica Group]
          Length = 545

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 180/438 (41%), Positives = 268/438 (61%), Gaps = 41/438 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +A+W+K+EGDK+SPG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 129 IGMPSLSPTMTEGNIARWVKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIIHGDG 188

Query: 66  TENIAVNSPILNILMDSTEI---------------PPSPPLSKENIVEVREEHSHSSPVV 110
            + I V   I   + +  +I                P+    +    E ++E        
Sbjct: 189 AKEIKVGEIIAVTVEEEEDIGKFKDYKAPSSAESAAPAESKPQSEPTEPKKEKEQPKATK 248

Query: 111 VREKH-SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST--KTNVKDY 167
             E   S++R  +SP+AR+LA ++ + LSS+ G+GP GRI+K+DIE  +++  K   K+ 
Sbjct: 249 TEESFLSEDRTFSSPIARKLAEDNNVPLSSIKGTGPDGRILKADIEDYLASVAKGAKKET 308

Query: 168 STIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNI 227
           +     G VD                  +P+  IRK  A RL  SKQTIPH+Y+++D  +
Sbjct: 309 AAAPGLGYVD------------------LPNTQIRKVTANRLLHSKQTIPHYYLTVDTRV 350

Query: 228 DNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI 287
           D L+ LR ++N            KIS+ND+++KA ALA+  VPE N SW  + + ++ ++
Sbjct: 351 DKLIKLRSELN---PLQDTSGGKKISINDLVIKAAALALRNVPECNSSWMNDFIRQYHNV 407

Query: 288 DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMG 347
           +I+VAV    G+  P+IR AD+K +  I+ EVKQLAQRA+  +LKPE+Y+GGT ++SN+G
Sbjct: 408 NINVAVQTEDGLFVPVIRDADKKGLATIADEVKQLAQRARDNRLKPEDYEGGTFTVSNLG 467

Query: 348 M-LGINSFCAVINPPQSTILAIGAGEKKVVFQNE-EIKVATIMNATLSADHRSVDGAIAS 405
              GI  FCA++NPPQS ILAIG+ EK+V+   E + +V + M+ATLS DHR +DGAI +
Sbjct: 468 GPFGIKQFCAIVNPPQSAILAIGSAEKRVIPGAEGQFEVGSFMSATLSCDHRVIDGAIGA 527

Query: 406 KLLAKFKEYIENPVWMLM 423
           + +  FK YIENP  ML+
Sbjct: 528 EWMKAFKGYIENPTTMLL 545


>gi|4585966|gb|AAD25602.1|AC005287_4 Putative dihyrdolipoamide acetyltransferase [Arabidopsis thaliana]
          Length = 516

 Score =  339 bits (869), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 185/442 (41%), Positives = 272/442 (61%), Gaps = 40/442 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +A+W+K+EGDK++PG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 91  IGMPSLSPTMTEGNIARWLKKEGDKVAPGEVLCEVETDKATVEMECMEEGYLAKIVKAEG 150

Query: 66  TENIAVNSPILNILMDS-------------------TEIPPSPPLSKENIVEVREEHSHS 106
           ++ I V   I   + D                    T+  P+P   KE   +V++  S  
Sbjct: 151 SKEIQVGEVIAITVEDEEDIGKFKDYTPSSTADAAPTKAEPTPAPPKEE--KVKQPSSPP 208

Query: 107 SPVVVREKH--SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNV 164
            P   +     + +R  ASPLAR+LA ++ + LS + G+GP GRIVK+DI+  +++    
Sbjct: 209 EPKASKPSTPPTGDRVFASPLARKLAEDNNVPLSDIEGTGPEGRIVKADIDEYLAS---- 264

Query: 165 KDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
              S   +     +S D+    L     Y  IPH  IRK  A RL  SKQTIPH+Y+++D
Sbjct: 265 ---SGKGATAKPSKSTDSKAPAL----DYVDIPHSQIRKVTASRLAFSKQTIPHYYLTVD 317

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
             +D L++LR Q+N    F       +ISVND+++KA ALA+ +VP+ N SWT + + + 
Sbjct: 318 TCVDKLMALRSQLN---SFKEASGGKRISVNDLVVKAAALALRKVPQCNSSWTDDYIRQF 374

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           K+++I+VAV    G+  P+++ AD+K +  I  EV+ LAQ+AK+  LKPE+Y+GGT ++S
Sbjct: 375 KNVNINVAVQTENGLYVPVVKDADRKGLSTIGEEVRLLAQKAKENSLKPEDYEGGTFTVS 434

Query: 345 NMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQN--EEIKVATIMNATLSADHRSVDG 401
           N+G   GI  FCAV+NPPQ+ ILA+G+ EK+VV  N  ++   A+ M  TLS DHR VDG
Sbjct: 435 NLGGPFGIKQFCAVVNPPQAAILAVGSAEKRVVPGNGPDQFNFASYMPVTLSCDHRVVDG 494

Query: 402 AIASKLLAKFKEYIENPVWMLM 423
           AI ++ L  FK YIENP  ML+
Sbjct: 495 AIGAEWLKAFKGYIENPKSMLL 516


>gi|326526603|dbj|BAJ97318.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 546

 Score =  339 bits (869), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 183/445 (41%), Positives = 270/445 (60%), Gaps = 47/445 (10%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            I MPSLSPTMTEG +A+W+K+EGDK+SPG++LCE+ETDKA +E E ++EG + +I+   
Sbjct: 123 AIGMPSLSPTMTEGNIARWVKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVCGD 182

Query: 65  GTENIAVNSPILNILMDSTEI---------------------PPSPPLS-KENIVEVREE 102
           G + I V   I   + +  +I                     P S P+  KE   EV + 
Sbjct: 183 GAKEIKVGEIICITVEEEGDIEKFKDYKASSSPSAAAPAESKPQSEPVQPKEEKKEVSKA 242

Query: 103 HSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST-- 160
              ++        S +R  +SP+AR+LA ++ + LSSL G+GP GRI+K+DIE  +S+  
Sbjct: 243 PEPTATKTEESSQSGDRLFSSPVARKLAEDNNVPLSSLKGTGPDGRILKADIEDYLSSAS 302

Query: 161 KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
           K + K+ +     G VD                  +P+  IRK  A RL QSKQTIPH+Y
Sbjct: 303 KGSKKEAAAAPGLGYVD------------------LPNTQIRKVTANRLLQSKQTIPHYY 344

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           +++D  +D L+ LR ++N            KIS+ND+++KA ALA+ +VP  N SW  + 
Sbjct: 345 LTVDSRVDKLIKLRSELN---PMQDASGGKKISINDLVIKAAALALRKVPACNSSWMNDF 401

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           + ++ +++I+VAV    G+  P++R AD+K +  I+ EVKQLA RA+   LKPE+Y+GGT
Sbjct: 402 IRQYHNVNINVAVQTEHGLFVPVVRDADKKGLATIADEVKQLALRARDNSLKPEDYEGGT 461

Query: 341 TSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQNE-EIKVATIMNATLSADHRS 398
            ++SN+G   GI  FCA++NPPQS ILAIG+ EK+VV   E + +V + M+ATLS DHR 
Sbjct: 462 FTVSNLGGPFGIKQFCAIVNPPQSAILAIGSAEKRVVPGVEGQFEVGSFMSATLSCDHRV 521

Query: 399 VDGAIASKLLAKFKEYIENPVWMLM 423
           +DGA+ ++ L  FK Y+ENP  ML+
Sbjct: 522 IDGAMGAEWLKAFKSYLENPTTMLL 546


>gi|14161722|gb|AAK53067.1| mono-lipoyl E2 [Arabidopsis thaliana]
          Length = 539

 Score =  339 bits (869), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 185/442 (41%), Positives = 271/442 (61%), Gaps = 40/442 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +A+W+K+EGDK++PG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 114 IGMPSLSPTMTEGNIARWLKKEGDKVAPGEVLCEVETDKATVEMECMEEGYLAKIVKAEG 173

Query: 66  TENIAVNSPILNILMDS-------------------TEIPPSPPLSKENIVEVREEHSHS 106
           ++ I V   I   + D                    T+  P+P   KE   +V++  S  
Sbjct: 174 SKEIQVGEVIAITVEDEEDIGKFKDYTPSSTADAAPTKAEPTPAPPKEE--KVKQPSSPP 231

Query: 107 SPVVVREKH--SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNV 164
            P   +     + +R  ASPLAR+LA ++ + LS   G+GP GRIVK+DI+  +++    
Sbjct: 232 EPKASKPSTPPTGDRVFASPLARKLAEDNNVPLSDTEGTGPEGRIVKADIDEYLAS---- 287

Query: 165 KDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
              S   +     +S D+    L     Y  IPH  IRK  A RL  SKQTIPH+Y+++D
Sbjct: 288 ---SGKGATAKPSKSTDSKAPAL----DYVDIPHSQIRKVTASRLAFSKQTIPHYYLTVD 340

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
             +D L++LR Q+N    F       +ISVND+++KA ALA+ +VP+ N SWT + + + 
Sbjct: 341 TCVDKLMALRSQLN---SFKEASGGKRISVNDLVVKAAALALRKVPQCNSSWTDDYIRQF 397

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           K+++I+VAV    G+  P+++ AD+K +  I  EV+ LAQ+AK+  LKPE+Y+GGT ++S
Sbjct: 398 KNVNINVAVQTENGLYVPVVKDADRKGLSTIGEEVRLLAQKAKENSLKPEDYEGGTFTVS 457

Query: 345 NMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQN--EEIKVATIMNATLSADHRSVDG 401
           N+G   GI  FCAV+NPPQ+ ILA+G+ EK+VV  N  ++   A+ M  TLS DHR VDG
Sbjct: 458 NLGGPFGIKQFCAVVNPPQAAILAVGSAEKRVVPGNGPDQFNFASYMPVTLSCDHRVVDG 517

Query: 402 AIASKLLAKFKEYIENPVWMLM 423
           AI ++ L  FK YIENP  ML+
Sbjct: 518 AIGAEWLKAFKGYIENPKSMLL 539


>gi|73954763|ref|XP_862015.1| PREDICTED: similar to dihydrolipoamide S-acetyltransferase (E2
           component of pyruvate dehydrogenase complex) isoform 2
           [Canis familiaris]
          Length = 631

 Score =  339 bits (869), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 181/441 (41%), Positives = 270/441 (61%), Gaps = 42/441 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +IL+P G
Sbjct: 210 VVLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILIPEG 269

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSH-------------------- 105
           T ++ + +P+  I+    +IP         + +++ +                       
Sbjct: 270 TRDVPLGTPLCIIVEKEEDIPAFADYRPTEVTDLKPQAPPSTPPPVAPVPPTPQPVTPTP 329

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R  ASPLA++LA E GIDL+ + G+GP GRI+K D+++ + TK    
Sbjct: 330 SAPRPATPAGPKGRLFASPLAKKLAAEKGIDLTQVKGTGPEGRIIKKDVDSFVPTKAAPV 389

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + + S    D                  +P  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 390 RVAPVPSGVFTD------------------VPISNIRRVIAQRLMQSKQTIPHYYLSIDV 431

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L        +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 432 NMGEVLLVRKELNKWLSAFGSGRRSKISVNDFIIKASALACLKVPEANSSW-LDTVIRQN 490

Query: 286 H-IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H +D+SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 491 HVVDVSVAVSTPAGLITPIVFNAHIKGLEAIANDVVSLATKAREGKLQPHEFQGGTFTIS 550

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E ++V  + E    VA++M+ TLS DHR VDGA
Sbjct: 551 NLGMFGIKNFSAIINPPQACILAIGASEDRLVPADNEKGFDVASMMSVTLSCDHRVVDGA 610

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 611 VGAQWLAEFRKYLEKPITMLL 631



 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 51/75 (68%), Gaps = 1/75 (1%)

Query: 10  SLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENI 69
           SL P    G +A+W K+EG+KI+ G+++ E+ETDKA + FES++E  + +ILV  GT ++
Sbjct: 87  SLPPHQKAGTIARWEKKEGEKINEGELIAEVETDKATVGFESLEECYMAKILVAEGTRDV 146

Query: 70  AVNSPILNILMDSTE 84
            V + I+ I ++  E
Sbjct: 147 PVGA-IICITVEKPE 160


>gi|307942233|ref|ZP_07657584.1| dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Roseibium sp. TrichSKD4]
 gi|307774519|gb|EFO33729.1| dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Roseibium sp. TrichSKD4]
          Length = 309

 Score =  338 bits (868), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 162/313 (51%), Positives = 222/313 (70%), Gaps = 18/313 (5%)

Query: 125 LARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN-------------VKDYSTIQ 171
           +ARRLA  +G+DL+ +SG+GPHGRIVK DIE  +                      +   
Sbjct: 1   MARRLAKLNGLDLAQISGTGPHGRIVKKDIEAALEKGVGKAATSASASAPASAAPAAAAA 60

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
             G+  +     +L LF  DSYE++PHD +RKTIA RL +SKQTIPHFYVS+DC +D LL
Sbjct: 61  PSGMSSD----QVLKLFDDDSYELVPHDGMRKTIAKRLTESKQTIPHFYVSVDCELDALL 116

Query: 232 SLREQMNRTLQFHRE-EISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDIS 290
           +LR Q+N      ++ + + K+SVND+ +KA ALA+  VP+ANVSWT + M++HKH D+ 
Sbjct: 117 ALRSQLNGAAPTDKDGKPAYKLSVNDMTIKALALALRDVPDANVSWTDDNMVKHKHADVG 176

Query: 291 VAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLG 350
           VAVSIPGG++TPI+RQA+ K +  IS E+K L +RAK+RKLKPEEYQGGTT++SNMGM+ 
Sbjct: 177 VAVSIPGGLITPIVRQAEMKPLSVISNEMKDLGKRAKERKLKPEEYQGGTTAVSNMGMMD 236

Query: 351 INSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAK 410
           +  F AV+NPP +TILA+GAGE++ V ++  + +AT+M  TLS DHR VDGA+ ++LLA 
Sbjct: 237 VKDFSAVVNPPHATILAVGAGEQRPVVKDGALAIATVMTVTLSTDHRCVDGALGAELLAA 296

Query: 411 FKEYIENPVWMLM 423
           FK YI+NP+ ML+
Sbjct: 297 FKGYIQNPMSMLV 309


>gi|125558055|gb|EAZ03591.1| hypothetical protein OsI_25727 [Oryza sativa Indica Group]
          Length = 541

 Score =  338 bits (868), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 187/443 (42%), Positives = 273/443 (61%), Gaps = 47/443 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +A+W+K+EGDK+SPG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 121 IGMPSLSPTMTEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIIHGDG 180

Query: 66  TENIAVNSPILNILMDSTEI-------------PPSPPLSK------ENIVEVREEHSHS 106
           ++ I V   I   + +  +I             P +P   K      E  VE RE    S
Sbjct: 181 SKEIKVGEIIAVTVEEEGDIKKFKDYKPSTLAAPVAPSELKAQSELTEPKVEEREPSKAS 240

Query: 107 SPVVVREK---HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
            P   R +    S +R  +SPLAR+LA ++ + LS++ G+GP GRI+K+DIE  ++    
Sbjct: 241 EPKAPRTEEPSRSGDRIFSSPLARKLAEDNNVPLSNVKGTGPDGRILKADIEDYLAK--- 297

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
                     G   E++ A  L      SY  +P+  IRK  A RL  SKQTIPH+Y+++
Sbjct: 298 ----------GCRKEALAAPGL------SYTDVPNAQIRKVTANRLLSSKQTIPHYYLTV 341

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           D  +DNL+ LR ++N            KIS+ND+++KA ALA+ +VP+ N SW  + + +
Sbjct: 342 DTRVDNLIKLRGELN---PLQESSGGKKISINDLVIKAAALALRKVPQCNSSWMNDFIRQ 398

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
           + +++I+VAV    G+  P+IR AD+K +  I+ EVKQLAQRA+   LKP++Y+GGT +I
Sbjct: 399 YHNVNINVAVQTEHGLFVPVIRDADKKGLGMIAEEVKQLAQRARDNSLKPDDYEGGTFTI 458

Query: 344 SNMGM-LGINSFCAVINPPQSTILAIGAGEKKVV--FQNEEIKVATIMNATLSADHRSVD 400
           SN+G   GI  FCA+INPPQS ILAIG+ E++V+    N + +  + M+AT+S DHR +D
Sbjct: 459 SNLGGPFGIKQFCAIINPPQSAILAIGSAERRVIPGSANGQYEFGSFMSATMSCDHRVID 518

Query: 401 GAIASKLLAKFKEYIENPVWMLM 423
           GAI ++ L  FK YIENP  ML+
Sbjct: 519 GAIGAEFLKAFKGYIENPTSMLL 541


>gi|18400212|ref|NP_566470.1| dihydrolipoamide S-acetyltransferase, putative [Arabidopsis
           thaliana]
 gi|118573090|sp|Q8RWN9|OPD22_ARATH RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component 2 of pyruvate dehydrogenase complex,
           mitochondrial; AltName: Full=Dihydrolipoamide
           S-acetyltransferase component 2 of pyruvate
           dehydrogenase complex; AltName: Full=Pyruvate
           dehydrogenase complex component E2 2; Short=PDC-E2 2;
           Short=PDCE2 2; Flags: Precursor
 gi|13605807|gb|AAK32889.1|AF367302_1 AT3g13930/MDC16_5 [Arabidopsis thaliana]
 gi|20147147|gb|AAM10290.1| AT3g13930/MDC16_5 [Arabidopsis thaliana]
 gi|23306388|gb|AAN17421.1| putative acetyltransferase [Arabidopsis thaliana]
 gi|23397124|gb|AAN31846.1| putative acetyltransferase [Arabidopsis thaliana]
 gi|24899791|gb|AAN65110.1| putative acetyltransferase [Arabidopsis thaliana]
 gi|332641921|gb|AEE75442.1| dihydrolipoyllysine-residue acetyltransferase component 2 of
           pyruvate dehydrogenase complex [Arabidopsis thaliana]
          Length = 539

 Score =  338 bits (867), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 184/440 (41%), Positives = 269/440 (61%), Gaps = 36/440 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +A+W+K+EGDK++PG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 114 IGMPSLSPTMTEGNIARWLKKEGDKVAPGEVLCEVETDKATVEMECMEEGFLAKIVKEEG 173

Query: 66  TENIAVNSPILNILMDSTEI------PPSP-------------PLSKENIVEVREEHSHS 106
            + I V   I   + D  +I       PS               L KE  VE       +
Sbjct: 174 AKEIQVGEVIAITVEDEDDIQKFKDYTPSSDTGPAAPEAKPAPSLPKEEKVEKPASAPEA 233

Query: 107 SPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKD 166
                    S++R  ASPLAR+LA ++ + LSS+ G+GP GRIVK+D+E  +++ +    
Sbjct: 234 KISKPSSAPSEDRIFASPLARKLAEDNNVPLSSIKGTGPEGRIVKADVEDFLASGSK--- 290

Query: 167 YSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
               ++     + +D+ +  L     Y  IPH  IRK  A RL  SKQTIPH+Y+++D  
Sbjct: 291 ----ETTAKPSKQVDSKVPAL----DYVDIPHTQIRKVTASRLAFSKQTIPHYYLTVDTC 342

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           +D ++ LR Q+N    F       +ISVND+++KA ALA+ +VP+ N SWT   + + K+
Sbjct: 343 VDKMMGLRSQLN---SFQEASGGKRISVNDLVIKAAALALRKVPQCNSSWTDEYIRQFKN 399

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
           ++I+VAV    G+  P+++ AD+K +  I  EV+ LAQ+AK+  LKPE+Y+GGT ++SN+
Sbjct: 400 VNINVAVQTENGLYVPVVKDADKKGLSTIGEEVRFLAQKAKENSLKPEDYEGGTFTVSNL 459

Query: 347 GM-LGINSFCAVINPPQSTILAIGAGEKKVVFQN--EEIKVATIMNATLSADHRSVDGAI 403
           G   GI  FCAVINPPQ+ ILAIG+ EK+VV     ++  VA+ M+ TLS DHR +DGAI
Sbjct: 460 GGPFGIKQFCAVINPPQAAILAIGSAEKRVVPGTGPDQYNVASYMSVTLSCDHRVIDGAI 519

Query: 404 ASKLLAKFKEYIENPVWMLM 423
            ++ L  FK YIE P  ML+
Sbjct: 520 GAEWLKAFKGYIETPESMLL 539


>gi|307135863|gb|ADN33731.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase [Cucumis melo subsp. melo]
          Length = 536

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 188/442 (42%), Positives = 270/442 (61%), Gaps = 40/442 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MPSLSPTMTEG +A+W+K+EGDKISPG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 111 VGMPSLSPTMTEGNIARWLKKEGDKISPGEVLCEVETDKATVEMECMEEGYLAKIICGDG 170

Query: 66  TENIAVNSPILNILMDSTEIPP----SPPLSKENIV-------------EVREEHSHS-S 107
            + I V   I   + D  +I       P  S                  EV EE   S  
Sbjct: 171 AKEIKVGEVIAITVEDEEDIAKFKDYKPTSSNTGAASAPESPAPSPPKKEVVEEPVRSPQ 230

Query: 108 PVVVREKH---SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNV 164
           P  V++     +  R  ASPLAR+LA E+ + +SS+ G+GP G IVK+DIE  ++++   
Sbjct: 231 PSTVKQSPPSPAGERIFASPLARKLAEENNVPISSIKGTGPDGSIVKADIEDYLASRG-- 288

Query: 165 KDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
           K+ +  ++       +D           Y  +PH  IRK  A RL  SKQTIPH+Y+++D
Sbjct: 289 KESTAPKAKDAAGAPLD-----------YSDLPHTQIRKVTASRLLFSKQTIPHYYLTVD 337

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
             +D L+ LR Q+N            +ISVND+++KA ALA+ +VP+ N SWT N + ++
Sbjct: 338 TCVDKLMDLRNQLN---ALQEASGGKRISVNDLVIKAAALALRKVPQCNSSWTDNYIRQY 394

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
            +++I+VAV    G+  P+IR AD+K +  IS EVK+LAQ+A+   LKPE+Y+GGT ++S
Sbjct: 395 HNVNINVAVQTDNGLFVPVIRDADKKGLSTISNEVKKLAQKARDNTLKPEDYEGGTFTVS 454

Query: 345 NMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQN--EEIKVATIMNATLSADHRSVDG 401
           N+G   GI  FCA+INPPQS ILA+G+ EK+V+  +  +E K A+ M+ TLS DHR +DG
Sbjct: 455 NLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGSGAQEFKFASFMSVTLSCDHRVIDG 514

Query: 402 AIASKLLAKFKEYIENPVWMLM 423
           AI +  L  FK YIENP  ML+
Sbjct: 515 AIGADWLKAFKGYIENPESMLL 536


>gi|11994364|dbj|BAB02323.1| dihydrolipoamide acetyltransferase [Arabidopsis thaliana]
          Length = 546

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 184/440 (41%), Positives = 269/440 (61%), Gaps = 36/440 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +A+W+K+EGDK++PG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 121 IGMPSLSPTMTEGNIARWLKKEGDKVAPGEVLCEVETDKATVEMECMEEGFLAKIVKEEG 180

Query: 66  TENIAVNSPILNILMDSTEI------PPSP-------------PLSKENIVEVREEHSHS 106
            + I V   I   + D  +I       PS               L KE  VE       +
Sbjct: 181 AKEIQVGEVIAITVEDEDDIQKFKDYTPSSDTGPAAPEAKPAPSLPKEEKVEKPASAPEA 240

Query: 107 SPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKD 166
                    S++R  ASPLAR+LA ++ + LSS+ G+GP GRIVK+D+E  +++ +    
Sbjct: 241 KISKPSSAPSEDRIFASPLARKLAEDNNVPLSSIKGTGPEGRIVKADVEDFLASGSK--- 297

Query: 167 YSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
               ++     + +D+ +  L     Y  IPH  IRK  A RL  SKQTIPH+Y+++D  
Sbjct: 298 ----ETTAKPSKQVDSKVPAL----DYVDIPHTQIRKVTASRLAFSKQTIPHYYLTVDTC 349

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           +D ++ LR Q+N    F       +ISVND+++KA ALA+ +VP+ N SWT   + + K+
Sbjct: 350 VDKMMGLRSQLN---SFQEASGGKRISVNDLVIKAAALALRKVPQCNSSWTDEYIRQFKN 406

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
           ++I+VAV    G+  P+++ AD+K +  I  EV+ LAQ+AK+  LKPE+Y+GGT ++SN+
Sbjct: 407 VNINVAVQTENGLYVPVVKDADKKGLSTIGEEVRFLAQKAKENSLKPEDYEGGTFTVSNL 466

Query: 347 GM-LGINSFCAVINPPQSTILAIGAGEKKVVFQN--EEIKVATIMNATLSADHRSVDGAI 403
           G   GI  FCAVINPPQ+ ILAIG+ EK+VV     ++  VA+ M+ TLS DHR +DGAI
Sbjct: 467 GGPFGIKQFCAVINPPQAAILAIGSAEKRVVPGTGPDQYNVASYMSVTLSCDHRVIDGAI 526

Query: 404 ASKLLAKFKEYIENPVWMLM 423
            ++ L  FK YIE P  ML+
Sbjct: 527 GAEWLKAFKGYIETPESMLL 546


>gi|73666694|ref|YP_302710.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Ehrlichia
           canis str. Jake]
 gi|72393835|gb|AAZ68112.1| Dihydrolipoamide acetyltransferase, long form [Ehrlichia canis str.
           Jake]
          Length = 403

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 180/428 (42%), Positives = 267/428 (62%), Gaps = 39/428 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDE-GIIDEILVPA 64
           I MP+LSPTM  G + KW K EGD I  GDI+ +IETDKA+MEFE  DE GII +I    
Sbjct: 5   ILMPALSPTMKNGTIRKWYKSEGDIIKSGDIIADIETDKAVMEFEYTDEDGIIGKIFFAE 64

Query: 65  GTENIAVNSPILNILMDSTEIPPSPPLSKE--------NIVEVREEH-SHSSPVVVREKH 115
           G+++IAVN  I  I +D  ++       K         N ++V ++  S +  V+V + +
Sbjct: 65  GSKDIAVNQLIALIAVDEHDLVNVQSYKKRDDVSQNNSNALQVNQQVVSSNEEVLVNQSN 124

Query: 116 SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGL 175
              R   SPLA+++A +  +D++ + G+GP+GRI+K+D+    S K   K++ +      
Sbjct: 125 VSERIKISPLAKKIAADLCVDINLIKGTGPYGRIIKADVLDAASQK---KEHVSSSPMSF 181

Query: 176 VDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLRE 235
            + S                    ++R+ IA RL  SKQ+IPHFYVSIDC +D+LL LR 
Sbjct: 182 TEIS--------------------SMRRVIAERLVYSKQSIPHFYVSIDCIVDDLLKLR- 220

Query: 236 QMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSI 295
                L+ + E    K++VND I+KA A+++ + PE NVSW+ + ++   ++DISVAVSI
Sbjct: 221 -----LEINAENSDTKVTVNDFIIKAVAMSIKKFPEINVSWSDDKIVVFHNVDISVAVSI 275

Query: 296 PGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFC 355
             G++TPII  AD+KS+L+IS EVK LA +AK  KL+ EE+QGG  +ISN+GM GI  FC
Sbjct: 276 DSGLITPIIFNADKKSLLEISSEVKTLASKAKSGKLRSEEFQGGGFTISNLGMFGIKEFC 335

Query: 356 AVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYI 415
           A++NPPQS I+A+G  EK+ +  +++I ++ ++  TLS DHR +DG +A+K L+ FK Y+
Sbjct: 336 AIVNPPQSCIMAVGCSEKRAIVVDDQISISNVITITLSVDHRVIDGVLAAKFLSCFKSYL 395

Query: 416 ENPVWMLM 423
           E P  ML+
Sbjct: 396 EKPFLMLI 403


>gi|148550591|ref|YP_001260030.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Sphingomonas wittichii RW1]
 gi|148503010|gb|ABQ71263.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Sphingomonas wittichii RW1]
          Length = 420

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 192/428 (44%), Positives = 266/428 (62%), Gaps = 24/428 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM EG LAKW+ +EGD +  GD+L EIETDKA MEFE+VDEGII +IL+P G
Sbjct: 5   LKMPALSPTMEEGSLAKWLVKEGDVVKSGDLLAEIETDKATMEFEAVDEGIIAKILIPEG 64

Query: 66  TENIAVNSPILNILMDSTEIP-----------PSPPLSKENIVEVREEHSHSSPVVVREK 114
           TE + V + +  +  +  +I            P+P ++ +    +      +S       
Sbjct: 65  TEGVKVGTVVAMLAAEGEDITAIGEGAVPALLPAPEIADKVATSIPAAVPVASSAAPAIG 124

Query: 115 HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFG 174
            S+ +  ASPLARRLA    IDLS++ GSGP+GRIVK DI+                +F 
Sbjct: 125 ASRIK--ASPLARRLAEASAIDLSTIRGSGPNGRIVKVDIDGATPASMPAVAPGVPAAFA 182

Query: 175 LVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLR 234
               SI+ +I        +EV+   N+RK IA RL +SKQ +PH Y++ D ++D LL LR
Sbjct: 183 AAVPSIEPDI-------PHEVVKLSNMRKVIARRLTESKQQVPHIYLTADIHLDPLLKLR 235

Query: 235 EQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVS 294
             +N  L     E   K+SVND+++KA A A+I+VP  NV +  + ++R   +DISVAVS
Sbjct: 236 ADLNDGLA----ERGVKLSVNDLLVKALAAALIEVPSCNVQFAGDNLLRFSRVDISVAVS 291

Query: 295 IPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSF 354
           IPGG++TPII  A+ K +  IS E+K  A+RA+  KL+P EYQGGT S+SNMGM GI  F
Sbjct: 292 IPGGLITPIIAGANAKGVAAISSEMKDRAERARNGKLQPHEYQGGTASLSNMGMFGIKQF 351

Query: 355 CAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEY 414
            AVINPPQ+ I+AIGAGEK+    N  + VAT+M+ T S DHR++DGA  ++L+A FK  
Sbjct: 352 EAVINPPQAMIMAIGAGEKRPYVVNNALTVATVMSVTGSFDHRAIDGADGAQLMAAFKRI 411

Query: 415 IENPVWML 422
           +E P+ +L
Sbjct: 412 VEKPLTLL 419


>gi|115471693|ref|NP_001059445.1| Os07g0410100 [Oryza sativa Japonica Group]
 gi|33354212|dbj|BAC81178.1| unknown protein [Oryza sativa Japonica Group]
 gi|50510197|dbj|BAD31326.1| unknown protein [Oryza sativa Japonica Group]
 gi|113610981|dbj|BAF21359.1| Os07g0410100 [Oryza sativa Japonica Group]
 gi|215678515|dbj|BAG92170.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 541

 Score =  337 bits (865), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 187/443 (42%), Positives = 272/443 (61%), Gaps = 47/443 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +A+W+K+EGDK+SPG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 121 IGMPSLSPTMTEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIIHGDG 180

Query: 66  TENIAVNSPILNILMDSTEI-------------PPSPPLSK------ENIVEVREEHSHS 106
           ++ I V   I   + +  +I             P +P   K      E  VE RE    S
Sbjct: 181 SKEIKVGEIIAVTVEEEGDIKKFKDYKPSTLAAPVAPSELKAQSEPTEPKVEEREPSKAS 240

Query: 107 ---SPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
              +P       S +R  +SPLAR+LA ++ + LSS+ G+GP GRI+K+DIE  ++    
Sbjct: 241 ELKAPRTEEPSRSGDRIFSSPLARKLAEDNNVPLSSVKGTGPDGRILKADIEDYLAK--- 297

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
                     G   E++ A  L      SY  +P+  IRK  A RL  SKQTIPH+Y+++
Sbjct: 298 ----------GCRKEALAAPGL------SYTDVPNAQIRKVTANRLLSSKQTIPHYYLTV 341

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           D  +DNL+ LR ++N            KIS+ND+++KA ALA+ +VP+ N SW  + + +
Sbjct: 342 DTRVDNLIKLRGELN---PLQESSGGKKISINDLVIKAAALALRKVPQCNSSWMNDFIRQ 398

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
           + +++I+VAV    G+  P+IR AD+K +  I+ EVKQLAQRA+   LKP++Y+GGT +I
Sbjct: 399 YHNVNINVAVQTEHGLFVPVIRDADKKGLGMIAEEVKQLAQRARDNSLKPDDYEGGTFTI 458

Query: 344 SNMGM-LGINSFCAVINPPQSTILAIGAGEKKVV--FQNEEIKVATIMNATLSADHRSVD 400
           SN+G   GI  FCA+INPPQS ILAIG+ E++V+    N + +  + M+AT+S DHR +D
Sbjct: 459 SNLGGPFGIKQFCAIINPPQSAILAIGSAERRVIPGSANGQYEFGSFMSATMSCDHRVID 518

Query: 401 GAIASKLLAKFKEYIENPVWMLM 423
           GAI ++ L  FK YIENP  ML+
Sbjct: 519 GAIGAEFLKAFKGYIENPTSMLL 541


>gi|297829956|ref|XP_002882860.1| hypothetical protein ARALYDRAFT_478800 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297328700|gb|EFH59119.1| hypothetical protein ARALYDRAFT_478800 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 539

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 184/440 (41%), Positives = 270/440 (61%), Gaps = 36/440 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +A+W+K+EGDK++PG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 114 IGMPSLSPTMTEGNIARWLKKEGDKVAPGEVLCEVETDKATVEMECMEEGFLAKIVKEEG 173

Query: 66  TENIAVNSPILNILMDSTEI------PPSPPLSKENIV---------EVREEHSHSSPVV 110
            + I V   I   + D  +I       PS                  E + E   S+P  
Sbjct: 174 AKEIQVGEVIAITVEDEEDIQKFKDYTPSSGTGPAAPEAKPAPSPPKEEKVEKPASAPEA 233

Query: 111 VREKHS----KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKD 166
              K S    ++R  ASPLAR+LA ++ + LSS+ G+GP GRIVK+D+E  +++ +    
Sbjct: 234 KISKPSSAPSEDRIFASPLARKLAEDNNVPLSSIKGTGPEGRIVKADVEDFLASGSK--- 290

Query: 167 YSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
               ++     + +D+ +  L     Y  IPH  IRK  A RL  SKQTIPH+Y+++D  
Sbjct: 291 ----ETTARPSKQVDSKVPAL----DYVDIPHTQIRKVTASRLAFSKQTIPHYYLTVDTC 342

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           +D ++ LR Q+N    F       +ISVND+++KA ALA+ +VP+ N SWT   + + K+
Sbjct: 343 VDKMMGLRSQLN---SFQEASGGKRISVNDLVIKAAALALRKVPQCNSSWTDEYIRQFKN 399

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
           ++I+VAV    G+  P+++ AD+K +  I  EV+ LAQ+AK+  LKPE+Y+GGT ++SN+
Sbjct: 400 VNINVAVQTENGLYVPVVKDADKKGLSAIGEEVRFLAQKAKENSLKPEDYEGGTFTVSNL 459

Query: 347 GM-LGINSFCAVINPPQSTILAIGAGEKKVV--FQNEEIKVATIMNATLSADHRSVDGAI 403
           G   GI  FCAVINPPQ+ ILAIG+ EK+VV     ++  VA+ M+ TLS DHR +DGAI
Sbjct: 460 GGPFGIKQFCAVINPPQAAILAIGSAEKRVVPGAGPDQYNVASYMSVTLSCDHRVIDGAI 519

Query: 404 ASKLLAKFKEYIENPVWMLM 423
            ++ L  FK YIE P  ML+
Sbjct: 520 GAEWLKAFKGYIETPESMLL 539


>gi|88657701|ref|YP_506926.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Ehrlichia
           chaffeensis str. Arkansas]
 gi|88599158|gb|ABD44627.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Ehrlichia chaffeensis str. Arkansas]
          Length = 416

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 181/440 (41%), Positives = 268/440 (60%), Gaps = 50/440 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDE-GIIDEILVPA 64
           + MP+LSPTM  G + KW K EGD +  GD++ +IETDKA+ME E  DE GI+ +I    
Sbjct: 5   VLMPALSPTMKSGTIRKWYKAEGDVVKSGDVIADIETDKAVMECEYTDEDGIMGKIFFAE 64

Query: 65  GTENIAVNSPILNILMDSTEIPP--------------------SPPLSKENIV-EVREEH 103
           G++NI VN  I  I +D  ++                      S P   E++V ++ ++ 
Sbjct: 65  GSKNIEVNQLIALIAVDEQDLAKVHSYEKGDNVVKNELVALQDSQPAQDESVVLQMNQQI 124

Query: 104 SHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
            ++S V+V   +S  R   SPLA+++A   G+D++ + G+GP+GRI+K+DI  +I+   +
Sbjct: 125 VNASEVLVNSSNSSERVKVSPLAKKIASNLGVDVNLVKGTGPYGRIIKADILDVINQHGH 184

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
           + +     SF  +                       ++R+ IA RL  SKQTIPHFYVSI
Sbjct: 185 IANSPEDASFTEIS----------------------SMRRVIAERLVYSKQTIPHFYVSI 222

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           DC +D+LL LR      L+ + E    K++VND I+KA A+++ + PE NVSW+ + ++ 
Sbjct: 223 DCLVDSLLKLR------LEINAENPDTKVTVNDFIIKAVAMSIKKFPEINVSWSDDKIVV 276

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
              IDISVAVSI  G++TPII  AD+KS+L+IS EVK LA +AK  KLKPEE+QGG  ++
Sbjct: 277 FPSIDISVAVSIDNGLITPIIFGADKKSLLEISREVKALASKAKSGKLKPEEFQGGGFTV 336

Query: 344 SNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAI 403
           SN+GM GI  F A++NPPQS I+++G  EK+ +  NE+I ++ ++  TLS DHR +DG +
Sbjct: 337 SNLGMFGIKEFYAIVNPPQSCIMSVGCSEKRAMVVNEQICISNVVTVTLSVDHRVIDGVL 396

Query: 404 ASKLLAKFKEYIENPVWMLM 423
           A+K L  FK Y+E P  ML+
Sbjct: 397 AAKFLNCFKSYLEKPFLMLI 416


>gi|20260138|gb|AAM12967.1| dihydrolipoamide acetyltransferase [Arabidopsis thaliana]
          Length = 539

 Score =  336 bits (862), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 183/440 (41%), Positives = 268/440 (60%), Gaps = 36/440 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTM EG +A+W+K+EGDK++PG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 114 IGMPSLSPTMAEGNIARWLKKEGDKVAPGEVLCEVETDKATVEMECMEEGFLAKIVKEEG 173

Query: 66  TENIAVNSPILNILMDSTEI------PPSP-------------PLSKENIVEVREEHSHS 106
            + I V   I   + D  +I       PS               L KE  VE       +
Sbjct: 174 AKEIQVGEVIAITVEDEDDIQKFKDYTPSSDTGPAAPEAKPAPSLPKEEKVEKPASAPEA 233

Query: 107 SPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKD 166
                    S++R  ASPLAR+LA ++ + LSS+ G+GP GRIVK+D+E  +++ +    
Sbjct: 234 KISKPSSAPSEDRIFASPLARKLAEDNNVPLSSIKGTGPEGRIVKADVEDFLASGSK--- 290

Query: 167 YSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
               ++     + +D+ +  L     Y  IPH  IRK  A RL  SKQTIPH+Y+++D  
Sbjct: 291 ----ETTAKPSKQVDSKVPAL----DYVDIPHTQIRKVTASRLAFSKQTIPHYYLTVDTC 342

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           +D ++ LR Q+N    F       +ISVND+++KA ALA+ +VP+ N SWT   + + K+
Sbjct: 343 VDKMMGLRSQLN---SFQEASGGKRISVNDLVIKAAALALRKVPQCNSSWTDEYIRQFKN 399

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
           ++I+VAV    G+  P+++ AD+K +  I  EV+ LAQ+AK+  LKPE+Y+GGT ++SN+
Sbjct: 400 VNINVAVQTENGLYVPVVKDADKKGLSTIGEEVRFLAQKAKENSLKPEDYEGGTFTVSNL 459

Query: 347 GM-LGINSFCAVINPPQSTILAIGAGEKKVVFQN--EEIKVATIMNATLSADHRSVDGAI 403
           G   GI  FCAVINPPQ+ ILAIG+ EK+VV     ++  VA+ M+ TLS DHR +DGAI
Sbjct: 460 GGPFGIKQFCAVINPPQAAILAIGSAEKRVVPGTGPDQYNVASYMSVTLSCDHRVIDGAI 519

Query: 404 ASKLLAKFKEYIENPVWMLM 423
            ++ L  FK YIE P  ML+
Sbjct: 520 GAEWLKAFKGYIETPESMLL 539


>gi|242060978|ref|XP_002451778.1| hypothetical protein SORBIDRAFT_04g007700 [Sorghum bicolor]
 gi|241931609|gb|EES04754.1| hypothetical protein SORBIDRAFT_04g007700 [Sorghum bicolor]
          Length = 539

 Score =  336 bits (862), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 180/446 (40%), Positives = 267/446 (59%), Gaps = 53/446 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +AKW+K+EGDK+SPG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 119 IGMPSLSPTMTEGNIAKWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVQGDG 178

Query: 66  TENIAVNSPILNILMDSTEI-------------------------PPSPPLSKENIVEVR 100
            + I V   I   + +  +I                         P  P + ++ + +  
Sbjct: 179 AKEIKVGEVIAITVEEEGDIEKFKDYKPSSSAEPVAPAESKAQPEPSQPKVEEKKLTQAP 238

Query: 101 EEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST 160
           E  +   P +     S +R  ASPLAR+LA ++ + LSS+ G+GP GRI+K+DIE  ++ 
Sbjct: 239 EAKA---PKIEDASQSGDRIFASPLARKLAEDNNVPLSSVKGTGPDGRILKADIEDYLA- 294

Query: 161 KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
           K   ++       G +D                  IP+  IRK  A RL QSKQTIPH+Y
Sbjct: 295 KGGTREAFAAPGLGYID------------------IPNAQIRKVTANRLLQSKQTIPHYY 336

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           +++D  +D L+ LR ++N            KIS+ND+++KA ALA+ +VP+ N SW  + 
Sbjct: 337 LTVDARVDKLVKLRGELN---PLQDAAGGKKISINDLVIKAAALALRKVPQCNSSWMNDF 393

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           + ++ +++I+VAV    G+  P+IR AD+K +  I+ EVKQLAQ+A+   LKP +Y+GGT
Sbjct: 394 IRQYHNVNINVAVQTEHGLFVPVIRDADKKGLGTIAEEVKQLAQKARDNSLKPADYEGGT 453

Query: 341 TSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVV--FQNEEIKVATIMNATLSADHR 397
            ++SN+G   GI  FCA+INPPQS ILAIG+ EK+V+    + + +  + M+ATLS DHR
Sbjct: 454 FTVSNLGGPFGIKQFCAIINPPQSAILAIGSAEKRVIPGSADGQYEFGSFMSATLSCDHR 513

Query: 398 SVDGAIASKLLAKFKEYIENPVWMLM 423
            +DGAI ++ L  FK YIENP  ML+
Sbjct: 514 VIDGAIGAEFLKAFKGYIENPTSMLL 539


>gi|162147725|ref|YP_001602186.1| dihydrolipoamid acetyltransferase component of pyruvate
           dehydrogenase complex [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209542349|ref|YP_002274578.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786302|emb|CAP55884.1| Dihydrolipoamid acetyltransferase component of pyruvate
           dehydrogenase complex [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209530026|gb|ACI49963.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 424

 Score =  336 bits (861), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 184/432 (42%), Positives = 271/432 (62%), Gaps = 26/432 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTMTEGKL++W+K+EGD I  GD++ EIETDKA ME E+VD+G++  ILV  G
Sbjct: 5   ILMPALSPTMTEGKLSRWLKKEGDAIHSGDVIAEIETDKATMEVEAVDDGLLGRILVSEG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK-------- 117
           TE + VN+PI  ++ +   +P                 +  S        +         
Sbjct: 65  TEGVKVNAPIAIVVAEGESVPDDAAPVAAAPAAAPVAAAPVSEAKAPAIAAAPAVPQGAA 124

Query: 118 ------NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
                  R  ASPLARR+A + GIDLS + GSGP+GRIV+ D+E+  +T   V       
Sbjct: 125 PAPAQGTRVFASPLARRIAAQKGIDLSGVKGSGPNGRIVRRDVES--ATAAPVAAPVPSP 182

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
           +      +I+A          +  +P+  IRK IA RL ++K TIPHFYV++D  +D LL
Sbjct: 183 APSAPAAAIEA---------PHTAVPNSTIRKVIARRLTEAKSTIPHFYVAMDVELDALL 233

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISV 291
            LR ++N          + K+SVND+++KA A+ + +VP+ N S+T +A I +  +D+SV
Sbjct: 234 DLRAKLNAASPAEGPG-AFKLSVNDMLIKAVAVTLRRVPKVNASYTEDATILYDDVDVSV 292

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGI 351
           AVSI  G++TPI+RQAD+KS+ +IS + K L  RA+  KLKP+E+QGG+ SISNMGM G+
Sbjct: 293 AVSIADGLITPIVRQADRKSLREISEDAKDLITRARAGKLKPQEFQGGSFSISNMGMYGV 352

Query: 352 NSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKF 411
             F A+INPPQ+ ILAI A EK+ V +++ I++AT+M  TLS DHR VDGA+A++ ++ F
Sbjct: 353 KEFSAIINPPQAAILAIAAAEKRAVVKDDAIRIATVMTVTLSVDHRVVDGALAAEWVSTF 412

Query: 412 KEYIENPVWMLM 423
           +  +E+P+ +++
Sbjct: 413 RSVVESPLSLVV 424


>gi|73954765|ref|XP_862047.1| PREDICTED: similar to dihydrolipoamide S-acetyltransferase (E2
           component of pyruvate dehydrogenase complex) isoform 3
           [Canis familiaris]
          Length = 636

 Score =  336 bits (861), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 180/441 (40%), Positives = 274/441 (62%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +IL+P G
Sbjct: 210 VVLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILIPEG 269

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSH-------------------- 105
           T ++ + +P+  I+    +IP         + +++ +                       
Sbjct: 270 TRDVPLGTPLCIIVEKEEDIPAFADYRPTEVTDLKPQAPPSTPPPVAPVPPTPQPVTPTP 329

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R  ASPLA++LA E GIDL+ + G+GP GRI+K D+++ + TK    
Sbjct: 330 SAPRPATPAGPKGRLFASPLAKKLAAEKGIDLTQVKGTGPEGRIIKKDVDSFVPTKAAPA 389

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + + +       + + +        +  +P  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 390 PAAAVPAAVPGVAPVPSGV--------FTDVPISNIRRVIAQRLMQSKQTIPHYYLSIDV 441

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 442 NMGEVLLVRKELNKML-----EGRSKISVNDFIIKASALACLKVPEANSSWL-DTVIRQN 495

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 496 HVVDVSVAVSTPAGLITPIVFNAHIKGLEAIANDVVSLATKAREGKLQPHEFQGGTFTIS 555

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E ++V  + E    VA++M+ TLS DHR VDGA
Sbjct: 556 NLGMFGIKNFSAIINPPQACILAIGASEDRLVPADNEKGFDVASMMSVTLSCDHRVVDGA 615

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 616 VGAQWLAEFRKYLEKPITMLL 636



 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 51/75 (68%), Gaps = 1/75 (1%)

Query: 10  SLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENI 69
           SL P    G +A+W K+EG+KI+ G+++ E+ETDKA + FES++E  + +ILV  GT ++
Sbjct: 87  SLPPHQKAGTIARWEKKEGEKINEGELIAEVETDKATVGFESLEECYMAKILVAEGTRDV 146

Query: 70  AVNSPILNILMDSTE 84
            V + I+ I ++  E
Sbjct: 147 PVGA-IICITVEKPE 160


>gi|73954761|ref|XP_546524.2| PREDICTED: similar to dihydrolipoamide S-acetyltransferase (E2
           component of pyruvate dehydrogenase complex) isoform 1
           [Canis familiaris]
          Length = 647

 Score =  336 bits (861), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 180/441 (40%), Positives = 274/441 (62%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +IL+P G
Sbjct: 221 VVLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILIPEG 280

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSH-------------------- 105
           T ++ + +P+  I+    +IP         + +++ +                       
Sbjct: 281 TRDVPLGTPLCIIVEKEEDIPAFADYRPTEVTDLKPQAPPSTPPPVAPVPPTPQPVTPTP 340

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R  ASPLA++LA E GIDL+ + G+GP GRI+K D+++ + TK    
Sbjct: 341 SAPRPATPAGPKGRLFASPLAKKLAAEKGIDLTQVKGTGPEGRIIKKDVDSFVPTKAAPA 400

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + + +       + + +        +  +P  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 401 PAAAVPAAVPGVAPVPSGV--------FTDVPISNIRRVIAQRLMQSKQTIPHYYLSIDV 452

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 453 NMGEVLLVRKELNKML-----EGRSKISVNDFIIKASALACLKVPEANSSWL-DTVIRQN 506

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 507 HVVDVSVAVSTPAGLITPIVFNAHIKGLEAIANDVVSLATKAREGKLQPHEFQGGTFTIS 566

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E ++V  + E    VA++M+ TLS DHR VDGA
Sbjct: 567 NLGMFGIKNFSAIINPPQACILAIGASEDRLVPADNEKGFDVASMMSVTLSCDHRVVDGA 626

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 627 VGAQWLAEFRKYLEKPITMLL 647



 Score = 73.6 bits (179), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 57/81 (70%), Gaps = 1/81 (1%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
             + +PSLSPTM  G +A+W K+EG+KI+ G+++ E+ETDKA + FES++E  + +ILV 
Sbjct: 92  QKVPLPSLSPTMQAGTIARWEKKEGEKINEGELIAEVETDKATVGFESLEECYMAKILVA 151

Query: 64  AGTENIAVNSPILNILMDSTE 84
            GT ++ V + I+ I ++  E
Sbjct: 152 EGTRDVPVGA-IICITVEKPE 171


>gi|115465912|ref|NP_001056555.1| Os06g0105400 [Oryza sativa Japonica Group]
 gi|55295833|dbj|BAD67701.1| putative dihydrolipoamide S-acetyltransferase [Oryza sativa
           Japonica Group]
 gi|113594595|dbj|BAF18469.1| Os06g0105400 [Oryza sativa Japonica Group]
          Length = 550

 Score =  336 bits (861), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 182/443 (41%), Positives = 271/443 (61%), Gaps = 46/443 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +A+W+K+EGDK+SPG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 129 IGMPSLSPTMTEGNIARWVKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIIHGDG 188

Query: 66  TENIAVNSPILNILMDSTEIPP----SPPLSKENIV--EVREEHSHSSPVVVREKH---- 115
            + I V   I   + +  +I        P S E+    E + +   + P   +E+     
Sbjct: 189 AKEIKVGEIIAVTVEEEEDIGKFKDYKAPSSAESAAPAESKPQSEPTEPKKEKEQPKAPE 248

Query: 116 -----------SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST--KT 162
                      S++R  +SP+AR+LA ++ + LSS+ G+GP GRI+K+DIE  +++  K 
Sbjct: 249 PKATKTEESFLSEDRTFSSPIARKLAEDNNVPLSSIKGTGPDGRILKADIEDYLASVAKG 308

Query: 163 NVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVS 222
             K+ +     G VD                  +P+  IRK  A RL  SKQTIPH+Y++
Sbjct: 309 AKKETAAAPGLGYVD------------------LPNTQIRKVTANRLLHSKQTIPHYYLT 350

Query: 223 IDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMI 282
           +D  +D L+ LR ++N            KIS+ND+++KA ALA+  VPE N SW  + + 
Sbjct: 351 VDTRVDKLIKLRSELN---PLQDTSGGKKISINDLVIKAAALALRNVPECNSSWMNDFIR 407

Query: 283 RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTS 342
           ++ +++I+VAV    G+  P+IR AD+K +  I+ EVKQLAQRA+   LKPE+Y+GGT +
Sbjct: 408 QYHNVNINVAVQTEDGLFVPVIRDADKKGLATIADEVKQLAQRARDNSLKPEDYEGGTFT 467

Query: 343 ISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQNE-EIKVATIMNATLSADHRSVD 400
           +SN+G   GI  FCA++NPPQS ILAIG+ EK+V+   E + +V + M+ATLS DHR +D
Sbjct: 468 VSNLGGPFGIKQFCAIVNPPQSAILAIGSAEKRVIPGAEGQFEVGSFMSATLSCDHRVID 527

Query: 401 GAIASKLLAKFKEYIENPVWMLM 423
           GAI ++ +  FK YIENP  ML+
Sbjct: 528 GAIGAEWMKAFKGYIENPTTMLL 550


>gi|114798189|ref|YP_760675.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoyllysine-residue acetyltransferase
           [Hyphomonas neptunium ATCC 15444]
 gi|114738363|gb|ABI76488.1| pyruvate dehydrogenase complex , E2 component,
           dihydrolipoyllysine-residue acetyltransferase
           [Hyphomonas neptunium ATCC 15444]
          Length = 443

 Score =  335 bits (860), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 192/451 (42%), Positives = 274/451 (60%), Gaps = 37/451 (8%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   ITMP+LSPTM EG LAKW+ +EGD +  GDI+ EIETDKA ME E+VDEG + +I+
Sbjct: 1   MAINITMPALSPTMEEGTLAKWLVKEGDTVKSGDIIAEIETDKATMEVEAVDEGTVAKIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSP------------- 108
           V  G+E + VN+ ++ +L +  E   S      +    +EE    +P             
Sbjct: 61  VAEGSEGVKVNA-VIAVLAEDGEDASSVKTPSADAAPKKEEKKEDAPKAGEKKPDEKKPE 119

Query: 109 -------------VVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE 155
                            +     R  ASPLA+R+A   GIDL +L GSGPHGRI+K D+E
Sbjct: 120 PKKEEAKPEPAKAAAPAKSDDGARLKASPLAKRIAANKGIDLKALKGSGPHGRIIKRDVE 179

Query: 156 TLISTKTNVKDYSTIQSFGLVDESIDANILN--LFAKDSYEVIPHDNIRKTIACRLQQSK 213
           +  +        +   +    D  I   IL+  ++A D+YE+ P D +RKT+A RL QS 
Sbjct: 180 S--AKPGAQAATAGAAAPASPDGLILPQILDDRVYAPDTYELKPLDGMRKTVARRLTQSF 237

Query: 214 QTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEAN 273
             +PHF ++ID  +DNLL+ R  +N      RE +  K+SVND+++KA ALA++  P+ N
Sbjct: 238 MQVPHFPLNIDITLDNLLTSRASINNA---AREGV--KVSVNDLLIKAAALALMDEPDCN 292

Query: 274 VSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKP 333
            S+T   +  HKH ++SVAV++ GG++TP+I +A+ K + +IS E+K LA RA++RKLKP
Sbjct: 293 ASFTDKGIAYHKHANVSVAVAVEGGLITPVIFKAETKGLAEISEEMKDLAARARERKLKP 352

Query: 334 EEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATL 392
           +EY GGT SISN+GM GI SF ++INPP+  IL++GAGEK+ VV +   + V TIM+ TL
Sbjct: 353 QEYMGGTFSISNLGMFGIKSFASIINPPEGMILSVGAGEKRAVVDEKGNVAVRTIMSVTL 412

Query: 393 SADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           + DHR + GA  +K L  FK Y+E P  ML+
Sbjct: 413 TCDHRVIGGAEGAKWLTAFKRYVETPEAMLL 443


>gi|86138766|ref|ZP_01057338.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Roseobacter sp.
           MED193]
 gi|85824413|gb|EAQ44616.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Roseobacter sp.
           MED193]
          Length = 421

 Score =  335 bits (860), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 173/424 (40%), Positives = 259/424 (61%), Gaps = 20/424 (4%)

Query: 15  MTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSP 74
           M EG LAKW+ +EGD I  GD++ EIETDKA MEFE+VDEG++ +IL+  G+E + VN+ 
Sbjct: 1   MEEGTLAKWLVKEGDTIQSGDLIAEIETDKATMEFEAVDEGVVGKILIAEGSEGVKVNTA 60

Query: 75  ILNILMDSTEIPP-----------SPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIAS 123
           I  +L D   +             +       +       + +           +R  AS
Sbjct: 61  IAVLLEDGESVDDIGASAAPAAPAAAAAEVAPLAAETAAPAATPAPAPPAAADGSRIFAS 120

Query: 124 PLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA- 182
           PLARR+A + G+DL  ++GSGP GRIVK+D+E+  +        +   +      +    
Sbjct: 121 PLARRIAADKGLDLGGITGSGPRGRIVKADVESATAAPKAAAAPAAASAPAAAAPAPAGP 180

Query: 183 ---NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
               +  ++   +YE +  D +RKTIA RL ++KQT+PHFY+  D  +D LL  R Q+N+
Sbjct: 181 SSDQVARMYEGRAYEEVTLDGMRKTIAARLTEAKQTVPHFYLRRDIQLDALLKFRSQLNK 240

Query: 240 TLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGI 299
            L+        K+SVND I+KA ALA+  VP+AN  W  + +++ K  D++VAV+I GG+
Sbjct: 241 QLEGR----GVKLSVNDFIIKAVALALQAVPDANAVWAGDRVLKMKASDVAVAVAIEGGL 296

Query: 300 VTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVIN 359
            TP+++ ++ KS+  +S E+K LA RA+ RKL P EYQGG+ +ISN+GM GI++F A++N
Sbjct: 297 FTPVLQDSELKSLSALSGEMKDLASRARDRKLAPHEYQGGSFAISNLGMFGIDNFDAIVN 356

Query: 360 PPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENP 418
           PP + ILA+GAG KK VV  + E+KVAT+M+ T+S DHR +DGA+ ++LL    E +ENP
Sbjct: 357 PPHAGILAVGAGAKKPVVGADGELKVATVMSVTMSVDHRVIDGALGAQLLQAIVENLENP 416

Query: 419 VWML 422
           + ML
Sbjct: 417 MVML 420


>gi|326387771|ref|ZP_08209377.1| dihydrolipoamide acetyltransferase, long form [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326207817|gb|EGD58628.1| dihydrolipoamide acetyltransferase, long form [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 425

 Score =  335 bits (859), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 182/441 (41%), Positives = 260/441 (58%), Gaps = 43/441 (9%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            I MP+LSPTM EGKLAKW+ + GD +S GDIL EIETDKA MEFE+VDEG+I  I V  
Sbjct: 4   AIKMPALSPTMEEGKLAKWLVKAGDTVSSGDILAEIETDKATMEFEAVDEGVIVSIDVAE 63

Query: 65  GTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK------N 118
           GTE + V + I  +  +  +  P+P  +           +  +                +
Sbjct: 64  GTEGVKVGTVIATLAGEDEDATPAPAAAPAPAATAAPVAAPVAAAPAAAPAVSFAAAKGD 123

Query: 119 RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE-----------------TLISTK 161
           R +ASPLA+R+A + G+DL ++ GSGP+GRIV++D+E                       
Sbjct: 124 RVVASPLAKRIAADRGVDLKAVKGSGPNGRIVRADVEGVPTAPAAAPVSAPAPVAAPVQA 183

Query: 162 TNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYV 221
                  T+  FG+                 +E    +N+RKTIA RL ++KQTIPH Y+
Sbjct: 184 AAPVVAPTVPDFGI----------------PFEASKLNNVRKTIARRLTEAKQTIPHIYL 227

Query: 222 SIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAM 281
           ++D  +D LL LR Q+N+ L+        K+SVND+++KA A A++QVP+ NVS+  + +
Sbjct: 228 TVDVRLDALLKLRGQLNKALEAQ----GVKLSVNDLLIKALAKALVQVPKCNVSFAGDEL 283

Query: 282 IRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTT 341
              K +D+SVAV+ P G++TPII  A  KSI  I+ E+K LA +A+  KL+P EYQGGT 
Sbjct: 284 RSFKRVDVSVAVAAPSGLITPIIVDAGAKSISTIASEMKALASKARDGKLQPHEYQGGTA 343

Query: 342 SISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDG 401
           S+SN+GM GI  F AVINPPQ  ILA+G GE++    +  + VAT+M AT S DHR++DG
Sbjct: 344 SLSNLGMFGIKQFDAVINPPQGMILAVGTGEQRPWIVDGALSVATVMTATGSFDHRAIDG 403

Query: 402 AIASKLLAKFKEYIENPVWML 422
           A  ++LL  FK  +E+P+ ++
Sbjct: 404 ADGAELLQAFKALVEDPLALI 424


>gi|224070718|ref|XP_002303212.1| predicted protein [Populus trichocarpa]
 gi|222840644|gb|EEE78191.1| predicted protein [Populus trichocarpa]
          Length = 512

 Score =  335 bits (858), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 193/454 (42%), Positives = 271/454 (59%), Gaps = 58/454 (12%)

Query: 6   ITMPSLSPTMTE---GKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           I MPSLSPTMTE   G +A+W+K+EGDKIS G++LCE+ETDKA +E E ++EG + +IL 
Sbjct: 81  IGMPSLSPTMTEACLGNIARWLKKEGDKISTGEVLCEVETDKATVEMECMEEGYLAKILK 140

Query: 63  PAGTENIAVNSPILNILMDSTEIP----------------------PSPPLSKENIVEVR 100
             G + I +   I   + D  +I                       P+PP S +   EV 
Sbjct: 141 GDGAKEIKLGEVIAITVEDEEDIAKFKDYNPSASGSGATSANEASAPTPPASHKE--EVE 198

Query: 101 EEHSHSSPVVVREKHS--KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI 158
           +  S   P + +   +   +R  ASPLAR+LA +H + LSS+ G+GP G IVK+DIE   
Sbjct: 199 KPASLPEPKISKPSAAPDGDRTFASPLARKLAEDHNVPLSSIKGTGPDGNIVKADIE--- 255

Query: 159 STKTNVKDYSTIQSFGLVDESIDANILNLFAKDS------YEVIPHDNIRKTIACRLQQS 212
                  DY       L     +A      AKD+      Y  IPH  IRK  A RL  S
Sbjct: 256 -------DY-------LASRGKEAPATKPVAKDTSAPALDYVDIPHSQIRKVTASRLLLS 301

Query: 213 KQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEA 272
           KQTIPH+Y+++D  +D L+ LR Q+N            +ISVND+++KA ALA+ +VP+ 
Sbjct: 302 KQTIPHYYLTVDTCVDKLMGLRSQLNL---IQETSGGKRISVNDLVIKAAALALRKVPQC 358

Query: 273 NVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLK 332
           N SWT + + ++ +++I+VAV    G+  P+IR AD+K +  I+ EVK LAQ+AK+  LK
Sbjct: 359 NSSWTDSYIRQYNNVNINVAVQTDNGLYVPVIRDADKKGLSKIADEVKNLAQKAKENSLK 418

Query: 333 PEEYQGGTTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQN--EEIKVATIMN 389
           PE+Y+GGT ++SN+G   GI  FCA+INPPQS ILAIG+ EK+V+  +  ++ K A+ M+
Sbjct: 419 PEDYEGGTFTVSNLGGPFGIKQFCAIINPPQSGILAIGSAEKRVIPGSGPDDFKFASFMS 478

Query: 390 ATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            TLS DHR +DGAI ++ L  FK YIENP  ML+
Sbjct: 479 VTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 512


>gi|126739340|ref|ZP_01755033.1| branched-chain alpha-keto acid dehydrogenase E2 subunit
           [Roseobacter sp. SK209-2-6]
 gi|126719440|gb|EBA16149.1| branched-chain alpha-keto acid dehydrogenase E2 subunit
           [Roseobacter sp. SK209-2-6]
          Length = 425

 Score =  335 bits (858), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 177/429 (41%), Positives = 259/429 (60%), Gaps = 26/429 (6%)

Query: 15  MTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSP 74
           M EG LAKW+ +EGD IS GD++ EIETDKA MEFE+VDEG++ +IL+  G+E + VN+ 
Sbjct: 1   MEEGTLAKWLVKEGDIISSGDLIAEIETDKATMEFEAVDEGVVGKILIAEGSEGVKVNTA 60

Query: 75  ILNILMDSTE--------------IPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           I  +L++  E                 +             + + +            R 
Sbjct: 61  I-AVLLEEGESADDIAASAPAAPAAAAAEGAPVAAEKAAAPDPAAAPAPAAPTGADGTRI 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
            ASPLARR+A + G+DL++L+GSGP GRIVK+D+E   +            +        
Sbjct: 120 FASPLARRIAADKGLDLAALTGSGPRGRIVKADVENATAAPQPAAAPVAAATPASAPAVA 179

Query: 181 DAN------ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLR 234
             +      +  ++    +E +  D +RKTIA RL ++KQTIPHFY+  D  +D LL  R
Sbjct: 180 APSGPSADMVAKMYEGREFEEVSLDGMRKTIAARLSEAKQTIPHFYLRRDIQLDALLKFR 239

Query: 235 EQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVS 294
            Q+N+ L+        K+SVND I+KA A A+ QVPEAN  W  + +++ K  D++VAV+
Sbjct: 240 SQLNKQLEGR----GVKLSVNDFIIKAVANALQQVPEANAVWAGDRVLQMKASDVAVAVA 295

Query: 295 IPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSF 354
           I GG+ TP+++ AD KS+  +S ++K LA RA+ RKL P EYQGG+ +ISN+GM GI++F
Sbjct: 296 IEGGLFTPVLQDADMKSLSALSAQMKDLASRARDRKLAPHEYQGGSFAISNLGMFGIDNF 355

Query: 355 CAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKE 413
            A++NPP + ILA+GAG KK VV ++ E+KVAT+M+ T+S DHR +DGA+ + LL    +
Sbjct: 356 DAIVNPPHAGILAVGAGTKKPVVGEDGELKVATVMSVTMSVDHRVIDGAVGANLLKAIVD 415

Query: 414 YIENPVWML 422
            +ENPV ML
Sbjct: 416 NLENPVAML 424


>gi|297690200|ref|XP_002822510.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component
           of pyruvate dehydrogenase complex, mitochondrial-like
           isoform 1 [Pongo abelii]
          Length = 647

 Score =  334 bits (857), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 183/441 (41%), Positives = 272/441 (61%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 221 VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 280

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH--------------------SH 105
           T ++ + +P+  I+    +I          + +++ +                     + 
Sbjct: 281 TRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQAPPPTPPPVAAVPPTPQPLAPTP 340

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R   SPLA++LA E GIDL+ + G+GP GRI K DI++ + +K    
Sbjct: 341 SAPCPATPAGPKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPA 400

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +   G     + A +        +  IP  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 401 PAAVVPPTGPGMAPVPAGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDV 452

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 453 NMGEVLLVRKELNKIL-----EGRSKISVNDFIIKASALACLKVPEANSSWM-DTVIRQN 506

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 507 HVVDVSVAVSTPAGLITPIVFNAHIKGLETIANDVVSLATKAREGKLQPHEFQGGTFTIS 566

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E K+V  + E    VA++M+ TLS DHR VDGA
Sbjct: 567 NLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGA 626

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 627 VGAQWLAEFRKYLEKPITMLL 647



 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 51/70 (72%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
             + +PSLSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++E  + +ILV 
Sbjct: 92  QKVPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVA 151

Query: 64  AGTENIAVNS 73
            GT ++ + +
Sbjct: 152 EGTRDVPIGA 161


>gi|297690202|ref|XP_002822511.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component
           of pyruvate dehydrogenase complex, mitochondrial-like
           isoform 2 [Pongo abelii]
          Length = 591

 Score =  334 bits (856), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 183/441 (41%), Positives = 272/441 (61%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 165 VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 224

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH--------------------SH 105
           T ++ + +P+  I+    +I          + +++ +                     + 
Sbjct: 225 TRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQAPPPTPPPVAAVPPTPQPLAPTP 284

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R   SPLA++LA E GIDL+ + G+GP GRI K DI++ + +K    
Sbjct: 285 SAPCPATPAGPKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPA 344

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +   G     + A +        +  IP  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 345 PAAVVPPTGPGMAPVPAGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDV 396

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 397 NMGEVLLVRKELNKIL-----EGRSKISVNDFIIKASALACLKVPEANSSWM-DTVIRQN 450

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 451 HVVDVSVAVSTPAGLITPIVFNAHIKGLETIANDVVSLATKAREGKLQPHEFQGGTFTIS 510

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E K+V  + E    VA++M+ TLS DHR VDGA
Sbjct: 511 NLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGA 570

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 571 VGAQWLAEFRKYLEKPITMLL 591



 Score = 76.3 bits (186), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 52/70 (74%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
           + + +PSLSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++E  + +ILV 
Sbjct: 36  YRVPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVA 95

Query: 64  AGTENIAVNS 73
            GT ++ + +
Sbjct: 96  EGTRDVPIGA 105


>gi|54289581|gb|AAV32093.1| pyruvate dehydrogenase E2 subunit [Euplotes sp. BB-2004]
          Length = 459

 Score =  334 bits (856), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 185/444 (41%), Positives = 273/444 (61%), Gaps = 53/444 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MPSLSPTM +G LAKW K+ GD++ PGDIL E+ETDKA ++FE  ++G + ++LV  G
Sbjct: 43  LQMPSLSPTMEKGNLAKWCKKVGDQVEPGDILAEVETDKATVDFEMQEDGYVAKLLVEEG 102

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVRE------------------------ 101
            ++IA+   +   + D  ++        E+  E  +                        
Sbjct: 103 AQDIALGELVAISVEDEDDVAAFKDYKPESTSEASQAPVKEAAPSTPEPAQTTSSPAAPT 162

Query: 102 EHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTK 161
           + +  SP V R K S +R IASP AR+LA E GID+S+++G+GP GRIV +D++      
Sbjct: 163 QAATPSPAVTR-KASGDRVIASPFARKLASEGGIDISTIAGTGPGGRIVAADLDGA---- 217

Query: 162 TNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYV 221
                 S  Q+F          + +  A  +YE IP   +RK IA RL +SK+TIPH+YV
Sbjct: 218 -----SSAAQAF----------VSSAPASIAYEDIPVSQVRKVIAKRLSESKETIPHYYV 262

Query: 222 SIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAM 281
           ++D   D LL LR  +N     H E   +KISVND+I+KA +LA  +VP+ N SW  + +
Sbjct: 263 TVDAEADKLLKLRSMLNT----HSE---SKISVNDMIIKATSLASKKVPQTNSSWQGDFI 315

Query: 282 IRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTT 341
            ++ ++D+SVAVS P G++TPII++A+ K +  IS E+K LA RA++ KLK +E+QGGT 
Sbjct: 316 RQYSNVDVSVAVSTPTGLITPIIKEANLKGLETISAEMKDLAARARENKLKLDEFQGGTI 375

Query: 342 SISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSV 399
           S+SN+GM G++ F A+INPPQ+ ILAIG  +++V+  +EE   + A +++ TLS+DHR V
Sbjct: 376 SVSNLGMFGVSHFSAIINPPQACILAIGGSQQRVLPGDEEGKYRTANVISFTLSSDHRVV 435

Query: 400 DGAIASKLLAKFKEYIENPVWMLM 423
           DGA A+     FK+YIENP  ML+
Sbjct: 436 DGAEAAIWGQHFKKYIENPELMLL 459


>gi|126327034|ref|XP_001381327.1| PREDICTED: similar to dihydrolipoamide S-acetyltransferase (E2
           component of pyruvate dehydrogenase complex),
           [Monodelphis domestica]
          Length = 643

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 182/441 (41%), Positives = 272/441 (61%), Gaps = 35/441 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K++ GD+L EIETDKA + FE  +EG + +IL+P G
Sbjct: 215 VLLPALSPTMTMGTVQRWEKKVGEKLNEGDLLAEIETDKATIGFEVQEEGYLAKILIPEG 274

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSS--------------PVVV 111
           T ++ + +P+  I+    +IP      +  + +++ + + S+              P   
Sbjct: 275 TRDVPLGTPLCIIVEKEADIPAFADYRQTGVTDIKPQATPSTSPPIAAVPPTPLSTPTAP 334

Query: 112 REKH------SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
              H      +K R  ASPLA++LA E GIDL  + G+GP GRI K DIE+ + +K    
Sbjct: 335 SASHPAMPTGAKGRVFASPLAKKLAAEKGIDLKQVRGTGPDGRITKKDIESFVPSK---- 390

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             +T            A  +       +  IP  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 391 --ATPALPPTAAMPAPAPGVAAVPTGIFTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDV 448

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N  L        +KISVND I+KA A+A ++VPEAN SW  + +IR  
Sbjct: 449 NMGEVLEVRKELNTILAG-----GSKISVNDFIIKASAMACLKVPEANSSWM-DTVIRQN 502

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ DISVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 503 HVVDISVAVSTPSGLITPIVFNAHIKGLESIANDVVSLATKAREGKLQPHEFQGGTFTIS 562

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILA+GA E ++V  + E    VA++M+ TLS DHR VDGA
Sbjct: 563 NLGMFGIKNFSAIINPPQACILAVGASENRLVPADNEKGFDVASMMSVTLSCDHRVVDGA 622

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+FK+Y+E P+ M++
Sbjct: 623 VGAQWLAEFKKYLEKPITMIL 643



 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 52/68 (76%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +PSLSPTM  G +A+W K+EG+KI+ GD++ E+ETDKA + FES++E  + +I+VP G
Sbjct: 90  VPLPSLSPTMQAGTIARWEKKEGEKINEGDLIAEVETDKATVGFESLEECYLAKIIVPEG 149

Query: 66  TENIAVNS 73
           T ++ V +
Sbjct: 150 TRDVPVGA 157


>gi|225444857|ref|XP_002279314.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 553

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 188/446 (42%), Positives = 269/446 (60%), Gaps = 52/446 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +A+W+K+EGDKISPG++LCE+ETDKA +E E ++EG + +I++  G
Sbjct: 132 IGMPSLSPTMTEGNIARWLKKEGDKISPGEVLCEVETDKATVEMECMEEGYLAKIVLGDG 191

Query: 66  TENIAVNSPILNILMDSTEIP--------------------PSPPLSKENIVEVREEHSH 105
            + I V   I   + +  +I                      SPP  KE       E   
Sbjct: 192 AKEIKVGQVIAITVEEEDDIAKFKGYEAPKGGAADGGKKSSASPPPMKE-----VAEKPA 246

Query: 106 SSP-----VVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST 160
           SSP       V    + +R  +SPLA++LA +H + L S+ G+GP GRIVK+DIE     
Sbjct: 247 SSPQPNVSKAVESSKAGDRIFSSPLAKKLAEDHNVPLQSIKGTGPDGRIVKADIE----- 301

Query: 161 KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
                DY  + S+G    +  +    L     Y  +PH  IRK  A RL  SKQTIPH+Y
Sbjct: 302 -----DY--LASYGKEATTPFSEAATL----DYTDLPHTQIRKVTASRLLLSKQTIPHYY 350

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           +++D  +D L+ LR Q+N TLQ        +ISVND+++KA ALA+ +VP+ N SWT + 
Sbjct: 351 LTVDTCVDKLMELRSQLN-TLQ--EASGGKRISVNDLVIKAAALALRKVPQCNSSWTNDY 407

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           + ++ +++I+VAV    G+  P++R AD+K +  I+ E+K LAQ+AK   LK E+Y+GGT
Sbjct: 408 IRQYHNVNINVAVQTDNGLYVPVVRDADKKGLSKIAEEIKHLAQKAKDNSLKSEDYEGGT 467

Query: 341 TSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVV--FQNEEIKVATIMNATLSADHR 397
            ++SN+G   G+  FCA+INPPQS ILA+G+ EK+V+     ++ K A+ M  TLS DHR
Sbjct: 468 FTVSNLGGPFGVKQFCAIINPPQSGILAVGSAEKRVIPGVGPDQFKYASFMPVTLSCDHR 527

Query: 398 SVDGAIASKLLAKFKEYIENPVWMLM 423
            +DGAI ++ L  FK YIENP  ML+
Sbjct: 528 VIDGAIGAEWLKAFKGYIENPESMLL 553


>gi|162458262|ref|NP_001104936.1| dihydrolipoamide S-acetyltransferase [Zea mays]
 gi|5669871|gb|AAD46491.1|AF135014_1 dihydrolipoamide S-acetyltransferase [Zea mays]
          Length = 542

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 182/444 (40%), Positives = 269/444 (60%), Gaps = 46/444 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +AKW+K+EGDK+SPG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 119 IGMPSLSPTMTEGNIAKWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIIHGDG 178

Query: 66  TENIAVNSPILNILMDSTEI---------------PPSPPLSKENIVEVREEHSH----- 105
            + I V   I   + +  +I                P+ P ++    + + E        
Sbjct: 179 AKEIKVGEVIAITVEEEGDIEKLKDYKPSSSAEPVAPAEPKAEPEPSQPKAEEKKPTQAP 238

Query: 106 --SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
              +P +     S +R  ASPLAR+LA ++ + LSS+ G+GP GRI+K+DIE        
Sbjct: 239 EAKTPKIEEASQSGDRIFASPLARKLAEDNNVPLSSVKGTGPDGRILKADIE-------- 290

Query: 164 VKDY-STIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVS 222
             DY +++   GL +   D  +        Y  IP+  IRK  A RL  SKQTIPH+Y++
Sbjct: 291 --DYLASVAKGGLRESFADPGL-------GYVDIPNAQIRKVTANRLLASKQTIPHYYLT 341

Query: 223 IDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMI 282
           +D  +D L+ LR ++N            KIS+ND+++KA ALA+ +VP+ N SW  + + 
Sbjct: 342 VDARVDKLVQLRGELN---PLQDASGGKKISINDLVIKAAALALRKVPQCNSSWMNDFIR 398

Query: 283 RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTS 342
           ++ +++I+VAV    G+  P+IR AD+K +  I+ EVKQLAQ+A+   LKP +Y+GGT +
Sbjct: 399 QYHNVNINVAVQTEHGLFVPVIRDADKKGLGAIAEEVKQLAQKARDNSLKPADYEGGTFT 458

Query: 343 ISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVV--FQNEEIKVATIMNATLSADHRSV 399
           +SN+G   GI  FCA+INPPQS ILAIG+ EK+V+    + + +  + M+ATLS DHR +
Sbjct: 459 VSNLGGPFGIKQFCAIINPPQSAILAIGSAEKRVIPGSADGQFEFGSFMSATLSCDHRVI 518

Query: 400 DGAIASKLLAKFKEYIENPVWMLM 423
           DGAI ++ L  FK YIENP  ML+
Sbjct: 519 DGAIGAEFLKAFKGYIENPTSMLL 542


>gi|58585004|ref|YP_198577.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58419320|gb|AAW71335.1| Dihydrolipoamide acyltransferase E2 component [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 423

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 178/439 (40%), Positives = 267/439 (60%), Gaps = 47/439 (10%)

Query: 6   ITMPSLSPTM--TEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
           I MP+LSPTM  T GK+ KW K+E D++  GD++ EIETDKAIMEFESVD G++ +ILV 
Sbjct: 5   ILMPALSPTMSKTGGKIVKWCKKEQDRVEVGDVIAEIETDKAIMEFESVDRGVLAKILVS 64

Query: 64  AGTENIAVNSPILNILMDSTE---------IPPSPPLSKENIVEVREEH----------S 104
            GT  + VN  I  +L +  +         +P      KE +V                +
Sbjct: 65  EGTSGVPVNQLIALMLEEGEDKSAIDNYVSVPAVNIEVKEKVVTTSSVSSNPSMSSQCLT 124

Query: 105 HSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNV 164
             S      K +++R   SPLA+++A   GI++  L G+GP+GRI+K+D+          
Sbjct: 125 QESKKEEGTKTTESRIKVSPLAKKIAQNEGINVRRLKGTGPYGRIIKADV---------- 174

Query: 165 KDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
                    G +D  +   I N    D   ++   N+R+ IA RL ++KQ IPHFY++++
Sbjct: 175 --------LGFLDSGV--QIKNRERSDEDTILEVSNMRQVIAQRLIEAKQNIPHFYLTVE 224

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
           C +D L+SL+ ++N        + +NK+++ND+I+KA A +M + P+ N SW  N ++R+
Sbjct: 225 CQVDKLISLKNEINSA------DKNNKVTINDLIIKAVAFSMKKFPDINSSWIDNKILRY 278

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
            +IDIS+AV++  G++TPI++ AD+K IL IS EVK L  RA+  KL PEE+QGG  +IS
Sbjct: 279 ANIDISIAVALEDGLITPIVKNADEKGILSISKEVKDLVIRARSGKLGPEEFQGGGFTIS 338

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIA 404
           N+GM  I +F A+INPPQS I+AIG  +K+ +  +E+I++  I+  TLS DHR+VDG + 
Sbjct: 339 NLGMFSIKTFSAIINPPQSCIMAIGTSKKQPIVIDEKIEIVEIITVTLSVDHRAVDGVLG 398

Query: 405 SKLLAKFKEYIENPVWMLM 423
           +K L  FK YIENP+ ML+
Sbjct: 399 AKFLNAFKHYIENPLAMLI 417


>gi|297738635|emb|CBI27880.3| unnamed protein product [Vitis vinifera]
          Length = 547

 Score =  333 bits (855), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 188/446 (42%), Positives = 269/446 (60%), Gaps = 52/446 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +A+W+K+EGDKISPG++LCE+ETDKA +E E ++EG + +I++  G
Sbjct: 126 IGMPSLSPTMTEGNIARWLKKEGDKISPGEVLCEVETDKATVEMECMEEGYLAKIVLGDG 185

Query: 66  TENIAVNSPILNILMDSTEIP--------------------PSPPLSKENIVEVREEHSH 105
            + I V   I   + +  +I                      SPP  KE       E   
Sbjct: 186 AKEIKVGQVIAITVEEEDDIAKFKGYEAPKGGAADGGKKSSASPPPMKE-----VAEKPA 240

Query: 106 SSP-----VVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST 160
           SSP       V    + +R  +SPLA++LA +H + L S+ G+GP GRIVK+DIE     
Sbjct: 241 SSPQPNVSKAVESSKAGDRIFSSPLAKKLAEDHNVPLQSIKGTGPDGRIVKADIE----- 295

Query: 161 KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
                DY  + S+G    +  +    L     Y  +PH  IRK  A RL  SKQTIPH+Y
Sbjct: 296 -----DY--LASYGKEATTPFSEAATL----DYTDLPHTQIRKVTASRLLLSKQTIPHYY 344

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           +++D  +D L+ LR Q+N TLQ        +ISVND+++KA ALA+ +VP+ N SWT + 
Sbjct: 345 LTVDTCVDKLMELRSQLN-TLQ--EASGGKRISVNDLVIKAAALALRKVPQCNSSWTNDY 401

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           + ++ +++I+VAV    G+  P++R AD+K +  I+ E+K LAQ+AK   LK E+Y+GGT
Sbjct: 402 IRQYHNVNINVAVQTDNGLYVPVVRDADKKGLSKIAEEIKHLAQKAKDNSLKSEDYEGGT 461

Query: 341 TSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVV--FQNEEIKVATIMNATLSADHR 397
            ++SN+G   G+  FCA+INPPQS ILA+G+ EK+V+     ++ K A+ M  TLS DHR
Sbjct: 462 FTVSNLGGPFGVKQFCAIINPPQSGILAVGSAEKRVIPGVGPDQFKYASFMPVTLSCDHR 521

Query: 398 SVDGAIASKLLAKFKEYIENPVWMLM 423
            +DGAI ++ L  FK YIENP  ML+
Sbjct: 522 VIDGAIGAEWLKAFKGYIENPESMLL 547


>gi|149184547|ref|ZP_01862865.1| pyruvate dehydrogenase E2 component [Erythrobacter sp. SD-21]
 gi|148831867|gb|EDL50300.1| pyruvate dehydrogenase E2 component [Erythrobacter sp. SD-21]
          Length = 444

 Score =  333 bits (855), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 187/453 (41%), Positives = 274/453 (60%), Gaps = 40/453 (8%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ + GD +S GDI+ EIETDKA MEFE+VDEG I  I 
Sbjct: 1   MPTPIKMPALSPTMEEGTLAKWLVKPGDSVSAGDIMAEIETDKATMEFEAVDEGTIASIT 60

Query: 62  VPAGTENIAVNSPILNILMDSTEI----PPSPPL------SKENIVEVREEHSHSSPVVV 111
           V  GTE + V + I  +  +  ++      +PP       S ++  E  E       V  
Sbjct: 61  VDEGTEGVKVGTVIAMLAEEGEDVEKVAKAAPPAEGDAGGSDDSETEA-ETKQREGKVAQ 119

Query: 112 REKHSKNR-------------PI--------ASPLARRLAGEHGIDLSSLSGSGPHGRIV 150
            EK ++ +             P+        ASPLARR+A + GIDL+++SGSGP+GRIV
Sbjct: 120 EEKRTEEKSSASDDETSAPAAPVGDDGKRIKASPLARRIAEQKGIDLTTISGSGPNGRIV 179

Query: 151 KSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQ 210
           K+D+E         KD +       V  +     L+      YE    +N+RK IA RL 
Sbjct: 180 KADVEEAKPGAAPAKDTAAAPEPAPVKPATQGGDLDA----PYEAQKLNNVRKVIARRLT 235

Query: 211 QSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVP 270
           ++KQTIPH Y+++D  +D LL LR ++N++L    E    K+SVND+++KA A A+ +VP
Sbjct: 236 EAKQTIPHIYLTVDVRLDALLKLRSELNKSL----EADGIKLSVNDLLIKAQARALQRVP 291

Query: 271 EANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRK 330
             NVS+  + + ++   DISVAV+ P G++TPIIR A +K +  IS E+K+LA +A+  K
Sbjct: 292 LCNVSFQGDELFQYTREDISVAVAAPSGLITPIIRDAGRKGLAQISTEMKELAGKARDGK 351

Query: 331 LKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNA 390
           L+P E+QGGT S+SN+GM G   F AVINPPQ+ ILA+GAGE++    +  + +AT+M+A
Sbjct: 352 LQPHEFQGGTASLSNLGMFGTKQFDAVINPPQAMILAVGAGEQRPHIIDGALGIATVMSA 411

Query: 391 TLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           T S DHR++DGA  ++ +  F++ +ENP+ +++
Sbjct: 412 TGSFDHRAIDGADGAQFMQAFQQLVENPMGLVV 444


>gi|115443677|ref|NP_001045618.1| Os02g0105200 [Oryza sativa Japonica Group]
 gi|40363771|dbj|BAD06281.1| putative dihydrolipoamide S-acetyltransferase [Oryza sativa
           Japonica Group]
 gi|41052549|dbj|BAD07541.1| putative dihydrolipoamide S-acetyltransferase [Oryza sativa
           Japonica Group]
 gi|50252092|dbj|BAD28078.1| putative dihydrolipoamide S-acetyltransferase [Oryza sativa
           Japonica Group]
 gi|113535149|dbj|BAF07532.1| Os02g0105200 [Oryza sativa Japonica Group]
 gi|215693370|dbj|BAG88752.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222622010|gb|EEE56142.1| hypothetical protein OsJ_05022 [Oryza sativa Japonica Group]
          Length = 548

 Score =  333 bits (855), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 183/443 (41%), Positives = 269/443 (60%), Gaps = 44/443 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +A+W+K+EGDK+SPG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 125 IGMPSLSPTMTEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIIHGDG 184

Query: 66  TENIAVNSPILNILMDSTEI---------------PPSPPLSKENIVEVREEHSHSS--- 107
            + I V   I   + +  ++                PS P ++    E + + +  S   
Sbjct: 185 AKEIKVGEIIAVTVEEEGDLEKFKDYKPSTSAAPAAPSEPKAQPEPAEPKVKETEPSRTP 244

Query: 108 ----PVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
               P          R  +SPLAR+LA ++ + LSS+ G+GP GRI+K+DIE        
Sbjct: 245 EPKAPKTEEASQPGGRIFSSPLARKLAEDNNVPLSSVMGTGPDGRILKADIE-------- 296

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
             DY    + G   E++ A  L      SY  +P+  IRK  A RL  SKQTIPH+Y+++
Sbjct: 297 --DYLASVAKGGKREALAAPGL------SYTDVPNTQIRKVTANRLLSSKQTIPHYYLTV 348

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           D  +DNL+ LR ++N            KIS+ND+++KA ALA+ +VP+ N SW ++ + +
Sbjct: 349 DARVDNLIKLRGELN---PLQESSGGKKISINDLVIKAAALALRKVPQCNSSWMSDFIRQ 405

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
           + +++I+VAV    G+  P+IR AD+K +  I+ EVKQ+AQRA+   LKPE+Y+GGT +I
Sbjct: 406 YHNVNINVAVQTEHGLFVPVIRDADKKGLGTIAEEVKQVAQRARDNSLKPEDYEGGTFTI 465

Query: 344 SNMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQ--NEEIKVATIMNATLSADHRSVD 400
           SN+G   GI  FCA+INPPQS ILAIG  EK+V+    + + +  + M+AT+S DHR +D
Sbjct: 466 SNLGGPFGIKQFCAIINPPQSAILAIGTAEKRVIPGSVDGQYEFGSFMSATMSCDHRVID 525

Query: 401 GAIASKLLAKFKEYIENPVWMLM 423
           GAI ++ L  FK YIENP  ML+
Sbjct: 526 GAIGAEFLKAFKGYIENPNSMLL 548


>gi|332208198|ref|XP_003253188.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component
           of pyruvate dehydrogenase complex, mitochondrial isoform
           2 [Nomascus leucogenys]
          Length = 591

 Score =  333 bits (854), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 182/441 (41%), Positives = 271/441 (61%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 165 VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 224

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH--------------------SH 105
           T ++ + +P+  I+    +I          + +++ +                     + 
Sbjct: 225 TRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQAPPPTPAPVAAVPPTPQPLAPTP 284

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R   SPLA++LA E GIDL+ + G+GP GRI K DI++ + +K    
Sbjct: 285 SAPCPATPAGPKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKAAPV 344

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +   G     +   +        +  IP  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 345 PAAVVPPTGPGMAPVPTGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDV 396

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 397 NMGEVLLIRKELNKIL-----EGRSKISVNDFIIKASALACLKVPEANSSWM-DTVIRQN 450

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 451 HVVDVSVAVSTPAGLITPIVFNAHIKGLETIANDVVSLATKAREGKLQPHEFQGGTFTIS 510

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E K+V  + E    VA++M+ TLS DHR VDGA
Sbjct: 511 NLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGA 570

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 571 VGAQWLAEFRKYLEKPITMLL 591



 Score = 76.3 bits (186), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 52/70 (74%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
           + + +PSLSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++E  + +ILV 
Sbjct: 36  YRVPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESMEECYMAKILVA 95

Query: 64  AGTENIAVNS 73
            GT ++ + +
Sbjct: 96  EGTRDVPIGA 105


>gi|224128670|ref|XP_002329061.1| predicted protein [Populus trichocarpa]
 gi|222839732|gb|EEE78055.1| predicted protein [Populus trichocarpa]
          Length = 436

 Score =  333 bits (854), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 187/450 (41%), Positives = 272/450 (60%), Gaps = 48/450 (10%)

Query: 8   MPSLSPTMTEG-----------KLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGI 56
           MPSLSPTMTE            +LA+W+K+EGDKISPG++LCE+ETDKA +E E ++EG 
Sbjct: 1   MPSLSPTMTEACSFLHLIGKQWRLARWLKKEGDKISPGEVLCEVETDKATVEMECMEEGY 60

Query: 57  IDEILVPAGTENIAVNSPILNILMDSTEIPP----SPPLSKENIVEVREEHSHS------ 106
           + +IL   G++ I +   I   + D  +I      SP  S       +E  SH+      
Sbjct: 61  LAKILKGDGSKEIKLGEVIAITVEDGEDIAKFKDYSPSTSGSGDTSAKEASSHAPPEKEE 120

Query: 107 --------SPVVVREKHSKN--RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIET 156
                    P V +   S N  R  +SPLAR+LA +H + LSS+ G+GP G IVK+DIE 
Sbjct: 121 VEKPASPPEPKVSKPSASPNGDRIFSSPLARKLAEDHNVPLSSIKGTGPDGHIVKADIEY 180

Query: 157 LISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTI 216
            ++++        + +   V +      L+      Y  IPH  IRK  A  L  SKQTI
Sbjct: 181 YLASRGE-----EVPATKPVTKDTPVPTLD------YVDIPHSQIRKVTASNLLFSKQTI 229

Query: 217 PHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSW 276
           PH+Y+++D  +D L+SLR Q+N            +IS+ND+++KA ALA+ +VP+ N SW
Sbjct: 230 PHYYLTVDTCVDKLMSLRSQLNL---LQEASGGKRISLNDLVIKAAALALRKVPQCNSSW 286

Query: 277 TTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEY 336
           T N + ++ +++I+VAV    G+  P+I+ AD+K +  IS +VK LAQ+AK+ +LKPE+Y
Sbjct: 287 TDNYIRQYNNVNINVAVQTDNGLYVPVIKDADKKGLSKISDDVKNLAQKAKENRLKPEDY 346

Query: 337 QGGTTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVV--FQNEEIKVATIMNATLS 393
           +GGT ++SN+G   GI  FCA+INPPQS ILA+G+ EK+V+    +++ K A+ M+ TLS
Sbjct: 347 EGGTFTVSNLGGPFGIRQFCAIINPPQSGILAVGSAEKRVIPGSGHDDFKFASFMSVTLS 406

Query: 394 ADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            DHR +DGAI ++ L  FK YIENP  ML+
Sbjct: 407 CDHRVIDGAIGAEWLKAFKGYIENPESMLL 436


>gi|226502364|ref|NP_001150860.1| dihydrolipoamide S-acetyltransferase1 [Zea mays]
 gi|195642434|gb|ACG40685.1| dihydrolipoyllysine-residue acetyltransferase component of
           pyruvatedehydrogenase complex [Zea mays]
          Length = 539

 Score =  333 bits (854), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 185/443 (41%), Positives = 269/443 (60%), Gaps = 47/443 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +AKW+K+EGDK+SPG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 119 IGMPSLSPTMTEGNIAKWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIIHGDG 178

Query: 66  TENIAVNSPILNILMDSTEI-------------PPSPPLSKE----NIVEVREEHSHSSP 108
            + I V   I   + +  +I             P +P  SK     +  +V E+    +P
Sbjct: 179 AKEIKVGEVIAITVEEEGDIEKFKDYKPSSSAEPVAPAESKAQPEPSQPKVEEKKLTQAP 238

Query: 109 VVVREK-----HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
            V   K      S +R  ASPLAR+LA ++ + LSS+ G+GP GRI K+DIE  ++ K  
Sbjct: 239 EVKAPKIEEASQSGDRIFASPLARKLAEDNNVPLSSVKGTGPDGRIFKADIEDYLA-KGG 297

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
           +++       G VD                  IP+  IRK  A RL  SKQTIPH+Y+++
Sbjct: 298 LREAFAAPGLGYVD------------------IPNAQIRKVTANRLLASKQTIPHYYLTV 339

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           D  +D L+ LR ++N            KIS+ND+++KA ALA+ +VP+ N SW  + + +
Sbjct: 340 DARVDKLVKLRGELN---PLQDASGGKKISINDLVIKAAALALRKVPQCNSSWMNDFIRQ 396

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
           + +++I+VAV    G+  P+IR AD+K +  I+ EVKQLAQ+A+   LKP +Y+GGT ++
Sbjct: 397 YHNVNINVAVQTEHGLFVPVIRDADKKGLGTIAEEVKQLAQKARDNSLKPADYEGGTFTV 456

Query: 344 SNMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVD 400
           SN+G   GI  FCA+INPPQS ILAIG+ EK+V+  + +   +  + M+ATLS DHR +D
Sbjct: 457 SNLGGPFGIKQFCAIINPPQSAILAIGSAEKRVIPGSADGLYEFGSFMSATLSCDHRVID 516

Query: 401 GAIASKLLAKFKEYIENPVWMLM 423
           GAI ++ L  FK YIENP  ML+
Sbjct: 517 GAIGAEFLKAFKGYIENPTSMLL 539


>gi|35360|emb|CAA68787.1| PDC-E2 precursor (AA -54 to 561) [Homo sapiens]
          Length = 615

 Score =  333 bits (854), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 182/441 (41%), Positives = 271/441 (61%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 189 VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 248

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH--------------------SH 105
           T ++ + +P+  I+    +I          + +++ +                     + 
Sbjct: 249 TRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQVPPPTPPPVAAVPPTPQPLAPTP 308

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R   SPLA++LA E GIDL+ + G+GP GRI K DI++ + +K    
Sbjct: 309 SAPCPATPAGPKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPA 368

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +   G     +   +        +  IP  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 369 PAAVVPPTGPGMAPVPTGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDV 420

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 421 NMGEVLLVRKELNKIL-----EGRSKISVNDFIIKASALACLKVPEANSSWM-DTVIRQN 474

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 475 HVVDVSVAVSTPAGLITPIVFNAHIKGVETIANDVVSLATKAREGKLQPHEFQGGTFTIS 534

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E K+V  + E    VA++M+ TLS DHR VDGA
Sbjct: 535 NLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGA 594

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 595 VGAQWLAEFRKYLEKPITMLL 615



 Score = 76.3 bits (186), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 51/68 (75%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +PSLSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++E  + +ILV  G
Sbjct: 62  VPLPSLSPTMQAGTIARWKKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVAEG 121

Query: 66  TENIAVNS 73
           T ++ + +
Sbjct: 122 TRDVPIGA 129


>gi|332837672|ref|XP_522180.3| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component
           of pyruvate dehydrogenase complex, mitochondrial isoform
           2 [Pan troglodytes]
          Length = 601

 Score =  333 bits (853), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 182/441 (41%), Positives = 271/441 (61%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 175 VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 234

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH--------------------SH 105
           T ++ + +P+  I+    +I          + +++ +                     + 
Sbjct: 235 TRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQAPPPTPPPVAAVPPTPQPLAPTP 294

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R   SPLA++LA E GIDL+ + G+GP GRI K DI++ + +K    
Sbjct: 295 SAPCPATPAGPKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPA 354

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +   G     +   +        +  IP  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 355 PAAVVPPTGPGMAPVPTGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDV 406

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 407 NMGEVLLVRKELNKIL-----EGRSKISVNDFIIKASALACLKVPEANSSWM-DTVIRQN 460

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 461 HVVDVSVAVSTPAGLITPIVFNAHIKGVETIANDVVSLAAKAREGKLQPHEFQGGTFTIS 520

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E K+V  + E    VA++M+ TLS DHR VDGA
Sbjct: 521 NLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGA 580

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 581 VGAQWLAEFRKYLEKPITMLL 601



 Score = 76.3 bits (186), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 52/70 (74%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
           + + +PSLSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++E  + +ILV 
Sbjct: 46  YRVPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVA 105

Query: 64  AGTENIAVNS 73
            GT ++ + +
Sbjct: 106 EGTRDVPIGA 115


>gi|332837670|ref|XP_003313345.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component
           of pyruvate dehydrogenase complex, mitochondrial isoform
           1 [Pan troglodytes]
          Length = 647

 Score =  333 bits (853), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 182/441 (41%), Positives = 271/441 (61%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 221 VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 280

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH--------------------SH 105
           T ++ + +P+  I+    +I          + +++ +                     + 
Sbjct: 281 TRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQAPPPTPPPVAAVPPTPQPLAPTP 340

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R   SPLA++LA E GIDL+ + G+GP GRI K DI++ + +K    
Sbjct: 341 SAPCPATPAGPKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPA 400

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +   G     +   +        +  IP  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 401 PAAVVPPTGPGMAPVPTGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDV 452

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 453 NMGEVLLVRKELNKIL-----EGRSKISVNDFIIKASALACLKVPEANSSWM-DTVIRQN 506

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 507 HVVDVSVAVSTPAGLITPIVFNAHIKGVETIANDVVSLAAKAREGKLQPHEFQGGTFTIS 566

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E K+V  + E    VA++M+ TLS DHR VDGA
Sbjct: 567 NLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGA 626

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 627 VGAQWLAEFRKYLEKPITMLL 647



 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 51/68 (75%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +PSLSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++E  + +ILV  G
Sbjct: 94  VPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVAEG 153

Query: 66  TENIAVNS 73
           T ++ + +
Sbjct: 154 TRDVPIGA 161


>gi|220838|dbj|BAA01504.1| dihydrolipoamide acetyltransferase [Rattus norvegicus]
          Length = 541

 Score =  332 bits (852), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 184/437 (42%), Positives = 269/437 (61%), Gaps = 34/437 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 120 IVLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 179

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA--- 122
           T ++ + +P+  I+    +I          +  ++ +     P  V       +P+A   
Sbjct: 180 TRDVPLGTPLCIIVEKQEDIAAFADYRPTEVTSLKPQAPPPVPPPVAAVPPIPQPLAPTP 239

Query: 123 -------------SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYST 169
                        SPLA++LA E GIDL+ + G+GP GRI+K DI++ + TK      + 
Sbjct: 240 SAAPAGPKGRVFVSPLAKKLAAEKGIDLTQVKGTGPEGRIIKKDIDSFVPTKAAPAAAAA 299

Query: 170 IQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
                 V  +     ++         IP  NIR+ IA RL QSKQTIPH+Y+S+D N+  
Sbjct: 300 APPGPRVAPTPAGVFID---------IPISNIRRVIAQRLMQSKQTIPHYYLSVDVNMGE 350

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI-D 288
           +L +R+++N+ L     E   KISVND I+KA ALA ++VPEAN SW  + +IR  H+ D
Sbjct: 351 VLLVRKELNKML-----EGKGKISVNDFIIKASALACLKVPEANSSWM-DTVIRQNHVVD 404

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           +SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +ISN+GM
Sbjct: 405 VSVAVSTPAGLITPIVFNAHIKGLETIASDVVSLASKAREGKLQPHEFQGGTFTISNLGM 464

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGAIASK 406
            GI +F A+INPPQ+ ILAIGA E K++  + E    VA++M+ TLS DHR VDGA+ ++
Sbjct: 465 FGIKNFSAIINPPQACILAIGASEDKLIPADNEKGFDVASVMSVTLSCDHRVVDGAVGAQ 524

Query: 407 LLAKFKEYIENPVWMLM 423
            LA+FK+Y+E PV ML+
Sbjct: 525 WLAEFKKYLEKPVTMLL 541



 Score = 69.7 bits (169), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 51/74 (68%), Gaps = 4/74 (5%)

Query: 13 PTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVN 72
          PTM  G +A+W K+EG+KIS GD++ E+ETDKA + FES++E  + +ILVP GT ++   
Sbjct: 1  PTMQAGTIARWEKKEGEKISEGDLIAEVETDKATVGFESLEECYMAKILVPEGTRDV--- 57

Query: 73 SPILNILMDSTEIP 86
           PI  I+  + E P
Sbjct: 58 -PIGCIICITVEKP 70


>gi|332208196|ref|XP_003253187.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component
           of pyruvate dehydrogenase complex, mitochondrial isoform
           1 [Nomascus leucogenys]
          Length = 647

 Score =  332 bits (852), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 182/441 (41%), Positives = 271/441 (61%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 221 VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 280

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH--------------------SH 105
           T ++ + +P+  I+    +I          + +++ +                     + 
Sbjct: 281 TRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQAPPPTPAPVAAVPPTPQPLAPTP 340

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R   SPLA++LA E GIDL+ + G+GP GRI K DI++ + +K    
Sbjct: 341 SAPCPATPAGPKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKAAPV 400

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +   G     +   +        +  IP  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 401 PAAVVPPTGPGMAPVPTGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDV 452

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 453 NMGEVLLIRKELNKIL-----EGRSKISVNDFIIKASALACLKVPEANSSWM-DTVIRQN 506

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 507 HVVDVSVAVSTPAGLITPIVFNAHIKGLETIANDVVSLATKAREGKLQPHEFQGGTFTIS 566

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E K+V  + E    VA++M+ TLS DHR VDGA
Sbjct: 567 NLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGA 626

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 627 VGAQWLAEFRKYLEKPITMLL 647



 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 51/68 (75%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +PSLSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++E  + +ILV  G
Sbjct: 94  VPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESMEECYMAKILVAEG 153

Query: 66  TENIAVNS 73
           T ++ + +
Sbjct: 154 TRDVPIGA 161


>gi|119587578|gb|EAW67174.1| dihydrolipoamide S-acetyltransferase (E2 component of pyruvate
           dehydrogenase complex), isoform CRA_a [Homo sapiens]
 gi|119587579|gb|EAW67175.1| dihydrolipoamide S-acetyltransferase (E2 component of pyruvate
           dehydrogenase complex), isoform CRA_a [Homo sapiens]
          Length = 647

 Score =  332 bits (852), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 182/441 (41%), Positives = 271/441 (61%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 221 VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 280

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH--------------------SH 105
           T ++ + +P+  I+    +I          + +++ +                     + 
Sbjct: 281 TRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQAPPPTPPPVAAVPPTPQPLAPTP 340

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R   SPLA++LA E GIDL+ + G+GP GRI K DI++ + +K    
Sbjct: 341 SAPCPATPAGPKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPA 400

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +   G     +   +        +  IP  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 401 PAAVVPPTGPGMAPVPTGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDV 452

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 453 NMGEVLLVRKELNKIL-----EGRSKISVNDFIIKASALACLKVPEANSSWM-DTVIRQN 506

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 507 HVVDVSVAVSTPAGLITPIVFNAHIKGVETIANDVVSLATKAREGKLQPHEFQGGTFTIS 566

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E K+V  + E    VA++M+ TLS DHR VDGA
Sbjct: 567 NLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGA 626

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 627 VGAQWLAEFRKYLEKPITMLL 647



 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 51/68 (75%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +PSLSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++E  + +ILV  G
Sbjct: 94  VPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVAEG 153

Query: 66  TENIAVNS 73
           T ++ + +
Sbjct: 154 TRDVPIGA 161


>gi|31711992|ref|NP_001922.2| dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex, mitochondrial precursor [Homo
           sapiens]
 gi|215274207|sp|P10515|ODP2_HUMAN RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component of pyruvate dehydrogenase complex,
           mitochondrial; AltName: Full=70 kDa mitochondrial
           autoantigen of primary biliary cirrhosis; Short=PBC;
           AltName: Full=Dihydrolipoamide acetyltransferase
           component of pyruvate dehydrogenase complex; AltName:
           Full=M2 antigen complex 70 kDa subunit; AltName:
           Full=Pyruvate dehydrogenase complex component E2;
           Short=PDC-E2; Short=PDCE2; Flags: Precursor
 gi|25058600|gb|AAH39084.1| Dihydrolipoamide S-acetyltransferase [Homo sapiens]
 gi|123983264|gb|ABM83373.1| dihydrolipoamide S-acetyltransferase (E2 component of pyruvate
           dehydrogenase complex) [synthetic construct]
 gi|123997965|gb|ABM86584.1| dihydrolipoamide S-acetyltransferase (E2 component of pyruvate
           dehydrogenase complex) [synthetic construct]
 gi|167887549|gb|ACA05975.1| dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex mitochondrial precursor [Homo
           sapiens]
 gi|193787077|dbj|BAG51900.1| unnamed protein product [Homo sapiens]
          Length = 647

 Score =  332 bits (852), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 182/441 (41%), Positives = 271/441 (61%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 221 VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 280

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH--------------------SH 105
           T ++ + +P+  I+    +I          + +++ +                     + 
Sbjct: 281 TRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQVPPPTPPPVAAVPPTPQPLAPTP 340

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R   SPLA++LA E GIDL+ + G+GP GRI K DI++ + +K    
Sbjct: 341 SAPCPATPAGPKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPA 400

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +   G     +   +        +  IP  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 401 PAAVVPPTGPGMAPVPTGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDV 452

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 453 NMGEVLLVRKELNKIL-----EGRSKISVNDFIIKASALACLKVPEANSSWM-DTVIRQN 506

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 507 HVVDVSVAVSTPAGLITPIVFNAHIKGVETIANDVVSLATKAREGKLQPHEFQGGTFTIS 566

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E K+V  + E    VA++M+ TLS DHR VDGA
Sbjct: 567 NLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGA 626

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 627 VGAQWLAEFRKYLEKPITMLL 647



 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 51/68 (75%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +PSLSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++E  + +ILV  G
Sbjct: 94  VPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVAEG 153

Query: 66  TENIAVNS 73
           T ++ + +
Sbjct: 154 TRDVPIGA 161


>gi|78365255|ref|NP_112287.1| dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex, mitochondrial [Rattus norvegicus]
 gi|119364626|sp|P08461|ODP2_RAT RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component of pyruvate dehydrogenase complex,
           mitochondrial; AltName: Full=70 kDa mitochondrial
           autoantigen of primary biliary cirrhosis; Short=PBC;
           AltName: Full=Dihydrolipoamide acetyltransferase
           component of pyruvate dehydrogenase complex; AltName:
           Full=Pyruvate dehydrogenase complex component E2;
           Short=PDC-E2; Short=PDCE2; Flags: Precursor
 gi|78174343|gb|AAI07441.1| Dihydrolipoamide S-acetyltransferase [Rattus norvegicus]
 gi|149041629|gb|EDL95470.1| dihydrolipoamide S-acetyltransferase (E2 component of pyruvate
           dehydrogenase complex) [Rattus norvegicus]
          Length = 632

 Score =  332 bits (851), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 184/437 (42%), Positives = 269/437 (61%), Gaps = 34/437 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 211 IVLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 270

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA--- 122
           T ++ + +P+  I+    +I          +  ++ +     P  V       +P+A   
Sbjct: 271 TRDVPLGTPLCIIVEKQEDIAAFADYRPTEVTSLKPQAPPPVPPPVAAVPPIPQPLAPTP 330

Query: 123 -------------SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYST 169
                        SPLA++LA E GIDL+ + G+GP GRI+K DI++ + TK      + 
Sbjct: 331 SAAPAGPKGRVFVSPLAKKLAAEKGIDLTQVKGTGPEGRIIKKDIDSFVPTKAAPAAAAA 390

Query: 170 IQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
                 V  +     ++         IP  NIR+ IA RL QSKQTIPH+Y+S+D N+  
Sbjct: 391 APPGPRVAPTPAGVFID---------IPISNIRRVIAQRLMQSKQTIPHYYLSVDVNMGE 441

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI-D 288
           +L +R+++N+ L     E   KISVND I+KA ALA ++VPEAN SW  + +IR  H+ D
Sbjct: 442 VLLVRKELNKML-----EGKGKISVNDFIIKASALACLKVPEANSSWM-DTVIRQNHVVD 495

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           +SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +ISN+GM
Sbjct: 496 VSVAVSTPAGLITPIVFNAHIKGLETIASDVVSLASKAREGKLQPHEFQGGTFTISNLGM 555

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGAIASK 406
            GI +F A+INPPQ+ ILAIGA E K++  + E    VA++M+ TLS DHR VDGA+ ++
Sbjct: 556 FGIKNFSAIINPPQACILAIGASEDKLIPADNEKGFDVASVMSVTLSCDHRVVDGAVGAQ 615

Query: 407 LLAKFKEYIENPVWMLM 423
            LA+FK+Y+E PV ML+
Sbjct: 616 WLAEFKKYLEKPVTMLL 632



 Score = 80.9 bits (198), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 52/70 (74%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
             + +PSLSPTM  G +A+W K+EG+KIS GD++ E+ETDKA + FES++E  + +ILVP
Sbjct: 83  QKVPLPSLSPTMQAGTIARWEKKEGEKISEGDLIAEVETDKATVGFESLEECYMAKILVP 142

Query: 64  AGTENIAVNS 73
            GT ++ V S
Sbjct: 143 EGTRDVPVGS 152


>gi|85708657|ref|ZP_01039723.1| pyruvate dehydrogenase E2 component [Erythrobacter sp. NAP1]
 gi|85690191|gb|EAQ30194.1| pyruvate dehydrogenase E2 component [Erythrobacter sp. NAP1]
          Length = 463

 Score =  332 bits (851), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 193/479 (40%), Positives = 281/479 (58%), Gaps = 73/479 (15%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + MP+LSPTM EG LA+W+ + GD+I+ GDI+ EIETDKA MEFE+VDEG +  IL
Sbjct: 1   MAIELKMPALSPTMEEGTLARWLVKVGDEIASGDIMAEIETDKATMEFEAVDEGTLAAIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEI----PPS---------------------------PP 90
           V  GTEN+AV + I  +  +  ++     PS                            P
Sbjct: 61  VEEGTENVAVGTVIAMLAEEGEDVSDVSAPSGDAAPAPTPAPAPAPKSAPASSEGVKASP 120

Query: 91  LSK-----ENIVEVREEHSHSSPVVVR------------EKHSKNRPIASPLARRLAGEH 133
           L+K     E +     E S     +V+            +  S +R IASPLA+++AGE 
Sbjct: 121 LAKRIAANEGVDLASVEGSGPKGRIVKADVEAAAGGSSSQPRSGDRVIASPLAKKMAGEQ 180

Query: 134 GIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSY 193
           GIDL  +SG+GP GRI+K+DI+    T       +   S    +E          AK + 
Sbjct: 181 GIDLGDVSGTGPGGRIIKADIDNYEPTPAASPAPAPAAS----EEKT--------AKPAP 228

Query: 194 EVIPH---------DNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFH 244
           +   H          N+RK IA RL +SKQT+PH+Y+++D  +D LL LR+++N +L   
Sbjct: 229 QAPEHGAPFEEEKLSNVRKVIARRLTESKQTVPHYYLTMDIVLDPLLKLRKELNASL--- 285

Query: 245 REEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPII 304
            E    K+SVND+++KA A A+I+VP+ NVS+  + M ++   DISVAV+ P G++TP+I
Sbjct: 286 -EPDGVKLSVNDLLIKALARALIRVPQCNVSYHGDTMRKYSRADISVAVAAPSGLITPVI 344

Query: 305 RQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQST 364
            +AD K +  IS E+K+LA +A+  KL+P EYQGGT S+SN+GM GI  F AVINPPQ  
Sbjct: 345 TEADTKGLAQISKEMKELAGKARDGKLQPHEYQGGTASLSNLGMFGIKQFDAVINPPQGM 404

Query: 365 ILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           ILA+GAG++     + EIK AT+++A+ S DHR++DGA  ++L+   K+ +ENP+ +L+
Sbjct: 405 ILAVGAGQQVPYVIDGEIKPATVLHASGSFDHRAIDGAEGAQLMEAIKQLVENPMGLLV 463


>gi|226207|prf||1501257A dihydrolipoamide acetyltransferase
          Length = 615

 Score =  332 bits (850), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 182/441 (41%), Positives = 271/441 (61%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 189 VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 248

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH--------------------SH 105
           T ++ + +P+  I+    +I          + +++ +                     + 
Sbjct: 249 TRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQVPPPTPPPVAAVPPTPQPLAPTP 308

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R   SPLA++LA E GIDL+ + G+GP GRI K DI++ + +K    
Sbjct: 309 SAPCPATPAGPKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPA 368

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +   G     +   +        +  IP  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 369 PAAVVPPTGPGMAPVPTGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDV 420

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 421 NMGEVLLVRKELNKIL-----EGRSKISVNDFIIKASALACLKVPEANSSWM-DTVIRQN 474

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 475 HVVDVSVAVSTPAGLITPIVFNAHIKGVETIANDVVSLATKAREGKLQPHEFQGGTFTIS 534

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEI--KVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E K+V  + E    VA++M+ TLS DHR VDGA
Sbjct: 535 NLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGRDVASMMSVTLSCDHRVVDGA 594

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 595 VGAQWLAEFRKYLEKPITMLL 615



 Score = 76.3 bits (186), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 51/68 (75%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +PSLSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++E  + +ILV  G
Sbjct: 62  VPLPSLSPTMQAGTIARWKKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVAEG 121

Query: 66  TENIAVNS 73
           T ++ + +
Sbjct: 122 TRDVPIGA 129


>gi|58266576|ref|XP_570444.1| dihydrolipoyllysine-residue acetyltransferase [Cryptococcus
           neoformans var. neoformans JEC21]
 gi|134111040|ref|XP_775662.1| hypothetical protein CNBD3910 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50258326|gb|EAL21015.1| hypothetical protein CNBD3910 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57226677|gb|AAW43137.1| dihydrolipoyllysine-residue acetyltransferase, putative
           [Cryptococcus neoformans var. neoformans JEC21]
          Length = 479

 Score =  331 bits (849), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 184/465 (39%), Positives = 269/465 (57%), Gaps = 62/465 (13%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           ++    MP++SPTMTEG +A+W K+EG+  S GD+L EIETDKA ++ E+ D+GI+ +I+
Sbjct: 34  VLSKFAMPAMSPTMTEGGVAQWKKKEGESFSAGDVLIEIETDKATIDVEAQDDGIMAKII 93

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEV----------------REEHSH 105
              GT+NIAV +PI  I  +  ++  +  L+ E+  E                 +EE S 
Sbjct: 94  AQDGTKNIAVGTPIAIIGEEGDDLSQADALAAESQSESAPSQKEAAPKEEKTAPKEEKSE 153

Query: 106 SS---------------------PVVVREKHSK-NRP--IASPLARRLAGEHGIDLSSLS 141
           SS                     P    E  SK +RP   ASPLAR++A E+GI L+ + 
Sbjct: 154 SSTTPAVGVPGEQKSGAGDAQTSPAKAPEHPSKGDRPKFFASPLARKIALENGIPLAEIK 213

Query: 142 GSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNI 201
           G+GP+GRIV++D++    +       +  +S  +  +              YE IP  N+
Sbjct: 214 GTGPNGRIVEADVKNYKPSAAAASTPAAGKSAAVPAD--------------YEDIPTSNM 259

Query: 202 RKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKA 261
           R+TI  RL +SKQ +PH+YV+++ N+D +L LRE  N+       E   K+SVND I+KA
Sbjct: 260 RRTIGKRLTESKQQLPHYYVTVEVNMDRVLKLREVFNKA-----GESKTKLSVNDFIVKA 314

Query: 262 FALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQ 321
            +LA+  VPEAN +W    +  +K  DI VAV+ P G++TPII+    K +  IS E K 
Sbjct: 315 ASLALADVPEANSAWLGETIRTYKKADICVAVATPNGLITPIIKDVGAKGLATISAETKA 374

Query: 322 LAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE 381
           LA RA+  KLKPEEYQGG+ +ISN+GM G++ F A+INPPQS ILA+G    K+    E+
Sbjct: 375 LASRARDGKLKPEEYQGGSFTISNLGMFGVDEFTAIINPPQSCILAVGKTTTKLELAPED 434

Query: 382 ---IKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
               K   +M  TLSADHR+VDGA+ ++ L  F+EY+E P+  ++
Sbjct: 435 PKGFKAVQVMKVTLSADHRTVDGAVGARWLKAFREYMEQPLTFML 479


>gi|328769405|gb|EGF79449.1| hypothetical protein BATDEDRAFT_12330 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 443

 Score =  331 bits (849), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 185/440 (42%), Positives = 264/440 (60%), Gaps = 39/440 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ++MP+LSPTMT+G L KW K+ GD+ISPGD+L EIETDKA M+FE  +EG + +IL+PAG
Sbjct: 21  LSMPALSPTMTQGNLGKWHKKIGDQISPGDVLVEIETDKAQMDFECQEEGFLAKILIPAG 80

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK-------- 117
            +++AVN+PI  I  ++ ++                  +  +P                 
Sbjct: 81  EKDVAVNTPIAVIADNAQDVDKFSDFVSSGPAPTATTKATPTPAPTTVLPPPVAAAPAPT 140

Query: 118 ------NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIET----LISTKTNVKDY 167
                 +R   SP+A+ LA E GI L+S+ GSGP GRIVK+DIE+    +++  T+ +  
Sbjct: 141 PTSSSSDRTFISPIAKALAAERGISLASIKGSGPGGRIVKADIESYSAPVVTGATHAQ-- 198

Query: 168 STIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNI 227
           +T+     V  S         A  ++  IP  N+RK IA RL QSK TIPHFY+++  N+
Sbjct: 199 TTVTPVTPVASS---------AGSAFTDIPLSNVRKVIASRLTQSKSTIPHFYLTVQINV 249

Query: 228 DNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH- 286
           D +L LRE +N+           K+SVND  +KA ALA+  VPE N +W  +  IR  H 
Sbjct: 250 DKILKLREALNK-----EGNGKYKLSVNDFTIKASALALKDVPEVNSAWH-DTFIRQSHS 303

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
            DI+VAV+   G++TPII  A+ K +  IS + K+LA++A+  KL P EYQGGT +ISN+
Sbjct: 304 ADIAVAVATETGLITPIIHSAEGKGLAAISNQTKELAEKARAGKLVPHEYQGGTFTISNL 363

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVVFQN---EEIKVATIMNATLSADHRSVDGAI 403
           GM G+  F A+INPP + ILA+G  E K+V  +   +  +V   MN TLS DHR VDGA+
Sbjct: 364 GMFGVQHFTAIINPPHAAILAVGGIEDKLVLDDLAPKGFRVQKTMNVTLSNDHRVVDGAV 423

Query: 404 ASKLLAKFKEYIENPVWMLM 423
            +K L +FK+Y+ENP+ ML+
Sbjct: 424 GAKWLQRFKQYLENPLTMLL 443


>gi|148554288|ref|YP_001261870.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Sphingomonas wittichii RW1]
 gi|148499478|gb|ABQ67732.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Sphingomonas wittichii RW1]
          Length = 443

 Score =  331 bits (849), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 189/442 (42%), Positives = 264/442 (59%), Gaps = 29/442 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM EG LAKW+ +EGD +  GD+L EIETDKA MEFE+VDEG I +++V  G
Sbjct: 5   LKMPALSPTMEEGTLAKWLVKEGDAVKSGDLLAEIETDKATMEFEAVDEGTIAKLVVGEG 64

Query: 66  TENIAVNSPILNILM-DSTEIPPSPP---------------LSKENIVEVREEHSHSSPV 109
           TE + V S I  I   D    P + P                  E      E  +  +  
Sbjct: 65  TEGVKVGSVIALIQGEDEDAAPKAAPKVEAAPKPEPKPAPAPKAEAPAPKAEAPARPAAP 124

Query: 110 VVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYST 169
                 S +R  ASPLARRLA   G+DL+ +SG+GP GR+VK+D++              
Sbjct: 125 AAAPAASGDRVKASPLARRLAQAQGVDLAQVSGTGPGGRVVKADLDGAPKAAAAPAQAPA 184

Query: 170 IQSFGLVDESIDANILNLFAKDS---------YEVIPHDNIRKTIACRLQQSKQTIPHFY 220
             +      +         A            +EV+   N+RK IA RL +S Q  PH +
Sbjct: 185 AAAAAAPAPTAAPAAAPKPAAAPAPAGPDEIPHEVVKLSNMRKVIARRLTESMQQSPHIF 244

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           +++D  +D LL LR ++N +L    E    K+SVND+++KA A A++ VP+ NVS+  + 
Sbjct: 245 LTVDIRLDPLLKLRGELNASL----EARGVKLSVNDLLIKALAAALMDVPDCNVSFAGDT 300

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           +I++K  DISVAV+IPGG++TPII+ AD KS+  I+ E K LAQRAK+ KL+P EYQGGT
Sbjct: 301 LIQYKRADISVAVAIPGGLITPIIKGADTKSVGAIATEAKDLAQRAKEGKLQPHEYQGGT 360

Query: 341 TSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVD 400
            SISNMGM GI  F AVINPPQ+ I+A+GAGEK+    ++ +  AT+M+AT S DHR++D
Sbjct: 361 ASISNMGMFGIKQFTAVINPPQAMIMAVGAGEKRPYVVDDALATATVMSATGSFDHRAID 420

Query: 401 GAIASKLLAKFKEYIENPVWML 422
           GA+ ++L+  FK  +ENP+ +L
Sbjct: 421 GAVGAQLMQAFKRLVENPLGLL 442


>gi|194382854|dbj|BAG58983.1| unnamed protein product [Homo sapiens]
          Length = 591

 Score =  331 bits (849), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 182/441 (41%), Positives = 270/441 (61%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 165 VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 224

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH--------------------SH 105
           T ++ + +P+  I+    +I          + +++ +                     + 
Sbjct: 225 TRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQVPPPTPPPVAAVPPTPQPLAPTP 284

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R   SPLA++LA E GIDL+ + G+GP GRI K DI++ + +K    
Sbjct: 285 SAPCPATPAGPKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPA 344

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +   G     +   +        +  IP  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 345 PAAVVPPTGPGMAPVPTGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDV 396

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 397 NMGEVLLVRKELNKIL-----EGRSKISVNDFIIKASALACLKVPEANSSWM-DTVIRQN 450

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G +TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 451 HVVDVSVAVSTPAGPITPIVFNAHIKGVETIANDVVSLATKAREGKLQPHEFQGGTFTIS 510

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E K+V  + E    VA++M+ TLS DHR VDGA
Sbjct: 511 NLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGA 570

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 571 VGAQWLAEFRKYLEKPITMLL 591



 Score = 76.3 bits (186), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 52/70 (74%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
           + + +PSLSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++E  + +ILV 
Sbjct: 36  YRVPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVA 95

Query: 64  AGTENIAVNS 73
            GT ++ + +
Sbjct: 96  EGTRDVPIGA 105


>gi|296216175|ref|XP_002754431.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component
           of pyruvate dehydrogenase complex, mitochondrial
           [Callithrix jacchus]
          Length = 647

 Score =  331 bits (848), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 184/441 (41%), Positives = 271/441 (61%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 221 VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 280

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH--------------------SH 105
           T ++ + +P+  I+    +I          + +++ +                     + 
Sbjct: 281 TRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQAPPPTPPPVATVPPTPQPLGPTP 340

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R   SPLAR+LA E GIDL+ + G+GP GRI K DI++ +  K    
Sbjct: 341 SAPCPATPAGPKGRVFVSPLARKLAVEKGIDLAQVKGTGPDGRITKKDIDSFVPPKAAPA 400

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +   G     + A +        +  IP  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 401 PAAAVPPPGPGMAPVPAGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDV 452

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 453 NMGEVLLVRKELNKIL-----EGRSKISVNDFIIKASALACLKVPEANSSWM-DTVIRQN 506

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 507 HVVDVSVAVSTPAGLITPIVFNAHTKGLETIANDVISLASKAREGKLQPHEFQGGTFTIS 566

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E K+V  + E    VA++M+ TLS DHR VDGA
Sbjct: 567 NLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGA 626

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 627 VGAQWLAEFRKYLEKPITMLL 647



 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 51/68 (75%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +PSLSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++E  + +ILV  G
Sbjct: 94  VPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVAEG 153

Query: 66  TENIAVNS 73
           T ++ + +
Sbjct: 154 TRDVPIGA 161


>gi|257796245|ref|NP_663589.3| dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex, mitochondrial [Mus musculus]
 gi|146325018|sp|Q8BMF4|ODP2_MOUSE RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component of pyruvate dehydrogenase complex,
           mitochondrial; AltName: Full=Dihydrolipoamide
           acetyltransferase component of pyruvate dehydrogenase
           complex; AltName: Full=Pyruvate dehydrogenase complex
           component E2; Short=PDC-E2; Short=PDCE2; Flags:
           Precursor
 gi|20071885|gb|AAH26680.1| Dihydrolipoamide S-acetyltransferase (E2 component of pyruvate
           dehydrogenase complex) [Mus musculus]
 gi|47125065|gb|AAH69862.1| Dihydrolipoamide S-acetyltransferase (E2 component of pyruvate
           dehydrogenase complex) [Mus musculus]
 gi|148693804|gb|EDL25751.1| dihydrolipoamide S-acetyltransferase (E2 component of pyruvate
           dehydrogenase complex) [Mus musculus]
          Length = 642

 Score =  331 bits (848), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 183/437 (41%), Positives = 272/437 (62%), Gaps = 33/437 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 220 IVLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 279

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA--- 122
           T ++ + +P+  I+    +I          +  ++ + +  +P  V       +P+A   
Sbjct: 280 TRDVPLGAPLCIIVEKQEDIAAFADYRPTEVTSLKPQAAPPAPPPVAAVPPTPQPVAPTP 339

Query: 123 -------------SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYST 169
                        SPLA++LA E GIDL+ + G+GP GRI+K DI++ + +K      + 
Sbjct: 340 SAAPAGPKGRVFVSPLAKKLAAEKGIDLTQVKGTGPEGRIIKKDIDSFVPSKAAPAAAAA 399

Query: 170 IQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
           +   G       A +        +  IP  NIR+ IA RL QSKQTIPH+Y+S+D N+  
Sbjct: 400 MAPPGPRVAPAPAGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSVDVNMGE 451

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI-D 288
           +L +R+++N+ L     E   KISVND I+KA ALA ++VPEAN SW  + +IR  H+ D
Sbjct: 452 VLLVRKELNKML-----EGKGKISVNDFIIKASALACLKVPEANSSWM-DTVIRQNHVVD 505

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           +SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +ISN+GM
Sbjct: 506 VSVAVSTPAGLITPIVFNAHIKGLETIASDVVSLASKAREGKLQPHEFQGGTFTISNLGM 565

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGAIASK 406
            GI +F A+INPPQ+ ILAIGA E K++  + E    VA++M+ TLS DHR VDGA+ ++
Sbjct: 566 FGIKNFSAIINPPQACILAIGASEDKLIPADNEKGFDVASVMSVTLSCDHRVVDGAVGAQ 625

Query: 407 LLAKFKEYIENPVWMLM 423
            LA+FK+Y+E P+ ML+
Sbjct: 626 WLAEFKKYLEKPITMLL 642



 Score = 80.9 bits (198), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 52/70 (74%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
             + +PSLSPTM  G +A+W K+EG+KIS GD++ E+ETDKA + FES++E  + +ILVP
Sbjct: 91  QKVPLPSLSPTMQAGTIARWEKKEGEKISEGDLIAEVETDKATVGFESLEECYMAKILVP 150

Query: 64  AGTENIAVNS 73
            GT ++ V S
Sbjct: 151 EGTRDVPVGS 160


>gi|26327949|dbj|BAC27715.1| unnamed protein product [Mus musculus]
          Length = 642

 Score =  331 bits (848), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 183/437 (41%), Positives = 272/437 (62%), Gaps = 33/437 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 220 IVLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 279

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA--- 122
           T ++ + +P+  I+    +I          +  ++ + +  +P  V       +P+A   
Sbjct: 280 TRDVPLGAPLCIIVEKQEDIAAFADYRPTEVTSLKPQAAPPAPPPVAAVPPTPQPVAPTP 339

Query: 123 -------------SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYST 169
                        SPLA++LA E GIDL+ + G+GP GRI+K DI++ + +K      + 
Sbjct: 340 SAAPAGPKGRVFVSPLAKKLAAEKGIDLTQVKGTGPEGRIIKKDIDSFVPSKAAPAAAAA 399

Query: 170 IQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
           +   G       A +        +  IP  NIR+ IA RL QSKQTIPH+Y+S+D N+  
Sbjct: 400 MAPPGPRVAPAPAGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSVDVNMGE 451

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI-D 288
           +L +R+++N+ L     E   KISVND I+KA ALA ++VPEAN SW  + +IR  H+ D
Sbjct: 452 VLLVRKELNKML-----EGKGKISVNDFIIKASALACLKVPEANSSWM-DTVIRQNHVVD 505

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           +SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +ISN+GM
Sbjct: 506 VSVAVSTPAGLITPIVFNAHIKGLETIASDVVSLASKAREGKLQPHEFQGGTFTISNLGM 565

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGAIASK 406
            GI +F A+INPPQ+ ILAIGA E K++  + E    VA++M+ TLS DHR VDGA+ ++
Sbjct: 566 FGIKNFSAIINPPQACILAIGASEDKLIPADNEKGFDVASVMSVTLSCDHRVVDGAVGAQ 625

Query: 407 LLAKFKEYIENPVWMLM 423
            LA+FK+Y+E P+ ML+
Sbjct: 626 WLAEFKKYLEKPITMLL 642



 Score = 80.9 bits (198), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 52/70 (74%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
             + +PSLSPTM  G +A+W K+EG+KIS GD++ E+ETDKA + FES++E  + +ILVP
Sbjct: 91  QKVPLPSLSPTMQAGTIARWEKKEGEKISEGDLIAEVETDKATVGFESLEECYMAKILVP 150

Query: 64  AGTENIAVNS 73
            GT ++ V S
Sbjct: 151 EGTRDVPVGS 160


>gi|62898924|dbj|BAD97316.1| dihydrolipoamide S-acetyltransferase (E2 component of pyruvate
           dehydrogenase complex) variant [Homo sapiens]
          Length = 647

 Score =  330 bits (847), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 181/441 (41%), Positives = 271/441 (61%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 221 VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 280

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH--------------------SH 105
           T ++ + +P+  I+    +I          + +++ +                     + 
Sbjct: 281 TRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQAPPPTPPPVAAVPPTPQPLAPTP 340

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R   SPLA++LA E GIDL+ + G+GP GRI K DI++ + +K    
Sbjct: 341 SAPCPATPAGPKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPA 400

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +   G     +   +        +  IP  NIR+ IA RL QSKQTIPH+Y+SI+ 
Sbjct: 401 PAAVVPPTGPGMAPVPTGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSINV 452

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 453 NMGEVLLVRKELNKIL-----EGRSKISVNDFIIKASALACLKVPEANSSWM-DTVIRQN 506

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 507 HVVDVSVAVSTPAGLITPIVFNAHIKGVETIANDVVSLATKAREGKLQPHEFQGGTFTIS 566

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E K+V  + E    VA++M+ TLS DHR VDGA
Sbjct: 567 NLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGA 626

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 627 VGAQWLAEFRKYLEKPITMLL 647



 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 51/68 (75%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +PSLSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++E  + +ILV  G
Sbjct: 94  VPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVAEG 153

Query: 66  TENIAVNS 73
           T ++ + +
Sbjct: 154 TRDVPIGA 161


>gi|87199963|ref|YP_497220.1| dihydrolipoamide acetyltransferase, long form [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87135644|gb|ABD26386.1| Dihydrolipoamide acetyltransferase, long form [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 427

 Score =  330 bits (847), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 181/435 (41%), Positives = 262/435 (60%), Gaps = 29/435 (6%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            I MP+LSPTM EG LAKW+ + GDK+S GDI+ EIETDKA MEFE+VDEG I  I V  
Sbjct: 4   AIKMPALSPTMEEGTLAKWLVKVGDKVSSGDIMAEIETDKATMEFEAVDEGTIVSIDVAE 63

Query: 65  GTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHS----------HSSPVVVREK 114
           G+E + V + I  +  +  +     P +           +           +        
Sbjct: 64  GSEGVKVGTVIATLAGEDEDASAPAPKAVAPAAAPVPVPAPKAEPAPAAVSTPAPAAASA 123

Query: 115 HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETL-------ISTKTNVKDY 167
              +R IA+PLA+R+A + GIDL  ++GSGP+GRI+++D+E         +ST       
Sbjct: 124 SKGDRVIATPLAKRIAADKGIDLKGVAGSGPNGRIIRADVEGAKPAAAAPVSTVAPAVAS 183

Query: 168 STIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNI 227
           +   +        D  I        YE    +N+RKTIA RL ++KQTIPH Y+++D  +
Sbjct: 184 AAAPAR-APAAVPDFGI-------PYEAQKLNNVRKTIARRLTEAKQTIPHIYLTVDIRL 235

Query: 228 DNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI 287
           D LL LR  +N+ L+        K+SVND+I+KA A A++QVP+ NVS+  + +   K  
Sbjct: 236 DALLKLRGDLNKALEAQ----GVKLSVNDLIIKALAKALMQVPKCNVSFAGDELRSFKRA 291

Query: 288 DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMG 347
           DISVAV+ P G++TPII  A  KS+  I+ E+K LA +A++ KL+P EYQGGT S+SN+G
Sbjct: 292 DISVAVAAPSGLITPIIVDAGSKSVSAIATEMKALANKAREGKLQPHEYQGGTASLSNLG 351

Query: 348 MLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKL 407
           M GI +F AVINPPQ+ I+A+GAGE++    +  + +AT+M+AT S DHR++DGA  ++L
Sbjct: 352 MFGIKNFDAVINPPQAMIMAVGAGEQRPYVIDGALGIATVMSATGSFDHRAIDGADGAEL 411

Query: 408 LAKFKEYIENPVWML 422
           +  FK  IENP+ ++
Sbjct: 412 MQAFKNLIENPLGLV 426


>gi|327289746|ref|XP_003229585.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component
           of pyruvate dehydrogenase complex, mitochondrial-like
           [Anolis carolinensis]
          Length = 638

 Score =  330 bits (846), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 185/434 (42%), Positives = 268/434 (61%), Gaps = 31/434 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILV  G
Sbjct: 220 IALPALSPTMTMGTVQRWEKKLGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVEEG 279

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVV------------RE 113
           T ++ + +P+  I+   ++I          + E++     +SP  V            + 
Sbjct: 280 TRDVPLGTPLCIIVERESDIAAFADYKDAGVAEIKPPPPPASPAPVCAVAPPLPQPAAKG 339

Query: 114 KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN-VKDYSTIQS 172
              K R +ASPLA++LA E GIDLS + G+GP GRI K DIE+ + +K    +       
Sbjct: 340 PVHKGRVVASPLAKKLAAEKGIDLSQVKGTGPDGRITKKDIESFVPSKVAPARAAEPTPM 399

Query: 173 FGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232
                    A    +F       IP  NIRK IA RL QSKQTIPH+Y+SID N+ ++L 
Sbjct: 400 AVPAAIPAAAAPPGVFTD-----IPISNIRKVIAQRLMQSKQTIPHYYLSIDVNMGDILV 454

Query: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI-DISV 291
           LR+++N+         + K+SVND I+KA ALA ++VPEAN SW  + +IR  H+ D+SV
Sbjct: 455 LRKELNQ---------NTKLSVNDFIIKASALACMKVPEANSSWL-DTVIRQNHVVDVSV 504

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGI 351
           AVS P G++TPI+  A  K +  I+ +V  LA RA++ KLKP E+QGGT ++SN+GM GI
Sbjct: 505 AVSTPAGLITPIVFNAHAKGLASINQDVVTLAARAREGKLKPHEFQGGTFTVSNLGMYGI 564

Query: 352 NSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVAT--IMNATLSADHRSVDGAIASKLLA 409
            +F A+INPPQ+ ILA+G  E+++V  + E   AT  +M+ TLS DHR VDGA+ ++ LA
Sbjct: 565 KNFSAIINPPQACILAVGGSEQRLVPADNEKGFATSSVMSVTLSCDHRVVDGAVGAQWLA 624

Query: 410 KFKEYIENPVWMLM 423
           +FK+++E P  ML+
Sbjct: 625 EFKKFLEKPSTMLL 638



 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 59/80 (73%), Gaps = 1/80 (1%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +A+W K+EGDKIS GD++ E+ETDKA + FES++E  + +ILVP G
Sbjct: 89  VPLPALSPTMQMGTIARWEKKEGDKISEGDLIAEVETDKATVGFESLEECYLAKILVPEG 148

Query: 66  TENIAVNSPILNILMDSTEI 85
           T ++ + + I+ I +D  E+
Sbjct: 149 TRDVPIGA-IICITVDKPEL 167


>gi|297853204|ref|XP_002894483.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297340325|gb|EFH70742.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 550

 Score =  330 bits (845), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 185/452 (40%), Positives = 269/452 (59%), Gaps = 48/452 (10%)

Query: 6   ITMPSLSPTMTE------------GKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVD 53
           I MPSLSPTMTE            G +A+W+K+EGDK++PG++LCE+ETDKA +E E ++
Sbjct: 113 IGMPSLSPTMTEAWTFIYLLIETYGNIARWLKKEGDKVAPGEVLCEVETDKATVEMECME 172

Query: 54  EGIIDEILVPAGTENIAVNSPILNILMDSTEI-------PPS-----PPLSKENIVEVRE 101
           EG + +I+   G++ I V   I   + D  +I       P S     PP ++      +E
Sbjct: 173 EGYLAKIVKAEGSKEIQVGEVIAITVEDEEDIGKFKDYTPSSTADVAPPKAEPTPAPPKE 232

Query: 102 EHSHSSPVVVREKHSK-------NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDI 154
           E           K SK       +R  ASPLAR+LA ++ + L+++ G+GP GRIVK+DI
Sbjct: 233 EKVEQPSSPPEPKASKRSVSPTGDRVFASPLARKLAEDNNVPLANIKGTGPEGRIVKADI 292

Query: 155 ETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQ 214
           +  +++       S   +     +S D+    L     Y   PH  IRK  A RL  SKQ
Sbjct: 293 DEYLAS-------SGTGATAKPSKSTDSKAPAL----DYVDAPHSQIRKVTASRLAFSKQ 341

Query: 215 TIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANV 274
           TIPH+Y+++D  +D L+ LR Q+N    F       +ISVND+++KA ALA+ +VP+ N 
Sbjct: 342 TIPHYYLTVDTCVDKLMGLRSQLN---SFQEASGGKRISVNDLVVKAAALALRKVPQCNS 398

Query: 275 SWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPE 334
           SWT + + + K+++I+VAV    G+  P+++ AD+K +  I  EV+ LAQ+AK+  LKPE
Sbjct: 399 SWTDDYIRQFKNVNINVAVQTENGLYVPVVKDADKKGLSTIGEEVRLLAQKAKENSLKPE 458

Query: 335 EYQGGTTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQN--EEIKVATIMNAT 391
           +Y+GGT ++SN+G   GI  FCAV+NPPQ+ ILA+G  EK+VV  N  ++   A+ M  T
Sbjct: 459 DYEGGTFTVSNLGGPFGIKQFCAVVNPPQAAILAVGTAEKRVVPGNGADQFNFASYMPVT 518

Query: 392 LSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           LS DHR VDGAI ++ L  FK YIENP  ML+
Sbjct: 519 LSCDHRVVDGAIGAEWLKAFKGYIENPESMLL 550


>gi|301771442|ref|XP_002921137.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component
           of pyruvate dehydrogenase complex, mitochondrial-like
           [Ailuropoda melanoleuca]
 gi|281338776|gb|EFB14360.1| hypothetical protein PANDA_009979 [Ailuropoda melanoleuca]
          Length = 647

 Score =  330 bits (845), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 182/441 (41%), Positives = 274/441 (62%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +IL+P G
Sbjct: 221 VVLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILIPEG 280

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHS-----------------SP 108
           T ++ + +P+  I+    +IP         + +++ +   S                 +P
Sbjct: 281 TRDVPLGTPLCIIVEKEEDIPAFADYRPTEVTDLKPQAPPSTPPPVAPVPPTPQPLAPTP 340

Query: 109 VVVREKHS---KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
              R       + R   SPLA++LA E GIDL+ + G+GP GRI+K DI++ + TK    
Sbjct: 341 SATRPATPAGLRGRLFVSPLAKKLAAEKGIDLTHVKGTGPEGRIIKKDIDSFVPTKAAPA 400

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + + + G     +   +        +  +P  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 401 PAAAVPAAGPEVAPVPTGV--------FTDVPISNIRRVIAQRLMQSKQTIPHYYLSIDV 452

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 453 NMGEVLLVRKELNKML-----EGRSKISVNDFIIKASALACLKVPEANSSWL-DTVIRQN 506

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ DISVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 507 HVVDISVAVSTPAGLITPIVFNAHIKGLEAIANDVVSLATKAREGKLQPHEFQGGTFTIS 566

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E ++V  + E    VA++M+ TLS DHR VDGA
Sbjct: 567 NLGMFGIKNFSAIINPPQACILAIGASEDRLVPADNEKGFDVASMMSVTLSCDHRVVDGA 626

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 627 VGAQWLAEFRKYLEKPITMLL 647



 Score = 73.2 bits (178), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +PSLSPTM  G +A+W K+EG+KI+ G+++ E+ETDKA + FES++E  + +ILV  G
Sbjct: 94  VPLPSLSPTMQAGTIARWEKKEGEKINEGELIAEVETDKATVGFESLEECYMAKILVAEG 153

Query: 66  TENIAVNSPILNILMDSTE 84
           T ++ V + I+ I ++  E
Sbjct: 154 TRDVPVGA-IICITVEKPE 171


>gi|297269182|ref|XP_002799814.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component
           of pyruvate dehydrogenase complex, mitochondrial-like
           [Macaca mulatta]
          Length = 591

 Score =  329 bits (844), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 183/441 (41%), Positives = 271/441 (61%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 165 VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 224

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH--------------------SH 105
           T ++ + +P+  I+    +I          + +++ +                     + 
Sbjct: 225 TRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQAPPPTPPPVATVPPTPQPLAPTP 284

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R   SPLA++LA E GIDL+ + G+GP GRI K DI++ + +K    
Sbjct: 285 SAPCPATPAGPKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKAAPA 344

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +   G     +   +        +  IP  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 345 PAAVVPPTGPGMAPVPTGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDV 396

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 397 NMGEVLLVRKELNKIL-----EGRSKISVNDFIIKASALACLKVPEANSSWM-DTVIRQN 450

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 451 HVVDVSVAVSTPAGLITPIVFNAHIKGLETIANDVVSLAAKAREGKLQPHEFQGGTFTIS 510

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E K+V  + E    VA++M+ TLS DHR VDGA
Sbjct: 511 NLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGA 570

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E PV ML+
Sbjct: 571 VGAQWLAEFRKYLEKPVTMLL 591



 Score = 76.6 bits (187), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 52/70 (74%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
           + + +PSLSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++E  + +ILV 
Sbjct: 36  YRVPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVA 95

Query: 64  AGTENIAVNS 73
            GT ++ + +
Sbjct: 96  EGTRDVPIGA 105


>gi|58699353|ref|ZP_00374125.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Wolbachia endosymbiont of Drosophila ananassae]
 gi|58534131|gb|EAL58358.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Wolbachia endosymbiont of Drosophila ananassae]
          Length = 435

 Score =  329 bits (844), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 183/458 (39%), Positives = 273/458 (59%), Gaps = 84/458 (18%)

Query: 6   ITMPSLSPTM--TEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
           I MP+LSPTM  T GK+ KW K+E DK+  GD++ EIETDKAIMEFES+DEG++ +ILV 
Sbjct: 5   ILMPALSPTMSKTGGKIVKWHKKEQDKVEVGDVIAEIETDKAIMEFESIDEGVLAKILVT 64

Query: 64  AGTENIAVNSPILNILMD-----------STEIPPS--PPLSKENIVEVREEH------- 103
            GT  + VN PI  +L +           ST I  +    ++K  +   + EH       
Sbjct: 65  EGTSGVPVNQPIALMLEEGEDESALNNYTSTSINSAVKKEVTKSAVDNQKSEHQDLNGKP 124

Query: 104 -SHSSPVVVR--------------------------------EKHSKNRPIASPLARRLA 130
            SHSS    R                                E +++ R   SPLA+++A
Sbjct: 125 ISHSSVSFQRVTLESNPSMSSQCLTLGSRKEEWIPVSATQMTEGYAEGRTKISPLAKKIA 184

Query: 131 GEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAK 190
              G+++  L G+GP+GRI+K+D+   + +             G+  ES +        K
Sbjct: 185 QNEGVNVQQLKGTGPYGRIIKADVLEFLGS-------------GIHTESPE--------K 223

Query: 191 DSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISN 250
           D+  ++   N+R+ IA RL +SKQ +PHFY+++DC +D L+SL+ ++N   +      +N
Sbjct: 224 DT--IVEVSNMRQVIAQRLTESKQNVPHFYLTVDCQVDKLISLKNEINSADE------NN 275

Query: 251 KISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQK 310
           K+++ND+I+KA A +M + P+ N SW  N ++R+ +IDIS+AV++  G++TPI++ AD+K
Sbjct: 276 KVTINDLIIKAAAFSMKKFPDINSSWIDNKILRYSNIDISIAVALEDGLITPIVKNADKK 335

Query: 311 SILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGA 370
            IL IS EVK L  RA+  KLKPEE+QGG  +ISN+GM GI +F A+INPPQS I+A+GA
Sbjct: 336 GILSISKEVKDLVSRARSGKLKPEEFQGGGFTISNLGMFGIKAFSAIINPPQSCIMAVGA 395

Query: 371 GEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLL 408
            +K+ +  NE+I++A IM  TLS DHR+VDGA+ +K L
Sbjct: 396 SKKQPIVMNEKIEIAEIMTVTLSVDHRAVDGALGAKFL 433


>gi|109108634|ref|XP_001107013.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component
           of pyruvate dehydrogenase complex, mitochondrial-like
           isoform 2 [Macaca mulatta]
          Length = 647

 Score =  329 bits (843), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 183/441 (41%), Positives = 271/441 (61%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 221 VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 280

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH--------------------SH 105
           T ++ + +P+  I+    +I          + +++ +                     + 
Sbjct: 281 TRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQAPPPTPPPVATVPPTPQPLAPTP 340

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R   SPLA++LA E GIDL+ + G+GP GRI K DI++ + +K    
Sbjct: 341 SAPCPATPAGPKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKAAPA 400

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +   G     +   +        +  IP  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 401 PAAVVPPTGPGMAPVPTGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDV 452

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 453 NMGEVLLVRKELNKIL-----EGRSKISVNDFIIKASALACLKVPEANSSWM-DTVIRQN 506

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 507 HVVDVSVAVSTPAGLITPIVFNAHIKGLETIANDVVSLAAKAREGKLQPHEFQGGTFTIS 566

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E K+V  + E    VA++M+ TLS DHR VDGA
Sbjct: 567 NLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGA 626

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E PV ML+
Sbjct: 627 VGAQWLAEFRKYLEKPVTMLL 647



 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 51/70 (72%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
             + +PSLSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++E  + +ILV 
Sbjct: 92  QKVPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVA 151

Query: 64  AGTENIAVNS 73
            GT ++ + +
Sbjct: 152 EGTRDVPIGA 161


>gi|149495728|ref|XP_001509202.1| PREDICTED: similar to dihydrolipoamide acetyltransferase
           [Ornithorhynchus anatinus]
          Length = 536

 Score =  328 bits (842), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 182/441 (41%), Positives = 272/441 (61%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILV  G
Sbjct: 110 VQLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVAEG 169

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHS--------------------H 105
           T ++ + +P+  I+    +IP         +V+++ + S                     
Sbjct: 170 TRDVPLGTPLCIIVEKEADIPAFADYQPTAVVDMKPQPSPSTPASAAAFAASPQPASPAP 229

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
            +        SK R   SPLAR+LA E GIDL+ + G+GP GRI K DI++ + ++    
Sbjct: 230 PAARPAAPAGSKARLYVSPLARKLATEKGIDLAQVKGTGPDGRITKKDIDSFVPSRAAPA 289

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + + S         A +        +  IP  NIR+ IA RL QSKQTIPH+Y+S+D 
Sbjct: 290 PAAAVPSLTPEVAVAPAGV--------FTDIPVSNIRRVIAQRLMQSKQTIPHYYLSVDV 341

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L       S+KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 342 NMGEVLLVRKELNKMLAG-----SSKISVNDFIIKASALACLKVPEANSSWL-DTVIRQN 395

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 396 HVVDVSVAVSTPAGLITPIVFNAHIKGLESIANDVVSLAAKAREGKLQPHEFQGGTFTIS 455

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVV-FQNEE-IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E ++V  +NE    VA++M+ TLS DHR VDGA
Sbjct: 456 NLGMFGIKNFSAIINPPQACILAIGASEDRLVPAENERGFDVASMMSVTLSCDHRVVDGA 515

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++++E P+ ML+
Sbjct: 516 VGAQWLAEFRKFLEKPINMLL 536


>gi|21594641|gb|AAH31495.1| Dihydrolipoamide S-acetyltransferase (E2 component of pyruvate
           dehydrogenase complex) [Mus musculus]
          Length = 642

 Score =  328 bits (842), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 182/437 (41%), Positives = 271/437 (62%), Gaps = 33/437 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 220 IVLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 279

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA--- 122
           T ++ + +P+  I+    +I          +  ++ + +  +P  V       +P+A   
Sbjct: 280 TRDVPLGAPLCIIVEKQEDIAAFADYRPTEVTSLKPQAAPPAPPPVAAVPPTPQPVAPTP 339

Query: 123 -------------SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYST 169
                        SPLA++LA E GIDL+ + G+GP GRI+K DI++ + +K      + 
Sbjct: 340 SAAPAGPKGRVFVSPLAKKLAAEKGIDLTQVKGTGPEGRIIKKDIDSFVPSKAVPAAAAA 399

Query: 170 IQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
           +   G       A +        +  IP  NIR+ IA RL QSKQTIPH+Y+S+D N+  
Sbjct: 400 MAPPGPRVAPAPAGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSVDVNMGE 451

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI-D 288
           +L +R+++N+ L     E   KISVND I+KA ALA ++VPEAN SW  + +IR  H+ D
Sbjct: 452 VLLVRKELNKML-----EGKGKISVNDFIIKASALACLKVPEANSSWM-DTVIRQNHVVD 505

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           +SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +ISN+GM
Sbjct: 506 VSVAVSTPAGLITPIVFNAHIKGLETIASDVVSLASKAREGKLQPHEFQGGTFTISNLGM 565

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGAIASK 406
            GI +F A+INPPQ+ ILAIGA E K++  + E    V ++M+ TLS DHR VDGA+ ++
Sbjct: 566 FGIKNFSAIINPPQACILAIGASEDKLIPADNEKGFDVVSVMSVTLSCDHRVVDGAVGAQ 625

Query: 407 LLAKFKEYIENPVWMLM 423
            LA+FK+Y+E P+ ML+
Sbjct: 626 WLAEFKKYLEKPITMLL 642



 Score = 80.9 bits (198), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 52/70 (74%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
             + +PSLSPTM  G +A+W K+EG+KIS GD++ E+ETDKA + FES++E  + +ILVP
Sbjct: 91  QKVPLPSLSPTMQAGTIARWEKKEGEKISEGDLIAEVETDKATVGFESLEECYMAKILVP 150

Query: 64  AGTENIAVNS 73
            GT ++ V S
Sbjct: 151 EGTRDVPVGS 160


>gi|194212681|ref|XP_001501871.2| PREDICTED: similar to dihydrolipoamide acetyltransferase [Equus
           caballus]
          Length = 647

 Score =  328 bits (841), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 181/440 (41%), Positives = 273/440 (62%), Gaps = 35/440 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +IL+P G
Sbjct: 221 VVLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILIPEG 280

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHS--------- 116
           T ++ + +P+  I+    +IP         + +++ +   + P V     +         
Sbjct: 281 TRDVPLGTPLCIIVEKEADIPAFADYRPTEVTDLKPQAPPTPPPVASVPPTPQPVTPTPS 340

Query: 117 ----------KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKD 166
                     K R   SPLA++LA E GIDL+ + G+GP GRIVK DI++ + TK     
Sbjct: 341 AACPAAPAGPKGRLFVSPLAKKLAAEKGIDLTQVKGTGPEGRIVKKDIDSFVPTKAAPAP 400

Query: 167 YSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
            + +    +   +     +       +  IP  NIR+ IA RL QSKQTIPH+Y+SID N
Sbjct: 401 AAAVPPPAVPGVAPVPTGV-------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDVN 453

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           +  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  H
Sbjct: 454 MGEVLLVRKELNKML-----EGRSKISVNDFIIKASALACLKVPEANSSWL-DTVIRQNH 507

Query: 287 I-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
           + DISVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +ISN
Sbjct: 508 VVDISVAVSTPAGLITPIVFNAHIKGLETIANDVVSLATKAREGKLQPHEFQGGTFTISN 567

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGAI 403
           +GM GI +F A+INPPQ+ ILA+GA E +++  + E    VA++M+ TLS DHR VDGA+
Sbjct: 568 LGMFGIKNFSAIINPPQACILAVGASEDRLLPADNEKGFDVASMMSVTLSCDHRVVDGAV 627

Query: 404 ASKLLAKFKEYIENPVWMLM 423
            ++ LA+F++Y+E P+ ML+
Sbjct: 628 GAQWLAEFRKYLEKPITMLL 647



 Score = 73.9 bits (180), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 51/70 (72%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +PSLSPTM  G +A+W K+EG+KI+ G+++ E+ETDKA + FES +E  + +ILV  G
Sbjct: 94  VPLPSLSPTMQAGTIARWEKKEGEKINEGELIAEVETDKATVGFESTEECYMAKILVAEG 153

Query: 66  TENIAVNSPI 75
           T ++ V S I
Sbjct: 154 TRDVPVGSVI 163


>gi|291383892|ref|XP_002708492.1| PREDICTED: dihydrolipoamide S-acetyltransferase [Oryctolagus
           cuniculus]
          Length = 646

 Score =  328 bits (841), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 180/441 (40%), Positives = 269/441 (60%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K++ GD+L EIETDKA + FE  +EG + +IL+P G
Sbjct: 220 VLLPALSPTMTMGTVQRWEKKVGEKLNEGDLLAEIETDKATIGFEVQEEGYLAKILIPEG 279

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHS--------- 116
           T ++ + +P+  I+    +I          + +++ +     P  V              
Sbjct: 280 TRDVPLGTPLCIIVEKEADISAFADYRPTEVADLKPQAPPPVPPPVATAAPTPQPSAPTP 339

Query: 117 -----------KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
                      K R   SPLA++LA E GIDL+ + G+GP GRI+K DI++ + TK    
Sbjct: 340 SAALPAAPAGPKGRVFVSPLAKKLAAEKGIDLTQVKGTGPDGRIIKKDIDSFVPTKAAPA 399

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +         +   +        +  IP  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 400 PAAAVPPPSPGVAPVPTGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDV 451

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 452 NMGEVLLVRKELNKML-----EGKSKISVNDFIIKASALACLKVPEANSSWM-DTVIRQN 505

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G++TPI+  A  K +  I+ +V  LA RA++ KL+P E+QGGT +IS
Sbjct: 506 HVVDVSVAVSTPAGLITPIVFNAHIKGLETIANDVVSLASRAREGKLQPHEFQGGTFTIS 565

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILA+GA E K+V  + E    VA++M+ TLS DHR VDGA
Sbjct: 566 NLGMFGIKNFSAIINPPQACILAVGASEDKLVPADNEKGFDVASVMSVTLSCDHRVVDGA 625

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 626 VGAQWLAEFRKYLEKPITMLL 646



 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 51/70 (72%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
             + +PSLSPTM  G +A+W K+EG+KI+ GD++ E+ETDKA + FES++E  + +ILV 
Sbjct: 92  QKVPLPSLSPTMQAGTIARWEKKEGEKINEGDLIAEVETDKATVGFESLEECYMAKILVS 151

Query: 64  AGTENIAVNS 73
            GT ++ V +
Sbjct: 152 EGTRDVPVGA 161


>gi|91977279|ref|YP_569938.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Rhodopseudomonas palustris BisB5]
 gi|91683735|gb|ABE40037.1| Dihydrolipoamide acetyltransferase, long form [Rhodopseudomonas
           palustris BisB5]
          Length = 473

 Score =  328 bits (840), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 154/317 (48%), Positives = 225/317 (70%), Gaps = 11/317 (3%)

Query: 114 KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIET------LISTKTNVKDY 167
           + S  R  +SPLARRLA + GIDL+ + G+GPHGR++  D+E       L +        
Sbjct: 161 QSSDARVFSSPLARRLAKDAGIDLARVEGTGPHGRVIARDVEQAKAGGGLKAPAAAASSA 220

Query: 168 STIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNI 227
           +   +  + D+ I A    L+ + SYE +PHD +R+TIA RL QS QTIPHFY++IDCN+
Sbjct: 221 APAVAPSMSDQQIRA----LYPEGSYEAVPHDGMRRTIAQRLTQSTQTIPHFYLTIDCNL 276

Query: 228 DNLLSLREQMNRTLQFHRE-EISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           D L++ RE +N      ++ + + K+SVND ++KA A+A+ ++P+ANVSWT   M++H+H
Sbjct: 277 DRLMAAREDINAAAPKDKDGKPAYKLSVNDFVIKAMAVALQRIPDANVSWTEAGMLKHRH 336

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
            DI VAV++PGG++TPIIR A+  S+  IS ++K  A RA+ RKLKP+EYQGGTT+ISN+
Sbjct: 337 SDIGVAVAMPGGLITPIIRSAETASLSAISKQMKDFAARARARKLKPDEYQGGTTAISNL 396

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASK 406
           GM GI  F AVINPP +TILA+GAGE++ + ++ +I++AT+M+ TLS DHR+VDGA+ ++
Sbjct: 397 GMYGIKDFTAVINPPHATILAVGAGEQRPIVRDGKIEIATMMSVTLSCDHRAVDGALGAE 456

Query: 407 LLAKFKEYIENPVWMLM 423
           L+  FK  IENPV M++
Sbjct: 457 LIGAFKTLIENPVMMMV 473



 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 61/80 (76%)

Query: 6  ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
          I MP+LSPTM +G LAKW+K+EGDK+  GD++ EIETDKA ME E+ DEG + +ILVP G
Sbjct: 5  ILMPALSPTMEKGNLAKWLKKEGDKVKSGDVIAEIETDKATMEVEASDEGTLAKILVPEG 64

Query: 66 TENIAVNSPILNILMDSTEI 85
          T+++AVN+ I  +  D  ++
Sbjct: 65 TQDVAVNAVIAVLAGDGEDV 84


>gi|47227166|emb|CAG00528.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 426

 Score =  327 bits (839), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 178/434 (41%), Positives = 263/434 (60%), Gaps = 26/434 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           IT+P+LSPTMT G + +W K+ G+K+  GD+L EIETDKA + FE  +EG + +I+VP G
Sbjct: 3   ITLPALSPTMTMGTVQRWEKKVGEKLGEGDLLAEIETDKATIGFEVQEEGYLAKIMVPEG 62

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHS--------- 116
           T ++ + +P+  I+   ++I       +  + +V       +P                 
Sbjct: 63  TRDVPLGTPLCIIVEKESDIAAFKDYVETGVADVSTPAPAPAPAPATPTPGPAAAAAAAP 122

Query: 117 ----KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQS 172
               K R   SPLA++LA E GIDL+ +SGSGP GRI K DI+  +  K      +   +
Sbjct: 123 SGPRKGRVFISPLAKKLAAEKGIDLAQVSGSGPDGRITKKDIDGFVPPKAAPVTAAAAAA 182

Query: 173 FGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232
                 +        F       +P  NIRK IA RL QSKQTIPH+Y+S+D N+D +L 
Sbjct: 183 AAPAPTTAAGAPAGTFTD-----VPISNIRKVIAQRLMQSKQTIPHYYLSVDVNMDQVLE 237

Query: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI-DISV 291
           LR+++N  ++      + K+SVND I+KA ALA ++VPE N SW  + +IR  H+ D+SV
Sbjct: 238 LRKELNDEVKAQ----NIKLSVNDFIIKASALACLKVPECNSSWM-DTLIRQNHVVDVSV 292

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGI 351
           AVS   G++TPI+  A  K +  IS +V  LA +A++ KL+P E+QGGT +ISN+GM G+
Sbjct: 293 AVSTANGLITPIVFNAHTKGLSAISSDVSALAAKAREGKLQPHEFQGGTFTISNLGMFGV 352

Query: 352 NSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGAIASKLLA 409
            +F A+INPPQS ILA+G  EK+++  + E    VA++M+ TLS DHR VDGA+ ++ LA
Sbjct: 353 KNFSAIINPPQSCILAVGGSEKRLLPADNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLA 412

Query: 410 KFKEYIENPVWMLM 423
           +F+ ++E PV ML+
Sbjct: 413 EFRRFLEKPVTMLL 426


>gi|218189878|gb|EEC72305.1| hypothetical protein OsI_05488 [Oryza sativa Indica Group]
          Length = 548

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 180/443 (40%), Positives = 267/443 (60%), Gaps = 44/443 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +A+W+K+EGDK+SPG++LCE+ETDKA +E E ++E  + +I+   G
Sbjct: 125 IGMPSLSPTMTEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEESYLAKIIHGDG 184

Query: 66  TENIAVNSPI---------LNILMD----STEIPPSP------PLSKENIVEVREEHSHS 106
            + I V   I         L    D    ++ +P +P      P   E  V+  E     
Sbjct: 185 AKEIKVGEIIAVTVEEEGDLERFKDYKPSTSAVPAAPSELKAQPEPAEPKVKETEPSRIP 244

Query: 107 SPVVVREKHSK---NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
            P   + + +     R  +SPLAR+LA ++ + LSS+ G+GP GRI+K+DIE  +++   
Sbjct: 245 EPKAPKTEEASQPGGRIFSSPLARKLAEDNNVPLSSVMGTGPDGRILKADIEDYLASVAK 304

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
                 + + GL                SY  +P+  IRK  A RL  SKQTIPH+Y+++
Sbjct: 305 GGKREALAAPGL----------------SYTDVPNTQIRKVTANRLLSSKQTIPHYYLTV 348

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           D  +D L+ LR ++N            KIS+ND+++KA ALA+ +VP+ N SW ++ + +
Sbjct: 349 DARVDKLIKLRGELN---PLQESSGGKKISINDLVIKAAALALRKVPQCNSSWMSDFIRQ 405

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
           + +++I+VAV    G+  P+IR AD+K +  I+ EVKQ+AQRA+   LKPE+Y+GGT +I
Sbjct: 406 YHNVNINVAVQTEHGLFVPVIRDADKKGLGTIAEEVKQVAQRARDNSLKPEDYEGGTFTI 465

Query: 344 SNMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQ--NEEIKVATIMNATLSADHRSVD 400
           SN+G   GI  FCA+INPPQS ILAIG  EK+V+    + + +  + M+AT+S DHR +D
Sbjct: 466 SNLGGPFGIKQFCAIINPPQSAILAIGTAEKRVIPGSVDGQYEFGSFMSATMSCDHRVID 525

Query: 401 GAIASKLLAKFKEYIENPVWMLM 423
           GAI ++ L  FK YIENP  ML+
Sbjct: 526 GAIGAEFLKAFKGYIENPNSMLL 548


>gi|148255817|ref|YP_001240402.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Bradyrhizobium sp. BTAi1]
 gi|146407990|gb|ABQ36496.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Bradyrhizobium sp. BTAi1]
          Length = 452

 Score =  326 bits (836), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 156/310 (50%), Positives = 219/310 (70%), Gaps = 5/310 (1%)

Query: 119 RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTK----TNVKDYSTIQSFG 174
           R  +SPLARRLA + GIDL+ ++G+GPHGR+V  D+E   S K          +   +  
Sbjct: 143 RVFSSPLARRLAKDAGIDLARITGTGPHGRVVARDVEEAKSGKGLKAAPSAAPAAAGAPA 202

Query: 175 LVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLR 234
           L     D  IL LF   SYEVIPHD +R+TIA RL  S Q +PHFY++IDC+I  LL+ R
Sbjct: 203 LAPSMSDKQILALFEPGSYEVIPHDGMRRTIAQRLTASVQNVPHFYLTIDCDIGKLLTAR 262

Query: 235 EQMNRTLQFHREEIS-NKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAV 293
           E++N      +E+    K+SVND ++KA A+A+ ++P  NVSWT   M++HKH D+ VAV
Sbjct: 263 EEINAAAPKDKEKKPLYKLSVNDFVIKAMAVALQKIPNCNVSWTEGGMVKHKHSDVGVAV 322

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
           ++PGG++TPIIR+A+ K++  IS E+K  A RA+ RKLKPEEYQGGTT++SN+GM GIN 
Sbjct: 323 AMPGGLITPIIRKAETKTLSAISGEMKDFAARARSRKLKPEEYQGGTTAVSNLGMYGINH 382

Query: 354 FCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKE 413
           F AVINPP +TILA+G  E++ V +N +I++A +M+ TLS DHR++DGA+ ++L+  FK+
Sbjct: 383 FTAVINPPHATILAVGTSEERPVVRNGKIEIANMMSVTLSCDHRAIDGALGAELIGAFKQ 442

Query: 414 YIENPVWMLM 423
            IENPV M++
Sbjct: 443 LIENPVMMMV 452


>gi|146341013|ref|YP_001206061.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Bradyrhizobium sp. ORS278]
 gi|146193819|emb|CAL77836.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex (E2) (Dihydrolipoamide
           acetyltransferase component of pyruvate dehydrogenase
           complex) [Bradyrhizobium sp. ORS278]
          Length = 452

 Score =  326 bits (836), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 154/310 (49%), Positives = 219/310 (70%), Gaps = 5/310 (1%)

Query: 119 RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTK----TNVKDYSTIQSFG 174
           R  +SPLARRLA + GIDL  ++G+GPHGR+V  D+E   S K          +   +  
Sbjct: 143 RIFSSPLARRLAKDAGIDLGRITGTGPHGRVVARDVEEAKSGKGLKAAPSAAPAAAGAPA 202

Query: 175 LVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLR 234
           +     D  IL LF   SYEVIPHD +R+TIA RL  + QT+PHFY++IDC+I  LL+ R
Sbjct: 203 VAPSMSDKQILALFEPGSYEVIPHDGMRRTIAQRLTAATQTVPHFYLTIDCDIGKLLAAR 262

Query: 235 EQMNRTLQFHREEIS-NKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAV 293
           E++N      +E+    K+SVND ++KA A+A+ ++P  NVSWT   M++HKH D+ VAV
Sbjct: 263 EEINAAAPKDKEKKPLYKLSVNDFVIKAMAVALQKIPNCNVSWTEGGMVKHKHSDVGVAV 322

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
           ++PGG++TPIIR+A+ K++  IS E+K  A RA+ RKLKPEEYQGGTT++SN+GM GI  
Sbjct: 323 AMPGGLITPIIRKAETKTLSAISGEMKDFAARARSRKLKPEEYQGGTTAVSNLGMYGITH 382

Query: 354 FCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKE 413
           F AVINPP +TILA+G  E++ V +N +I++A++M+ TLS DHR++DGA+ ++L+  FK+
Sbjct: 383 FTAVINPPHATILAVGTSEERPVVRNGKIEIASMMSVTLSCDHRAIDGALGAELIGAFKQ 442

Query: 414 YIENPVWMLM 423
            IENPV M++
Sbjct: 443 LIENPVMMMV 452


>gi|58415022|gb|AAW73086.1| pyruvate dehydrogenase dihydrolipoamide acyltransferase E2
           component [Novosphingobium aromaticivorans]
          Length = 489

 Score =  326 bits (835), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 177/428 (41%), Positives = 257/428 (60%), Gaps = 15/428 (3%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            I MP+LSPTM EG LAKW+ + GDK+S GDI+ EIETDKA MEFE+VDEG I  I V  
Sbjct: 66  AIKMPALSPTMEEGTLAKWLVKVGDKVSSGDIMAEIETDKATMEFEAVDEGTIVSIDVAE 125

Query: 65  GTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHS----------HSSPVVVREK 114
           G+E + V + I  +  +  +     P +           +           +        
Sbjct: 126 GSEGVKVGTVIATLAGEDEDASAPAPKAVAPAAAPVPVPAPKAEPAPAAVSTPAPAAASA 185

Query: 115 HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFG 174
              +R IA+PLA+R+A + GIDL  ++GSGP+GRI+++D+E                   
Sbjct: 186 SKGDRVIATPLAKRIAADKGIDLKGVAGSGPNGRIIRADVEGAKPAAAAPVSTVAPAVAS 245

Query: 175 LVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLR 234
               +     +  F    YE    +N+RKTIA RL ++KQTIPH Y+++D  +D LL LR
Sbjct: 246 AAAPARAPAAVPDFGI-PYEAQKLNNVRKTIARRLTEAKQTIPHIYLTVDIRLDALLKLR 304

Query: 235 EQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVS 294
             +N+ L+        K+SVND+I+KA A A++QVP+ NVS+  + +   K  DISVAV+
Sbjct: 305 GDLNKALEAQ----GVKLSVNDLIIKALAKALMQVPKCNVSFAGDELRSFKRADISVAVA 360

Query: 295 IPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSF 354
            P G++TPII  A  KS+  I+ E+K LA +A++ KL+P EYQGGT S+SN+GM  I +F
Sbjct: 361 APSGLITPIIVDAGSKSVSAIATEMKALANKAREGKLQPHEYQGGTASLSNLGMFSIKNF 420

Query: 355 CAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEY 414
            AVINPPQ+ I+A+GAGE++    +  + +AT+M+AT S DHR++DGA  ++L+  FK  
Sbjct: 421 DAVINPPQAMIMAVGAGEQRPYVIDGALGIATVMSATGSFDHRAIDGADGAELMQAFKNL 480

Query: 415 IENPVWML 422
           IENP+ ++
Sbjct: 481 IENPLGLV 488


>gi|16580128|gb|AAL02400.1| dihydrolipoamide S-acetyltransferase precursor [Mus musculus]
          Length = 559

 Score =  325 bits (834), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 181/437 (41%), Positives = 269/437 (61%), Gaps = 33/437 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I +P+ SPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +I VP G
Sbjct: 137 IVLPAPSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKIXVPEG 196

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA--- 122
           T ++ + +P   I+    +I          +  ++ + +  +P  V       +P+A   
Sbjct: 197 TRDVPLGAPXCIIVEKQEDIAAFADYRPTEVTSLKPQAAPPAPPPVAAVPPTPQPVAPTP 256

Query: 123 -------------SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYST 169
                        SPLA++LA E GIDL+ + G+GP GRI+K DI++ + +K      + 
Sbjct: 257 SAAPAGPKGRVFVSPLAKKLAAEKGIDLTQVKGTGPEGRIIKKDIDSFVPSKAAPAAAAA 316

Query: 170 IQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
           +   G       A +        +  IP  NIR+ IA RL QSKQTIPH+Y+S+D N+  
Sbjct: 317 MAPPGPRVAPAPAGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSVDVNMGE 368

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI-D 288
           +L +R+++N+ L     E   KISVND I+KA ALA ++VPEAN SW  + +IR  H+ D
Sbjct: 369 VLLVRKELNKML-----EGKGKISVNDFIIKASALACLKVPEANSSWM-DTVIRQNHVVD 422

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           +SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +ISN+GM
Sbjct: 423 VSVAVSTPAGLITPIVFNAHIKGLETIASDVVSLASKAREGKLQPHEFQGGTFTISNLGM 482

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGAIASK 406
            GI +F A+INPPQ+ ILAIGA E K++  + E    VA++M+ TLS DHR VDGA+ ++
Sbjct: 483 FGIKNFSAIINPPQACILAIGASEDKLIPADNEKGFDVASVMSVTLSCDHRVVDGAVGAQ 542

Query: 407 LLAKFKEYIENPVWMLM 423
            LA+FK+Y+E P+ ML+
Sbjct: 543 WLAEFKKYLEKPITMLL 559



 Score = 80.5 bits (197), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 52/68 (76%)

Query: 6  ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
          + +PSLSPTM  G +A+W K+EG+KIS GD++ E+ETDKA + FES++E  + +ILVP G
Sbjct: 10 VPLPSLSPTMQAGTIARWEKKEGEKISEGDLIAEVETDKATVGFESLEECYMAKILVPEG 69

Query: 66 TENIAVNS 73
          T ++ V S
Sbjct: 70 TRDVPVGS 77


>gi|332286043|ref|YP_004417954.1| dihydrolipoamide acetyltransferase [Pusillimonas sp. T7-7]
 gi|330429996|gb|AEC21330.1| dihydrolipoamide acetyltransferase [Pusillimonas sp. T7-7]
          Length = 420

 Score =  325 bits (832), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 175/438 (39%), Positives = 255/438 (58%), Gaps = 34/438 (7%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP ++       +  W KQEGD ++ GD L EIET+KA++EF +   G++ +IL
Sbjct: 1   MATLIRMPEVAANTDSAVIVSWTKQEGDAVAQGDCLAEIETEKAVIEFNAEQSGVLGKIL 60

Query: 62  VPAGTENIAVNSPILNIL------MDSTEIPPSPPLSKENIVEVREEHSHSSPVV----- 110
           V AG E + V +PI  +       +D   +      + +    V    + + P V     
Sbjct: 61  VQAGKE-VEVGTPIAALFAPGEKSVDIAALLSESADAGDEANAVTSGDTDARPTVQEPAP 119

Query: 111 -----VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
                   KH   R  ASPLA+RLA + GIDLS L GSGP GR+VK D+           
Sbjct: 120 IATAAAAGKH--ERIFASPLAKRLARDAGIDLSGLKGSGPQGRVVKRDVLAAQPAAPATA 177

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
                           A         SY  +PH ++R+TIA RL +SKQT+PHFY+  DC
Sbjct: 178 VAGAPAQA--------AVAPAAGQTQSYTDVPHTSMRRTIARRLSESKQTVPHFYLRADC 229

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
            +D LL++R+Q+N++        + K+SVNDII+KA A A+ Q+PE NVSWT +A+  + 
Sbjct: 230 RMDALLAMRKQINQSG-------ARKVSVNDIIVKAVAAALRQLPEMNVSWTESALRHYS 282

Query: 286 HIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
            IDISVAVS P G++TP+++  D KS+  +SL++  LA RA++ KL P+EYQGG+ ++SN
Sbjct: 283 DIDISVAVSTPTGLITPVVKGVDTKSLSVVSLDIADLAHRAREGKLAPQEYQGGSFTVSN 342

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIAS 405
           +GM G+  F A+INPPQ+ ILA+G  E++    +  + +A++M  TLS DHR++DGA+A+
Sbjct: 343 LGMYGVQEFAAIINPPQAAILAVGGFEQRPAVIDGALGIASLMTVTLSVDHRAIDGALAA 402

Query: 406 KLLAKFKEYIENPVWMLM 423
           K L  FK  IENP+  L+
Sbjct: 403 KWLGIFKSVIENPLSALI 420


>gi|321258612|ref|XP_003194027.1| dihydrolipoyllysine-residue acetyltransferase [Cryptococcus gattii
           WM276]
 gi|317460497|gb|ADV22240.1| Dihydrolipoyllysine-residue acetyltransferase, putative
           [Cryptococcus gattii WM276]
          Length = 476

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 185/466 (39%), Positives = 270/466 (57%), Gaps = 69/466 (14%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +    MP++SPTMTEG +A+W K+EG+  S GD+L EIETDKA ++ E+ D+G++ +I+ 
Sbjct: 35  LSKFAMPAMSPTMTEGGIAQWKKKEGESFSAGDVLIEIETDKATIDVEAQDDGVMAKIIA 94

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVE--------------VREEHS---- 104
             G +NIAV +PI  +  +  ++  +  L+ E+  E              V +E S    
Sbjct: 95  QDGAKNIAVGTPIAILAEEGDDLSQADALAAESQSESASQKEAAPKEEKPVSKEKSEPST 154

Query: 105 -----------------HSSPVVVREKHSK-NRP--IASPLARRLAGEHGIDLSSLSGSG 144
                             +SP    E  SK +RP   ASPLAR++A E+G+ L+ + G+G
Sbjct: 155 TPAVGTPGEQKFGSGDAQTSPAKAPEHPSKGDRPKFFASPLARKIALENGVPLAEIKGTG 214

Query: 145 PHGRIVKSDIETLISTKTNVKDY--STIQSFGLVDE--SIDANILNLFAKDSYEVIPHDN 200
           P+GRI+++D          VK+Y  S   S   V +  ++ A+         YE IP  N
Sbjct: 215 PNGRIIEAD----------VKNYKPSAAASTSAVGKPAAVPAD---------YEDIPTSN 255

Query: 201 IRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILK 260
           +R+TI  RL +SKQ +PH+YV+++ N+D +L LRE  N+       E   K+SVND I+K
Sbjct: 256 MRRTIGKRLTESKQQLPHYYVTVEVNMDRVLKLREVFNKA-----GEGKTKLSVNDFIVK 310

Query: 261 AFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVK 320
           A +LA+  VPEAN +W    +  +K  DI VAV+ P G++TPII+    K +  IS E K
Sbjct: 311 AASLALADVPEANSAWLGETIRMYKKADICVAVATPTGLITPIIKDVGAKGLATISAETK 370

Query: 321 QLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNE 380
            LA RA+  KLKPEEYQGGT +ISN+GM G++ F A+IN PQS ILA+G    K+    E
Sbjct: 371 ALASRARDGKLKPEEYQGGTFTISNLGMFGVDQFTAIINLPQSCILAVGKTSTKLELAPE 430

Query: 381 E---IKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           +    K   +M  TLSADHR+VDGAI ++ L  F+EY+E P+  ++
Sbjct: 431 DPKGFKAVQVMKVTLSADHRTVDGAIGARWLKAFREYMEQPLTFML 476


>gi|329664524|ref|NP_001192659.1| dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex, mitochondrial [Bos taurus]
 gi|297482701|ref|XP_002693037.1| PREDICTED: dihydrolipoamide S-acetyltransferase-like [Bos taurus]
 gi|296480288|gb|DAA22403.1| dihydrolipoamide S-acetyltransferase-like [Bos taurus]
          Length = 647

 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 181/441 (41%), Positives = 269/441 (60%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K++ GD+L EIETDKA + FE  +EG + +IL+P G
Sbjct: 221 VLLPALSPTMTMGTVQRWEKKVGEKLNEGDLLAEIETDKATIGFEVQEEGYLAKILIPEG 280

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHS--------- 116
           T ++ + +P+  I+    +IP         + +++       P  V              
Sbjct: 281 TRDVPLGTPLCIIVEKEADIPAFADYRPAEVTDLKPPAPPPIPSPVAPVPPAPQPVAPPP 340

Query: 117 -----------KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
                      K R   SPLA++LA E GIDL+ + G+GP GRI+K DI++ + TK    
Sbjct: 341 SAPRPAAPAGPKGRVFVSPLAKKLAAEKGIDLTQVKGTGPDGRIIKKDIDSFVPTKAAPT 400

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +         +   +        +  IP  NIR+ IA RL QSKQTIPH+Y+SID 
Sbjct: 401 PAAAVPPPSPGVAPVPTGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDV 452

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 453 NMGEVLLVRKELNKML-----EGKSKISVNDFIIKASALACLKVPEANSSWM-DTVIRQN 506

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ DISVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 507 HVVDISVAVSTPAGLITPIVFNAHIKGLETIANDVVSLATKAREGKLQPHEFQGGTFTIS 566

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E ++V  + E    VA++M+ TLS DHR VDGA
Sbjct: 567 NLGMFGIKNFSAIINPPQACILAIGASEDRLVPADNEKGFDVASMMSVTLSCDHRVVDGA 626

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 627 VGAQWLAEFRKYLEKPITMLL 647



 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/81 (45%), Positives = 57/81 (70%), Gaps = 1/81 (1%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
             + +PSLSPTM  G +A+W K+EG+KI+ G+++ E+ETDKA + FESV+E  + +ILV 
Sbjct: 92  QKVPLPSLSPTMQAGTIARWEKKEGEKINEGELIAEVETDKATVGFESVEECYMAKILVA 151

Query: 64  AGTENIAVNSPILNILMDSTE 84
            GT ++ V + I+ I +D  E
Sbjct: 152 EGTRDVPVGA-IICITVDKPE 171


>gi|619444|gb|AAA62253.1| dihydrolipoamide acetyltransferase [Homo sapiens]
          Length = 613

 Score =  323 bits (829), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 178/441 (40%), Positives = 267/441 (60%), Gaps = 38/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 188 VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 247

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH--------------------SH 105
           T ++ + +P+  I+    +I          + +++ +                     + 
Sbjct: 248 TRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQVPPPTPPPVAAVPPTPQPLAPTP 307

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R    PLA++LA E GIDL+ + G+GP GRI K DI++ + +K    
Sbjct: 308 STPCPATPAGPKGRVFVDPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPA 367

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +   G     +   +        +  IP  NIR+ IA RL QSKQTIPH+Y+ + C
Sbjct: 368 PAAVVPPTGPGMAPVPTGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYL-LSC 418

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
               +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 419 KYGEVLLVRKELNKIL-----EGRSKISVNDFIIKASALACLKVPEANSSWM-DTVIRQN 472

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ D+SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +IS
Sbjct: 473 HVVDVSVAVSTPAGLITPIVFNAHIKGVETIANDVVSLATKAREGKLQPHEFQGGTFTIS 532

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILAIGA E K+V  + E    VA++M+ TLS DHR VDGA
Sbjct: 533 NLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGA 592

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 593 VGAQWLAEFRKYLEKPITMLL 613



 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 51/68 (75%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +PSLSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++E  + +ILV  G
Sbjct: 61  VPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVAEG 120

Query: 66  TENIAVNS 73
           T ++ + +
Sbjct: 121 TRDVPIGA 128


>gi|296447125|ref|ZP_06889057.1| Dihydrolipoyllysine-residue acetyltransferase [Methylosinus
           trichosporium OB3b]
 gi|296255394|gb|EFH02489.1| Dihydrolipoyllysine-residue acetyltransferase [Methylosinus
           trichosporium OB3b]
          Length = 319

 Score =  323 bits (827), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 164/315 (52%), Positives = 220/315 (69%), Gaps = 7/315 (2%)

Query: 112 REKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYS--T 169
           R      R  ASPLARRLA E G+DL++L+GSGPHGR+V+ D++  ++        S  +
Sbjct: 8   RLAGGGGRIFASPLARRLAKESGLDLAALTGSGPHGRVVERDVKAALAGGRAAAGPSAPS 67

Query: 170 IQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
                L DE +      LFA  S+  IPHD++RK IA R+  S +TIPHF +  DC+ID 
Sbjct: 68  EAPVALSDEVVR----KLFAPGSFTEIPHDSMRKAIARRMTDSVRTIPHFALQTDCDIDA 123

Query: 230 LLSLREQMNRTLQFHREEISN-KISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHID 288
           LL LRE  N       +     K+SVNDII+KA ALA+ +VP+ANV++T NAM++H   D
Sbjct: 124 LLRLREDYNSAAPNGADGKPEWKVSVNDIIVKAMALALQRVPDANVTFTQNAMLKHTASD 183

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           + VAVSIPGG+VTPIIR A  KS  +I++E+K LA RA++R+LKP EY+GGTT++SN+GM
Sbjct: 184 VGVAVSIPGGLVTPIIRDAQMKSFREIAIEMKDLAARARERRLKPSEYEGGTTAVSNLGM 243

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLL 408
            G+ +F AVINPP +TILA+GAGEK+VV +N+   VATIM+ TLS DHR+VDGA+ + LL
Sbjct: 244 FGVKNFSAVINPPHATILAVGAGEKRVVVKNDAPAVATIMSVTLSVDHRAVDGALGAVLL 303

Query: 409 AKFKEYIENPVWMLM 423
           A+FK  IE P+ ML+
Sbjct: 304 AEFKRLIERPMAMLV 318


>gi|68534356|gb|AAH99043.1| LOC398314 protein [Xenopus laevis]
          Length = 590

 Score =  322 bits (826), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 177/439 (40%), Positives = 263/439 (59%), Gaps = 29/439 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I +P+LSPTMT G + KW K+ G+K+S GD+L EIETDKA + FE  +EG + +ILV  G
Sbjct: 160 ICLPALSPTMTMGTVQKWEKKVGEKLSEGDLLAEIETDKATIGFEVPEEGYLAKILVAEG 219

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKE-NIVEVREEHSHSSPVVVR------------ 112
           T ++ + +P+  I+   ++I       +   +V+++ +H+  +P                
Sbjct: 220 TRDVPLGTPLCIIVEKESDISSFADYKESTGVVDIKPQHAPPTPTAASVPVPPVAVSTPA 279

Query: 113 ------EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKD 166
                     K R   SPLA++LA E GID+  + GSGP GRI K DI++ +  K     
Sbjct: 280 PTPSAAPSAPKGRVFVSPLAKKLAAEKGIDIKQVKGSGPEGRITKKDIDSFVPPKAAPAP 339

Query: 167 YSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
            +       V     A + +    D    +P  NIR+ IA RL QSKQTIPH+Y+SID N
Sbjct: 340 VAAPTPAVAVPSPAVAAVPSGVFTD----VPISNIRRVIAQRLMQSKQTIPHYYLSIDIN 395

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           +  +  LR+++N   +      + K+S ND I+KA ALA ++VPEAN SW    + +H  
Sbjct: 396 MGEITQLRKELNEVTKAD----NIKLSFNDFIIKASALACLKVPEANSSWMDTVIRQHHV 451

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
           +D+SVAVS P G++TPI+  A  K +  IS +V  LA RA++ KLKP E+QGGT ++SN+
Sbjct: 452 VDVSVAVSTPVGLITPIVFNAHIKGLASISKDVLSLATRAREGKLKPHEFQGGTFTVSNL 511

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGAIA 404
           GM GI +F A+INPPQ+ ILA+G  E +++  + E    VA++M+ TLS DHR VDGA+ 
Sbjct: 512 GMYGIKNFSAIINPPQACILAVGGSENRLIPADNEKGFDVASVMSVTLSCDHRVVDGAVG 571

Query: 405 SKLLAKFKEYIENPVWMLM 423
           ++ LA+FK+++E P  ML+
Sbjct: 572 AQWLAEFKKFLEKPTTMLL 590



 Score = 80.9 bits (198), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 58/80 (72%), Gaps = 1/80 (1%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++EG + +ILV  G
Sbjct: 37  VPLPALSPTMQMGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEEGYMAKILVAEG 96

Query: 66  TENIAVNSPILNILMDSTEI 85
           T ++ + S ++ I +D  E 
Sbjct: 97  TRDVPIGS-VICITVDKAEF 115


>gi|80477501|gb|AAI08429.1| LOC398314 protein [Xenopus laevis]
          Length = 623

 Score =  322 bits (825), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 177/439 (40%), Positives = 263/439 (59%), Gaps = 29/439 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I +P+LSPTMT G + KW K+ G+K+S GD+L EIETDKA + FE  +EG + +ILV  G
Sbjct: 193 ICLPALSPTMTMGTVQKWEKKVGEKLSEGDLLAEIETDKATIGFEVPEEGYLAKILVAEG 252

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKE-NIVEVREEHSHSSPVVVR------------ 112
           T ++ + +P+  I+   ++I       +   +V+++ +H+  +P                
Sbjct: 253 TRDVPLGTPLCIIVEKESDISSFADYKESTGVVDIKPQHAPPTPTAASVPVPPVAVSTPA 312

Query: 113 ------EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKD 166
                     K R   SPLA++LA E GID+  + GSGP GRI K DI++ +  K     
Sbjct: 313 PTPSAAPSAPKGRVFVSPLAKKLAAEKGIDIKQVKGSGPEGRITKKDIDSFVPPKAAPAP 372

Query: 167 YSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
            +       V     A + +    D    +P  NIR+ IA RL QSKQTIPH+Y+SID N
Sbjct: 373 VAAPTPAVAVPSPAVAAVPSGVFTD----VPISNIRRVIAQRLMQSKQTIPHYYLSIDIN 428

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           +  +  LR+++N   +      + K+S ND I+KA ALA ++VPEAN SW    + +H  
Sbjct: 429 MGEITQLRKELNEVTKAD----NIKLSFNDFIIKASALACLKVPEANSSWMDTVIRQHHV 484

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
           +D+SVAVS P G++TPI+  A  K +  IS +V  LA RA++ KLKP E+QGGT ++SN+
Sbjct: 485 VDVSVAVSTPVGLITPIVFNAHIKGLASISKDVLSLATRAREGKLKPHEFQGGTFTVSNL 544

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGAIA 404
           GM GI +F A+INPPQ+ ILA+G  E +++  + E    VA++M+ TLS DHR VDGA+ 
Sbjct: 545 GMYGIKNFSAIINPPQACILAVGGSENRLIPADNEKGFDVASVMSVTLSCDHRVVDGAVG 604

Query: 405 SKLLAKFKEYIENPVWMLM 423
           ++ LA+FK+++E P  ML+
Sbjct: 605 AQWLAEFKKFLEKPTTMLL 623



 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 58/80 (72%), Gaps = 1/80 (1%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++EG + +ILV  G
Sbjct: 70  VPLPALSPTMQMGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEEGYMAKILVAEG 129

Query: 66  TENIAVNSPILNILMDSTEI 85
           T ++ + S ++ I +D  E 
Sbjct: 130 TRDVPIGS-VICITVDKAEF 148


>gi|148224215|ref|NP_001082239.1| dihydrolipoamide S-acetyltransferase [Xenopus laevis]
 gi|117167931|gb|AAI24834.1| LOC398314 protein [Xenopus laevis]
          Length = 628

 Score =  322 bits (825), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 177/439 (40%), Positives = 263/439 (59%), Gaps = 29/439 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I +P+LSPTMT G + KW K+ G+K+S GD+L EIETDKA + FE  +EG + +ILV  G
Sbjct: 198 ICLPALSPTMTMGTVQKWEKKVGEKLSEGDLLAEIETDKATIGFEVPEEGYLAKILVAEG 257

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKE-NIVEVREEHSHSSPVVVR------------ 112
           T ++ + +P+  I+   ++I       +   +V+++ +H+  +P                
Sbjct: 258 TRDVPLGTPLCIIVEKESDISSFADYKESTGVVDIKPQHAPPTPTAASVPVPPVAVSTPA 317

Query: 113 ------EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKD 166
                     K R   SPLA++LA E GID+  + GSGP GRI K DI++ +  K     
Sbjct: 318 PTPSAAPSAPKGRVFVSPLAKKLAAEKGIDIKQVKGSGPEGRITKKDIDSFVPPKAAPAP 377

Query: 167 YSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
            +       V     A + +    D    +P  NIR+ IA RL QSKQTIPH+Y+SID N
Sbjct: 378 VAAPTPAVAVPSPAVAAVPSGVFTD----VPISNIRRVIAQRLMQSKQTIPHYYLSIDIN 433

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           +  +  LR+++N   +      + K+S ND I+KA ALA ++VPEAN SW    + +H  
Sbjct: 434 MGEITQLRKELNEVTKAD----NIKLSFNDFIIKASALACLKVPEANSSWMDTVIRQHHV 489

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
           +D+SVAVS P G++TPI+  A  K +  IS +V  LA RA++ KLKP E+QGGT ++SN+
Sbjct: 490 VDVSVAVSTPVGLITPIVFNAHIKGLASISKDVLSLATRAREGKLKPHEFQGGTFTVSNL 549

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGAIA 404
           GM GI +F A+INPPQ+ ILA+G  E +++  + E    VA++M+ TLS DHR VDGA+ 
Sbjct: 550 GMYGIKNFSAIINPPQACILAVGGSENRLIPADNEKGFDVASVMSVTLSCDHRVVDGAVG 609

Query: 405 SKLLAKFKEYIENPVWMLM 423
           ++ LA+FK+++E P  ML+
Sbjct: 610 AQWLAEFKKFLEKPTTMLL 628



 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 58/80 (72%), Gaps = 1/80 (1%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++EG + +ILV  G
Sbjct: 75  VPLPALSPTMQMGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEEGYMAKILVAEG 134

Query: 66  TENIAVNSPILNILMDSTEI 85
           T ++ + S ++ I +D  E 
Sbjct: 135 TRDVPIGS-VICITVDKAEF 153


>gi|169844197|ref|XP_001828820.1| dihydrolipoyllysine-residue acetyltransferase [Coprinopsis cinerea
           okayama7#130]
 gi|116510191|gb|EAU93086.1| dihydrolipoyllysine-residue acetyltransferase [Coprinopsis cinerea
           okayama7#130]
          Length = 454

 Score =  322 bits (824), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 179/443 (40%), Positives = 262/443 (59%), Gaps = 32/443 (7%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +    MP++SPTMTEG +A W K+EG+  S GD+L EIETDKA ++ E+ D+GI+ +IL 
Sbjct: 22  LSQFNMPAMSPTMTEGGIASWKKKEGEAFSAGDVLLEIETDKATIDVEAQDDGILAKILA 81

Query: 63  PAGTENIAVNSPILNILMDSTEIP--------------PSPPLSKENIVEVREEHSHSSP 108
             G++ + V S I  I  +  ++                SPP ++E   E  +     +P
Sbjct: 82  QDGSKAVPVGSVIAIIGEEGDDLSGAAALAEEAASKPQASPPKAEEKAPEQPKPQPTPAP 141

Query: 109 --VVVREKHS---KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
             V V  K S    +R  ASP+A+++A E GI L+ + G+GP GRI++ D+E   + +  
Sbjct: 142 EPVKVESKESLPKGDRIFASPIAKKIALERGIPLAKVKGTGPSGRIIREDVEKWKAPEAA 201

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
               S   +      S+ +          Y   P  N+R+TI  RL QSKQ +PH+Y++ 
Sbjct: 202 APAASATTAAAAAQPSVPST--------DYVDTPVSNMRRTIGARLTQSKQELPHYYLTA 253

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           + N+D +L LRE  N+TL    ++ S K+SVND I+KA A A+  VPEAN +W    +  
Sbjct: 254 EINMDKVLKLREVFNKTL--GEKDKSAKLSVNDFIVKATACALSDVPEANSAWLGEVIRT 311

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
           +K  DISVAV+ P G++TPI++ A  K +  IS E K LA++A+  KL P EYQGGT +I
Sbjct: 312 YKKADISVAVATPTGLITPIVKDAGAKGLASISAETKALAKKARDGKLAPAEYQGGTFTI 371

Query: 344 SNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE---IKVATIMNATLSADHRSVD 400
           SN+GM GI+ F A+INPPQS ILA+GA + ++V   EE    K   +M  TLS DHR+VD
Sbjct: 372 SNLGMYGIDHFTAIINPPQSCILAVGATQARLVPAPEEERGFKTVQVMKVTLSCDHRTVD 431

Query: 401 GAIASKLLAKFKEYIENPVWMLM 423
           GA+ ++ L  FK Y+ENP+  ++
Sbjct: 432 GAVGARWLNAFKGYLENPLTFML 454


>gi|194388976|dbj|BAG61505.1| unnamed protein product [Homo sapiens]
          Length = 418

 Score =  322 bits (824), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 177/432 (40%), Positives = 264/432 (61%), Gaps = 37/432 (8%)

Query: 15  MTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSP 74
           M  G +A+W K+EGDKI+ GD+L EIETDKA + FE  +EG + +ILVP GT ++ + +P
Sbjct: 1   MQAGTIARWEKKEGDKINEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTP 60

Query: 75  ILNILMDSTEIPPSPPLSKENIVEVREEH--------------------SHSSPVVVREK 114
           +  I+    +I          + +++ +                     + S+P      
Sbjct: 61  LCIIVEKEADISALADYRPTEVTDLKPQAPPPTPPPVAAVPPTPQPLAPTPSAPCPATPA 120

Query: 115 HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFG 174
             K R   SPLA++LA E GIDL+ + G+GP GRI K DI++ + +K      + +   G
Sbjct: 121 GPKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPAPAAVVPPTG 180

Query: 175 LVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLR 234
                +   +        +  IP  NIR+ IA RL QSKQTIPH+Y+SI+ N+  +L +R
Sbjct: 181 PGMAPVPTGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSINVNMGEVLLVR 232

Query: 235 EQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI-DISVAV 293
           +++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  H+ D+SVAV
Sbjct: 233 KELNKIL-----EGRSKISVNDFIIKASALACLKVPEANSSWM-DTVIRQNHVVDVSVAV 286

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
           S P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +ISN+GM GI +
Sbjct: 287 STPAGLITPIVFNAHIKGVETIANDVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKN 346

Query: 354 FCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGAIASKLLAKF 411
           F A+INPPQ+ ILAIGA E ++V  + E    VA++M+ TLS DHR VDGA+ ++ LA+F
Sbjct: 347 FSAIINPPQACILAIGASEDELVPADNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEF 406

Query: 412 KEYIENPVWMLM 423
           ++Y+E P+ ML+
Sbjct: 407 RKYLEKPITMLL 418


>gi|20805283|gb|AAM28646.1|AF430140_1 mitochondrial dihydrolipoamide acetyltransferase precursor [Xenopus
           laevis]
          Length = 628

 Score =  322 bits (824), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 177/439 (40%), Positives = 262/439 (59%), Gaps = 29/439 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I +P+LSPTMT G + KW K+ G+K+S GD+L EIETDKA + FE  +EG + +ILV  G
Sbjct: 198 ICLPALSPTMTMGTVQKWEKKVGEKLSEGDLLAEIETDKATIGFEVPEEGYLAKILVAEG 257

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKE-NIVEVREEHSHSSPVVVR------------ 112
           T ++ + +P+  I+   ++I       +   +V+++ +H+  +P                
Sbjct: 258 TRDVPLGTPLCIIVEKESDISSFADYKESTGVVDIKPQHAPPTPTAASVPVPPVAVSTPA 317

Query: 113 ------EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKD 166
                     K R   SPLA++LA E GID+  + GSGP GRI K DI++ +  K     
Sbjct: 318 PTPSAAPSAPKGRVFVSPLAKKLAAEKGIDIKQVKGSGPEGRITKKDIDSFVPPKAAPAP 377

Query: 167 YSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
            +       V     A + +    D    +P  NIR+ IA RL QSKQTIPH+Y+SID N
Sbjct: 378 VAAPTPAVAVPSPAVAAVPSGVFTD----VPISNIRRVIAQRLMQSKQTIPHYYLSIDIN 433

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           +  +  LR+++N   +      + K+S ND I+KA ALA ++VPEAN SW    + +H  
Sbjct: 434 MGEITQLRKELNEVTKAD----NIKLSFNDFIIKASALACLKVPEANSSWMDTVIRQHHV 489

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
           +D+SVAVS P G++TPI+  A  K +  IS +V  LA RA++ KLKP E+QGGT ++SN+
Sbjct: 490 VDVSVAVSTPVGLITPIVFNAHIKGLASISKDVLSLATRAREGKLKPHEFQGGTFTVSNL 549

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGAIA 404
           GM GI +F A+INPPQ+ ILA+G  E +++  + E    VA++M+ TLS DHR VDGA+ 
Sbjct: 550 GMYGIKNFSAIINPPQACILAVGGSENRLIPADNEKGFDVASVMSVTLSCDHRVVDGAVG 609

Query: 405 SKLLAKFKEYIENPVWMLM 423
           ++ LA+FK ++E P  ML+
Sbjct: 610 AQWLAEFKNFLEKPTTMLL 628



 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 58/80 (72%), Gaps = 1/80 (1%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++EG + +ILV  G
Sbjct: 75  VPLPALSPTMQMGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEEGYMAKILVAEG 134

Query: 66  TENIAVNSPILNILMDSTEI 85
           T ++ + S ++ I +D  E 
Sbjct: 135 TRDVPIGS-VICITVDKAEF 153


>gi|148907049|gb|ABR16668.1| unknown [Picea sitchensis]
          Length = 566

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 184/444 (41%), Positives = 269/444 (60%), Gaps = 47/444 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTM+EG +AKW K+EGDK+S GD+LCEIETDKAI++ ES+++G + +I+   G
Sbjct: 144 IGMPSLSPTMSEGNVAKWKKKEGDKVSAGDVLCEIETDKAIVDMESMEDGYLAKIVHGDG 203

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREE--------------HSHSSPVVV 111
            + I +   I  ++ D  +I      +        E+                  SPV +
Sbjct: 204 AKEIKIGEVIAIMVEDEDDIAKFKDYTPSGQGAANEKAPSKETTPPPPPPKEDTPSPVTI 263

Query: 112 --REK-----HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNV 164
              EK      S++R  ASP+AR++A +H + +SS+ G+GP+GRIVK+DIE  +++ +  
Sbjct: 264 PKTEKSTASPQSEDRIFASPIARKMAEDHKVPISSIKGTGPNGRIVKADIEDYLASVSKA 323

Query: 165 KDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
              ST  +  L                 Y  IP   IRK  A RL  SKQTIPH+Y+++D
Sbjct: 324 TPPSTPPTKTL----------------EYTDIPLSQIRKVTASRLLLSKQTIPHYYLTVD 367

Query: 225 CNIDNLLSLREQMNRTLQFHREEISN--KISVNDIILKAFALAMIQVPEANVSWTTNAMI 282
             +D L+ LR Q+N  LQ    E SN  +ISVND ++KA A A+ +VP+ N SWT   + 
Sbjct: 368 TCVDKLMVLRNQLN-ALQ----EASNGKRISVNDFVIKAAASALRKVPQCNSSWTNEYIR 422

Query: 283 RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTS 342
           ++ +I+ISVAV    G+  P+++ AD+K +  I  +VK LAQ+AK+  LKP +Y+GGT +
Sbjct: 423 QYHNINISVAVQTDKGLFVPVVKDADKKGLSAIGEDVKVLAQKAKENTLKPADYEGGTFT 482

Query: 343 ISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVV--FQNEEIKVATIMNATLSADHRSV 399
           +SN+G   GI  FCA+INPPQS ILA+G+ EK+V+     ++  V + M+ TLS DHR +
Sbjct: 483 VSNLGGPFGIKQFCAIINPPQSAILAVGSAEKRVIPGALQDQFDVGSFMSVTLSCDHRVI 542

Query: 400 DGAIASKLLAKFKEYIENPVWMLM 423
           DGAI ++ L  FK YIE+P+ ML+
Sbjct: 543 DGAIGAEYLKAFKGYIEDPLTMLL 566


>gi|118102025|ref|XP_417933.2| PREDICTED: similar to Dihydrolipoamide S-acetyltransferase (E2
           component of pyruvate dehydrogenase complex) [Gallus
           gallus]
          Length = 681

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 178/446 (39%), Positives = 267/446 (59%), Gaps = 42/446 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K++ GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 250 VALPALSPTMTMGTVQRWEKKVGEKLNEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 309

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHS--------- 116
           T ++ + + +  I+   ++IP      +  + +++ +     P                 
Sbjct: 310 TRDVPLGTTLCIIVEKESDIPAFADYQETAVTDMKAQVPPPPPSPPVVATPAAAALPPQP 369

Query: 117 ----------------KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST 160
                           K R + SPLA++LA E GIDL+ + G+GP GRI K D+ET +  
Sbjct: 370 AAPPTPAVPTAGPPPRKGRILVSPLAKKLAAEKGIDLAQVKGTGPDGRITKKDVETFVPP 429

Query: 161 KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
           K                    A  +      ++  IP  NIR+ IA RL QSKQTIPH+Y
Sbjct: 430 KVAPAPAVEAVP--------AAAAVAAAPVGTFTDIPISNIRRVIAQRLMQSKQTIPHYY 481

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           +S+D N+  +L LR+++N+ +  +      K+SVND I+KA ALA ++VPEAN SW  + 
Sbjct: 482 LSVDVNMGEVLVLRKELNQVVSDN-----VKLSVNDFIIKASALACLKVPEANSSWM-DT 535

Query: 281 MIRHKHI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
           +IR  H+ D+SVAVS P G++TPI+  A  K +  IS +V  LA +A++ KL+P E+QGG
Sbjct: 536 VIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGLASISKDVVSLAAKAREGKLQPHEFQGG 595

Query: 340 TTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHR 397
           T +ISN+GM GI +F A+INPPQ+ ILA+G+ EK++V  + E    VA++M+ TLS DHR
Sbjct: 596 TFTISNLGMYGIKNFSAIINPPQACILAVGSSEKRLVPADNEKGFDVASMMSVTLSCDHR 655

Query: 398 SVDGAIASKLLAKFKEYIENPVWMLM 423
            VDGA+ ++ LA+FK ++E PV ML+
Sbjct: 656 VVDGAVGAQWLAEFKNFLEKPVTMLL 681



 Score = 79.0 bits (193), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +A+W K+EGDKI  GD++ E+ETDKA + FES++E  + +ILVP G
Sbjct: 122 VALPALSPTMQMGTIARWEKKEGDKIGEGDLIAEVETDKATVGFESLEECYLAKILVPEG 181

Query: 66  TENIAVNSPILNILMDSTE 84
           T ++ + + I+ I ++  E
Sbjct: 182 TRDVPIGA-IICITVEKPE 199


>gi|209885405|ref|YP_002289262.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Oligotropha carboxidovorans OM5]
 gi|209873601|gb|ACI93397.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Oligotropha carboxidovorans OM5]
          Length = 457

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 159/309 (51%), Positives = 219/309 (70%), Gaps = 6/309 (1%)

Query: 119 RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST---KTNVKDYSTIQSFGL 175
           R  ASPLARRLA E GID+S +SG+GPHGRI+  D++   +    K      +   +F  
Sbjct: 151 RTFASPLARRLAKEAGIDISRVSGTGPHGRIIARDVDEAKAGRGLKPAAAGGAAAPTFA- 209

Query: 176 VDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLRE 235
                DA I++LF  D+YE +PHD +RK IA RL  S + +P +Y++ DC+I NL++ RE
Sbjct: 210 -PGPSDAQIMSLFNADNYEAVPHDQMRKVIAQRLSASDRDVPQYYLTCDCDIGNLVAARE 268

Query: 236 QMN-RTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVS 294
            +N R  +    + + K+SVND ++KA ALA+ +VP+ANV+WT  AM+RHK  D+SVAVS
Sbjct: 269 DINGRAPKDKDGKPAYKLSVNDFVIKALALALQRVPDANVTWTDEAMLRHKVSDVSVAVS 328

Query: 295 IPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSF 354
           IP G++TPIIR A  KS+  IS E+K LA RAK RKLKPEEYQG +T++SN+GM G+  F
Sbjct: 329 IPTGLITPIIRSAHAKSVSTISNEMKDLAARAKARKLKPEEYQGASTAVSNLGMYGMKQF 388

Query: 355 CAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEY 414
            AVINPPQSTILA+G  E++ V +N +I++ATIM  TL+ DHR++DGA+ ++LL+ FK  
Sbjct: 389 TAVINPPQSTILAVGMSEERPVVRNGKIEIATIMTVTLTCDHRAMDGALGAQLLSAFKLL 448

Query: 415 IENPVWMLM 423
           IENPV M++
Sbjct: 449 IENPVMMVV 457



 Score =  100 bits (248), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 46/80 (57%), Positives = 60/80 (75%)

Query: 6  ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
          I MP+LSPTM +G LAKW+K+EGDK+S GD++ EIETDKA ME E+VDEG I +ILVP G
Sbjct: 5  ILMPALSPTMEKGNLAKWLKKEGDKVSSGDVIAEIETDKATMEVEAVDEGTIAKILVPEG 64

Query: 66 TENIAVNSPILNILMDSTEI 85
          T ++ VN  I  +  D  ++
Sbjct: 65 TADVPVNQVIAVLAADGEDV 84


>gi|332286691|ref|YP_004418602.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Pusillimonas sp. T7-7]
 gi|330430644|gb|AEC21978.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Pusillimonas sp. T7-7]
          Length = 390

 Score =  321 bits (822), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 172/422 (40%), Positives = 254/422 (60%), Gaps = 32/422 (7%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP +    + G++ +W+K +GD ++ GD+L EIETDKA++E ES DEG++ +I+
Sbjct: 1   MTINILMPGVGAGDSYGRVVQWLKSKGDHVAVGDMLAEIETDKAVLELESFDEGMLQDII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V AG E +A  + I  +   S E   +P    E   E++                  R  
Sbjct: 61  VNAGDEEVAAGTVIAVLSGSSDEPAQAPATGNEPASEIK------------------RQF 102

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           ASP ARRLA +  +D+S+L GSGP GR+V+ DIE      ++V                 
Sbjct: 103 ASPSARRLARQLDVDISTLRGSGPKGRVVRIDIEKAAEQASSVPVKHP------------ 150

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A +    A    E++PH  +RKTIA RLQ+SKQ IPHFY+++DC +D LL +R Q+N+ L
Sbjct: 151 APVTPATASSPAEIVPHSLMRKTIARRLQESKQQIPHFYLTVDCRMDALLMMRGQINQDL 210

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
              R   + KI++NDI++ A A AM +VPE N+ WT +A+ R+  IDISVAVS   G+VT
Sbjct: 211 S--RLNRALKITINDILVYAVARAMARVPEVNIRWTEHAIERNSTIDISVAVSTEKGLVT 268

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R A QKS+  IS E+     +A+  +L P +Y+GG  +ISN+G  G+ SF A+INPP
Sbjct: 269 PVVRDAQQKSLETISRELLGYVSKARSGQLAPADYEGGGLTISNLGTHGVKSFSAIINPP 328

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ ILA G+ EK+ + Q++ + +  IM  TLSADHR++DGA  ++ LA+ K  +E P  +
Sbjct: 329 QAAILAFGSVEKQPIVQDDALAIGHIMAVTLSADHRAIDGAAGARFLAELKFLLEAPYRL 388

Query: 422 LM 423
           L+
Sbjct: 389 LI 390


>gi|170084035|ref|XP_001873241.1| dihydrolipoamide acetyltransferase [Laccaria bicolor S238N-H82]
 gi|164650793|gb|EDR15033.1| dihydrolipoamide acetyltransferase [Laccaria bicolor S238N-H82]
          Length = 453

 Score =  321 bits (822), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 179/440 (40%), Positives = 257/440 (58%), Gaps = 37/440 (8%)

Query: 8   MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTE 67
           MP++SPTMTEG +A W K+EG+  SPGD+L EIETDKA ++ E+ D+GI+ +I+   G +
Sbjct: 27  MPAMSPTMTEGGIASWKKKEGEAFSPGDVLLEIETDKATIDVEAQDDGILAKIIAQDGAK 86

Query: 68  NIAVNSPILNILMDSTEI--------------PPSPPLSKENIVEVREEHSHSSPVVVRE 113
            + + S I  +  +  ++              PPS   + E   E       S P     
Sbjct: 87  GVPIGSIIAVVAEEGDDLSGAAAFAEQAATRGPPSNQTTTEPKAESPPPPKDSQPPTTTP 146

Query: 114 KH-------SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKD 166
                    S +R  ASP+A+++A E GI L+ +SGSGP GRI++ D+E           
Sbjct: 147 STPSKESLPSGDRIFASPIAKKIALERGIPLAKVSGSGPGGRIIREDVE----------K 196

Query: 167 YSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
           Y  I +     ++  A        D Y   P  N+R+TI  RL QSKQ +PH+Y++++ N
Sbjct: 197 YKEIPALASATQTNLAQPPAAALPD-YVDTPISNMRRTIGARLTQSKQELPHYYLTVEIN 255

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           +D  L LRE  N+TL    ++ S K+SVND I+KA   A+  VPEAN +W    +  +  
Sbjct: 256 MDKTLKLREVFNKTLT--EKDKSAKLSVNDFIVKAVTCALSDVPEANSAWLGEVIRTYNK 313

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
            DISVAV+ P G++TPII+ A  K +  IS E K LA++A+  KL P EYQGGT +ISN+
Sbjct: 314 ADISVAVATPTGLITPIIKDAGSKGLATISAETKALAKKARDGKLAPAEYQGGTFTISNL 373

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE---IKVATIMNATLSADHRSVDGAI 403
           GM GI+ F A+INPPQS ILA+G+ E K+V   EE    K+  +M  TLS+DHR+VDGA+
Sbjct: 374 GMFGIDHFTAIINPPQSCILAVGSTEAKLVPAPEEERGFKIVQVMKVTLSSDHRTVDGAV 433

Query: 404 ASKLLAKFKEYIENPVWMLM 423
            ++ L  FK Y+ENP+  ++
Sbjct: 434 GARWLTAFKGYLENPLTFML 453


>gi|125595764|gb|EAZ35544.1| hypothetical protein OsJ_19827 [Oryza sativa Japonica Group]
          Length = 413

 Score =  321 bits (822), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 174/434 (40%), Positives = 263/434 (60%), Gaps = 46/434 (10%)

Query: 15  MTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSP 74
           MTEG +A+W+K+EGDK+SPG++LCE+ETDKA +E E ++EG + +I+   G + I V   
Sbjct: 1   MTEGNIARWVKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIIHGDGAKEIKVGEI 60

Query: 75  ILNILMDSTEIPP----SPPLSKENIV--EVREEHSHSSPVVVREKH------------- 115
           I   + +  +I        P S E+    E + +   + P   +E+              
Sbjct: 61  IAVTVEEEEDIGKFKDYKAPSSAESAAPAESKPQSEPTEPKKEKEQPKAPEPKATKTEES 120

Query: 116 --SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST--KTNVKDYSTIQ 171
             S++R  +SP+AR+LA ++ + LSS+ G+GP GRI+K+DIE  +++  K   K+ +   
Sbjct: 121 FLSEDRTFSSPIARKLAEDNNVPLSSIKGTGPDGRILKADIEDYLASVAKGAKKETAAAP 180

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
             G VD                  +P+  IRK  A RL  SKQTIPH+Y+++D  +D L+
Sbjct: 181 GLGYVD------------------LPNTQIRKVTANRLLHSKQTIPHYYLTVDTRVDKLI 222

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISV 291
            LR ++N            KIS+ND+++KA ALA+  VPE N SW  + + ++ +++I+V
Sbjct: 223 KLRSELN---PLQDTSGGKKISINDLVIKAAALALRNVPECNSSWMNDFIRQYHNVNINV 279

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM-LG 350
           AV    G+  P+IR AD+K +  I+ EVKQLAQRA+   LKPE+Y+GGT ++SN+G   G
Sbjct: 280 AVQTEDGLFVPVIRDADKKGLATIADEVKQLAQRARDNSLKPEDYEGGTFTVSNLGGPFG 339

Query: 351 INSFCAVINPPQSTILAIGAGEKKVVFQNE-EIKVATIMNATLSADHRSVDGAIASKLLA 409
           I  FCA++NPPQS ILAIG+ EK+V+   E + +V + M+ATLS DHR +DGAI ++ + 
Sbjct: 340 IKQFCAIVNPPQSAILAIGSAEKRVIPGAEGQFEVGSFMSATLSCDHRVIDGAIGAEWMK 399

Query: 410 KFKEYIENPVWMLM 423
            FK YIENP  ML+
Sbjct: 400 AFKGYIENPTTMLL 413


>gi|269856953|gb|ACZ51502.1| CND02450-like protein [Cryptococcus heveanensis]
          Length = 492

 Score =  321 bits (822), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 180/468 (38%), Positives = 263/468 (56%), Gaps = 57/468 (12%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +    MP++SPTMTEG +A W  +EGD  + GD+L EIETDKA ++ E+ D+G++ +I+V
Sbjct: 35  LSKFQMPAMSPTMTEGGIANWKLKEGDSYAAGDVLVEIETDKATIDVEAQDDGVLAKIIV 94

Query: 63  PAGTENIAVNSPILNI------------LMDSTEIPPSPPLSKENIVEVREE-------- 102
             G + +AV +PI  I            L   +E  P+P   +E     +EE        
Sbjct: 95  NDGAKGVAVGTPIAIIGEEGDDLSGADKLASESESAPAPK-KEEQAAPAKEEPKKEQGGD 153

Query: 103 ------------------HSHSSPVVVRE------KHSKNRPIASPLARRLAGEHGIDLS 138
                              S SS   V++      +  K +  ASPLAR++A E GI L 
Sbjct: 154 KKISDTPALGTPADETKYGSGSSTSDVQKAPELSSQGEKPKFFASPLARKIALEKGIPLG 213

Query: 139 SLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPH 198
            + G+GP GRI K+D+E      ++    +T  S      +         A   YE +P 
Sbjct: 214 EVKGTGPEGRITKADVEKFKPGSSSSAAATTPTS----GATATPGKPAPAAPAEYEDVPT 269

Query: 199 DNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDII 258
            N+R+TI  RL +SKQ +PH+Y++++ N+D ++ LR+  N+       E   K+SVND I
Sbjct: 270 SNMRRTIGKRLTESKQQLPHYYLTVEVNMDRVMKLRQMFNKA-----GEGKTKLSVNDFI 324

Query: 259 LKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLE 318
           +KA ALA+ +VPEAN +W    +  +K  DI VAV+ P G++TPII+    K +  IS E
Sbjct: 325 VKAAALALAEVPEANSAWLGETIRTYKKADICVAVATPNGLITPIIKDVGAKGLASISAE 384

Query: 319 VKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQ 378
            K LA +A+  KLKPEEYQGG+ +ISN+GM GI++F A+INPPQS ILAIG    K+   
Sbjct: 385 TKALASKARDGKLKPEEYQGGSFTISNLGMYGIDNFTAIINPPQSCILAIGQTSNKLELA 444

Query: 379 NEE---IKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            E+    K   +M ATLS+DHR+VDGA+ ++ L  FKEY+E P+  ++
Sbjct: 445 PEDPKGFKSVQVMKATLSSDHRTVDGAVGARWLKAFKEYMEQPLTFML 492


>gi|27379890|ref|NP_771419.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Bradyrhizobium japonicum USDA 110]
 gi|27353043|dbj|BAC50044.1| dihydrolipoamide acetyltransferase [Bradyrhizobium japonicum USDA
           110]
          Length = 451

 Score =  321 bits (822), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 152/308 (49%), Positives = 222/308 (72%), Gaps = 2/308 (0%)

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
            R  +SPLARRLA + GID+S ++G+GPHGR+V  D+E   S K      +   S   + 
Sbjct: 144 GRVFSSPLARRLAKDAGIDVSMVTGTGPHGRVVARDVEQAKSGKGLKAPAAAPSSAPSIA 203

Query: 178 ESI-DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
            ++ D  IL+LF   SY+++PHD +R+TIA RL  S Q +PHFY++IDC+I  LL+ RE+
Sbjct: 204 PTMSDKQILSLFEPGSYDIVPHDGMRRTIAQRLTASIQNVPHFYLTIDCDIGKLLAAREE 263

Query: 237 MNRTLQFHREEIS-NKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSI 295
           +N      +E+    KISVND ++KA A+A+ ++P  NVSWT + M++H H D+ VAV++
Sbjct: 264 INAAAPKDKEKKPLYKISVNDFVIKAMAVALQKIPNCNVSWTESGMVKHHHSDVGVAVAM 323

Query: 296 PGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFC 355
           PGG++TPIIR+A+ K++  IS E+K  A RA+ RKLKPEEYQGGTT++SN+GM GI+ F 
Sbjct: 324 PGGLITPIIRKAETKTLSTISNEMKDFAARARSRKLKPEEYQGGTTAVSNLGMYGISHFT 383

Query: 356 AVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYI 415
           AVINPP +TILA+G  E++ V +N +I++A +M+ TLS DHR++DGA+ ++L+  FK+ I
Sbjct: 384 AVINPPHATILAVGTSEERPVVRNGKIEIAHMMSVTLSCDHRAIDGALGAELIGAFKQLI 443

Query: 416 ENPVWMLM 423
           ENPV M++
Sbjct: 444 ENPVMMMV 451



 Score = 96.3 bits (238), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 56/70 (80%)

Query: 6  ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
          I MP+LSPTM +G LAKW+K+EGDK+  GD++ EIETDKA ME E++DEG I +ILVP G
Sbjct: 5  ILMPALSPTMEKGNLAKWLKKEGDKVKSGDVIAEIETDKATMEVEAIDEGTIAKILVPEG 64

Query: 66 TENIAVNSPI 75
          T+++ VN  I
Sbjct: 65 TQDVPVNDVI 74


>gi|47522814|ref|NP_999159.1| dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex, mitochondrial [Sus scrofa]
 gi|14587786|dbj|BAB61720.1| dihydrolipoamide acetyltransferase [Sus scrofa]
          Length = 647

 Score =  321 bits (822), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 179/441 (40%), Positives = 268/441 (60%), Gaps = 37/441 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +IL+P G
Sbjct: 221 VVLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILIPEG 280

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHS--------- 116
           T ++ + +P+  I+    +IP         + +++      +P  V              
Sbjct: 281 TRDVPLGTPLCIIVEKEADIPAFADYRPTEVTDLKPPAPPPTPSPVTPVPPAPQPVAPTP 340

Query: 117 -----------KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
                      K R   SPLA++LA E GIDL+ + G+GP GRI+K DI++ + TK    
Sbjct: 341 AATRPATPAGPKGRLFVSPLAKKLASEKGIDLTQIKGTGPDGRIIKKDIDSFVPTKAAPT 400

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +         +   +        +  IP  NIR+ IA RL QSKQTIPH+Y+S+D 
Sbjct: 401 PAAAVPPPSPGVAPVPTGV--------FTDIPISNIRRVIAQRLMQSKQTIPHYYLSVDV 452

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +R+++N+ L     E  +KISVND I+KA ALA ++VPEAN SW  + +IR  
Sbjct: 453 NMGEVLLVRKELNKML-----EGRSKISVNDFIIKASALACLKVPEANSSWL-DTVIRQN 506

Query: 286 HI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           H+ DISVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E QGGT +IS
Sbjct: 507 HVVDISVAVSTPAGLITPIVFNAHIKGLETIANDVVSLATKAREGKLQPHEVQGGTFTIS 566

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM GI +F A+INPPQ+ ILA+GA E ++   + E    VA++M+ TLS DHR VDGA
Sbjct: 567 NLGMFGIKNFSAIINPPQACILAVGASEDRLFPADNEKGFDVASMMSVTLSCDHRVVDGA 626

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + ++ LA+F++Y+E P+ ML+
Sbjct: 627 VGAQWLAEFRKYLEKPITMLL 647



 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +PSLSPTM  G +A+W K+EGDKI+ G+++ E+ETDKA + FES++E  + +ILV  G
Sbjct: 94  VPLPSLSPTMQAGTIARWEKKEGDKINEGELIAEVETDKATVGFESLEECYMAKILVAEG 153

Query: 66  TENIAVNSPILNILMDSTE 84
           T ++ V + I+ I ++  E
Sbjct: 154 TRDVPVGA-IICITVEKPE 171


>gi|323136469|ref|ZP_08071551.1| Dihydrolipoyllysine-residue acetyltransferase [Methylocystis sp.
           ATCC 49242]
 gi|322398543|gb|EFY01063.1| Dihydrolipoyllysine-residue acetyltransferase [Methylocystis sp.
           ATCC 49242]
          Length = 317

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 155/305 (50%), Positives = 215/305 (70%), Gaps = 1/305 (0%)

Query: 119 RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDE 178
           R  ASPLARRLA E G+D++ L GSGPHGRI++ D++  I+     K  ST  +  L   
Sbjct: 12  RIFASPLARRLAKEAGLDIAGLQGSGPHGRIIERDVKDAIAGGGARKAPSTTPAAPLAAP 71

Query: 179 SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMN 238
                    +  DSYE IPHD++RK IA RL +S QT+PHF++ +DC ID LL LRE+ N
Sbjct: 72  PSAGTTRKFYEIDSYEEIPHDSMRKAIARRLTESIQTVPHFFLEVDCEIDALLRLREEFN 131

Query: 239 RTLQFHREEISN-KISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
                  +     K SVND ++KA ALA+ +VPEANV++T + M++HK  DI VAV+IPG
Sbjct: 132 AAAPKGADGAPEWKTSVNDYVIKALALALQRVPEANVTFTPDLMLKHKASDIGVAVAIPG 191

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G++TPI+R A  K++ +IS EVK+LA RA++RKLKP EY+GG +++SN+GM GI +F AV
Sbjct: 192 GLITPIVRNAQAKTVREISEEVKELAARARERKLKPHEYEGGVSAVSNLGMYGIRNFSAV 251

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           INPPQSTILA+G GE+++V ++    VA IM+ TLS DHR++DGA+ ++LLA+FK  IE+
Sbjct: 252 INPPQSTILAVGKGEQRMVVRDGAAAVANIMSVTLSCDHRAIDGALGAELLAEFKRLIEH 311

Query: 418 PVWML 422
           P+ + 
Sbjct: 312 PMALF 316


>gi|47086703|ref|NP_997832.1| dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex, mitochondrial [Danio rerio]
 gi|27762280|gb|AAO17575.1| dihydrolipoamide S-acetyltransferase [Danio rerio]
          Length = 652

 Score =  320 bits (820), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 177/439 (40%), Positives = 268/439 (61%), Gaps = 28/439 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +I++  G
Sbjct: 221 VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKIMISEG 280

Query: 66  TENIAVNSPILNILMDSTEI---------------PPSPPL---SKENIVEVREEHSHSS 107
           T ++ + +P+  I+   ++I               PP+P L               + ++
Sbjct: 281 TRDVPLGTPLCIIVEKESDISAFADYVETGVAASPPPAPTLVATPPPAAAPAAPIPAPAA 340

Query: 108 PVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDY 167
                    K R  ASPLA++LA E G+D++ ++G+GP GR+ K DI++ +  K      
Sbjct: 341 APAAPAAARKGRVFASPLAKKLAAEKGVDITQVTGTGPDGRVTKKDIDSFVPPKLTPAAA 400

Query: 168 STIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNI 227
           +   +         A         ++  +P  NIRK IA RL QSKQTIPH+Y+SID N+
Sbjct: 401 AAPSA--PTPSPPAAPAYAAVPTGTFTDVPISNIRKVIAQRLMQSKQTIPHYYLSIDVNM 458

Query: 228 DNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI 287
           D +L LR+++N  ++   E I  K+SVND I+KA ALA ++VPEAN SW  + +IR  H+
Sbjct: 459 DQVLELRKELNAEVK--AENI--KLSVNDFIIKASALACLKVPEANSSWM-DTVIRQNHV 513

Query: 288 -DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
            D+SVAVS P G++TPI+  A  K + +IS +V  LA +A+  KL+P E+QGGT +ISN+
Sbjct: 514 VDVSVAVSTPVGLITPIVFNAHIKGLANISKDVSALAAKARDGKLQPHEFQGGTFTISNL 573

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGAIA 404
           GM GI  F A+INPPQ+ ILA+G  EK+++  + E    VA +M+ TLS DHR VDGA+ 
Sbjct: 574 GMYGIKHFSAIINPPQACILAVGGSEKRLLPADNEKGFDVANMMSVTLSCDHRVVDGAVG 633

Query: 405 SKLLAKFKEYIENPVWMLM 423
           ++ LA+F++++E P  ML+
Sbjct: 634 AQWLAEFRKFLEKPFTMLL 652



 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FE ++E  + +ILV  G
Sbjct: 95  VELPALSPTMQMGTIARWEKKEGDKINEGDLIAEVETDKATVGFEMLEECYLAKILVAEG 154

Query: 66  TENIAVNSPILNILMDSTEI 85
           T ++ + + ++ I +D  E+
Sbjct: 155 TRDVPIGA-VICITVDKPEL 173


>gi|307188133|gb|EFN72965.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex, mitochondrial [Camponotus
           floridanus]
          Length = 485

 Score =  320 bits (819), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 179/439 (40%), Positives = 262/439 (59%), Gaps = 45/439 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +  W K+EGDK++ GD+L EIETDKA M FE+ +EG + +ILVPAG
Sbjct: 71  VPLPALSPTMETGTIISWQKKEGDKLNEGDLLAEIETDKATMGFETPEEGYLAKILVPAG 130

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKH---------- 115
           T+N+ +   +  I+ D + +        + +         S  V                
Sbjct: 131 TKNVPIGKLVCIIVQDESSVVAFKDFKDDAVAAPPPATPPSPAVSTSPAPTPAPPPAPTV 190

Query: 116 ---------SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKD 166
                    S  R  ASPLA+RLA E G+ L  L G+G +G I   D+E  ++ K  V  
Sbjct: 191 TKAPSIPPPSGERIYASPLAKRLATEKGLSLQGLQGTGLYGSITSKDLEGAVAIKPGV-- 248

Query: 167 YSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
             T+ + G     ID              IP  NIR  IA RL +SKQTIPH+Y+S+D  
Sbjct: 249 --TVGAPGAA--GID--------------IPISNIRAIIAKRLLESKQTIPHYYLSMDIK 290

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           +D  L++REQ N+ L+  +++I  K+SVNDII+K  A+A  ++PE N SW  N + ++ +
Sbjct: 291 MDAALAMREQFNKLLE--KDKI--KLSVNDIIIKGMAMACKKIPEGNSSWLGNVIRQYNN 346

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
           +D+SVAVS   G++TPI+  AD K ++ IS EVK LA +A++ KL+P+E+QGGT ++SN+
Sbjct: 347 VDVSVAVSTDSGLITPIVFSADTKGMVQISKEVKALAAKAREGKLQPQEFQGGTITVSNL 406

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVV-FQNEE-IKVATIMNATLSADHRSVDGAIA 404
           GM GI +F AVINPPQS ILA+G  E +++  +NE+    A  M+ T S DHR++DGA+ 
Sbjct: 407 GMFGIKNFAAVINPPQSIILAVGGTETRLIPAKNEKGFTTAQYMSVTASCDHRTIDGAVG 466

Query: 405 SKLLAKFKEYIENPVWMLM 423
           ++ L  FK++IENP  ML+
Sbjct: 467 AQWLVAFKDFIENPSTMLL 485


>gi|326933439|ref|XP_003212811.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component
           of pyruvate dehydrogenase complex, mitochondrial-like
           [Meleagris gallopavo]
          Length = 567

 Score =  318 bits (815), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 177/447 (39%), Positives = 266/447 (59%), Gaps = 43/447 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K++ GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 135 VALPALSPTMTMGTVQRWEKKVGEKLNEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 194

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHS--------- 116
           T ++ + + +  I+   ++IP      +  + +++ +     P                 
Sbjct: 195 TRDVPLGTTLCIIVEKESDIPAFADYRETAVTDMKAQVPPPPPPSPVVATPAAAAPPSPQ 254

Query: 117 -----------------KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
                            K R   SPLA++LA E GIDL+ + G+GP GRI K D+E+ + 
Sbjct: 255 PAAPPTPAVATAGPPPRKGRIPVSPLAKKLAAEKGIDLAQVKGTGPDGRITKKDVESFVP 314

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
            +                    A  +      ++  IP  NIR+ IA RL QSKQTIPH+
Sbjct: 315 PRVAPAPAVEAVP--------AAAAVAAAPVGTFTDIPISNIRRVIAQRLMQSKQTIPHY 366

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN 279
           Y+S+D N+  +L LR+++N+ +  +      K+SVND I+KA ALA ++VPEAN SW  +
Sbjct: 367 YLSVDVNMGEVLMLRKELNQVVSDNV-----KLSVNDFIIKASALACLKVPEANSSWM-D 420

Query: 280 AMIRHKHI-DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQG 338
            +IR  H+ D+SVAVS P G++TPI+  A  K +  IS +V  LA +A++ KL+P E+QG
Sbjct: 421 TVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGLASISKDVVSLATKAREGKLQPHEFQG 480

Query: 339 GTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADH 396
           GT +ISN+GM GI +F A+INPPQ+ ILA+G+ EKK+V  + E    VA++M+ TLS DH
Sbjct: 481 GTFTISNLGMYGIKNFSAIINPPQACILAVGSSEKKLVPADNEKGFDVASMMSVTLSCDH 540

Query: 397 RSVDGAIASKLLAKFKEYIENPVWMLM 423
           R VDGA+ ++ LA+FK ++E PV ML+
Sbjct: 541 RVVDGAVGAQWLAEFKNFLEKPVTMLL 567



 Score = 37.0 bits (84), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 30/47 (63%), Gaps = 4/47 (8%)

Query: 40 IETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNILMDSTEIP 86
          +ETDKA + FES++E  + +ILVP GT ++    PI  I+  + E P
Sbjct: 41 VETDKATVGFESLEECYLAKILVPEGTRDV----PIGAIICITVEKP 83


>gi|290996602|ref|XP_002680871.1| predicted protein [Naegleria gruberi]
 gi|284094493|gb|EFC48127.1| predicted protein [Naegleria gruberi]
          Length = 447

 Score =  318 bits (815), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 174/454 (38%), Positives = 273/454 (60%), Gaps = 43/454 (9%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           ++   I+MP+LSPTM  G + KW+K+EGD++ PGD++ E+ETDK+ +EFE  +EG + +I
Sbjct: 6   LLASLISMPALSPTMNTGNIGKWLKKEGDELKPGDLIVEVETDKSTLEFEFQEEGFLAKI 65

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIV----------------------- 97
           L P G++ IA+ SPI  ++ D+++I      S E++                        
Sbjct: 66  LTPEGSKTIALGSPIAILVDDASKI------SSEDLAAGASYTPGAATPAASTTPSSTPS 119

Query: 98  -EVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSL-SGSGPHGRIVKSDIE 155
            +     +  S        +  R  ASPLA+++A ++ +DL+ + SGSG   RIVK+D+E
Sbjct: 120 QQTSTTTTTQSAPSTTTTSTGGRVFASPLAKKVAQDNNVDLAQIGSGSGHSNRIVKADVE 179

Query: 156 TLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQT 215
             ++ K  V++     +     +   A      +  S+  IP  N+RK IA RL +SK+T
Sbjct: 180 EFLTRKPAVQEQPRATTTTTTQQQTVA--APAVSSGSFVDIPVSNVRKIIADRLLESKRT 237

Query: 216 IPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVS 275
           IPH+Y++++  +DNL+  RE++N+      E+   K+SVND ++KA AL+M +VPE N S
Sbjct: 238 IPHYYLTVEIEVDNLMKAREELNKA----GEKRGFKLSVNDFLVKAAALSMKKVPEINSS 293

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           W    + ++ ++D+SVAV    G++TPI+  A+ K +  IS EVK LA +A++ KLKP E
Sbjct: 294 WQDTFIRQYNNVDLSVAVQTDSGLITPIVFSAETKGLSSISNEVKALAGKARENKLKPHE 353

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQ------NEEIKVATIMN 389
           +QGGT +ISN+GM GI+ F A+INPPQ+ ILA+G   KKVV         ++ KV T M 
Sbjct: 354 FQGGTFTISNLGMFGIDEFSAIINPPQACILAVGKSSKKVVVNEKPTSAEDKFKVVTTMK 413

Query: 390 ATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            TLS DHR VDGA+ ++ L +FK  +ENP+++ +
Sbjct: 414 VTLSCDHRVVDGAVGAQWLQEFKTLLENPLYLTL 447


>gi|168026324|ref|XP_001765682.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162683108|gb|EDQ69521.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 436

 Score =  318 bits (815), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 178/449 (39%), Positives = 269/449 (59%), Gaps = 46/449 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMT+G +A W K+EGD++  GD+LCEIETDKA +E ES+++G + +ILV  G
Sbjct: 3   IGMPSLSPTMTQGNIAVWRKKEGDEVVAGDVLCEIETDKATLEMESMEDGFLGKILVKDG 62

Query: 66  TENIAVNSPILNILMDSTE-------IPP-------SPPLSKEN-----IVEVREEHSHS 106
            ++I V   I  +++D+ E         P       SPP  KE           ++   S
Sbjct: 63  AKDIPVGQAIC-LMVDTKEELESIGDYKPSGGGGDSSPPPKKEESTPSPPPPPSKKQDKS 121

Query: 107 SPVVVREKHSK-------NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
            P   +  H+        NR  A+P AR+ A E  + L+S+ G+GP G IVK+D+E  + 
Sbjct: 122 EPTPSKPGHATPSPPSGGNRIFATPAARKFAEEKKLSLTSIEGTGPDGGIVKADVEAYLD 181

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
                       S G   + + A I +L    SY  IP+  IR+  A RL QSKQTIPH+
Sbjct: 182 QHV---------SGGAPPKGV-APIDDL----SYTDIPNTQIRRITAKRLLQSKQTIPHY 227

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREE--ISNKISVNDIILKAFALAMIQVPEANVSWT 277
           Y+S+D  +D LL LR  +N +L   +++   + K+S+ND ++KA ALA+ +VPE N +WT
Sbjct: 228 YLSLDIRVDKLLQLRGDLNASLDASKKKDAPTKKLSLNDFVIKAAALALQKVPEVNSTWT 287

Query: 278 TNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQ 337
              + ++ +++ISVAV    G++ P+++ AD+K +  I+ +VK LA +A+   +KP +Y+
Sbjct: 288 DEYIRQYHNVNISVAVQTEHGLMVPVVKDADKKGLATITEDVKTLAGKARSNTMKPSDYE 347

Query: 338 GGTTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVV--FQNEEIKVATIMNATLSA 394
           GGT +ISN+G   GI  FCA+INPPQ+ ILA+G  EK++V     ++  V T M  T+S 
Sbjct: 348 GGTFTISNLGGPFGIKQFCAIINPPQAAILAVGTTEKRLVPGLTPDQYDVGTFMTVTMSC 407

Query: 395 DHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           DHR +DGA+ ++ L  FK YIE+PV +++
Sbjct: 408 DHRVIDGAVGAQWLGAFKSYIEDPVTLML 436


>gi|224083213|ref|XP_002189917.1| PREDICTED: similar to dihydrolipoamide S-acetyltransferase (E2
           component of pyruvate dehydrogenase complex)
           [Taeniopygia guttata]
          Length = 574

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 181/466 (38%), Positives = 271/466 (58%), Gaps = 59/466 (12%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           IT+P+LSPTMT G + +W K+ G+K++ GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 120 ITLPALSPTMTMGTVQRWEKKVGEKLNEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 179

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHS--------------------- 104
           T ++ + + +  I+    +IP         + +++                         
Sbjct: 180 TRDVPLGAALCIIVEKEADIPAFADYQAAAVTDMKAAAPSAPPPPQLAACASSSLKMGSI 239

Query: 105 -------HSSPVVVREK------HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVK 151
                  +SS  +          H   R + SPLA++LA E GIDL+ + G+GP GRI K
Sbjct: 240 SSLFYFVYSSADLTPTAPSAGPPHKGGRVVVSPLAKKLAAEKGIDLTQVKGTGPDGRITK 299

Query: 152 SDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQ 211
            D+E+ + +K                       +    + ++  IP  NIR+ IA RL Q
Sbjct: 300 KDVESFVPSKAAPAAAPGAIP----------AAVEAAPEGTFTDIPISNIRRVIAQRLMQ 349

Query: 212 SKQTIPHFYVSIDCNIDNLLSLREQMN----------RTLQFHREEISN-KISVNDIILK 260
           SKQTIPH+Y+SID N+  +L LR+++N          + + F     SN K+SVND I+K
Sbjct: 350 SKQTIPHYYLSIDVNMGKVLVLRKELNQVSSGILAWEKNILFSAFCGSNIKLSVNDFIIK 409

Query: 261 AFALAMIQVPEANVSWTTNAMIRHKH-IDISVAVSIPGGIVTPIIRQADQKSILDISLEV 319
           A ALA ++VPEAN SW  + +IR  H +D+SVAVS P G++TPI+  A  K +  IS +V
Sbjct: 410 ASALACLKVPEANSSW-MDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGLAAISKDV 468

Query: 320 KQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQN 379
             LA +A++ KL+P E+QGGT +ISN+GM GI +F A+INPPQ+ ILA+G+ ++ +V  +
Sbjct: 469 ASLAAKAREGKLQPHEFQGGTFTISNLGMYGIKNFSAIINPPQACILAVGSSKEILVPAD 528

Query: 380 EE--IKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            E    VA++M+ TLS DHR VDGA+ ++ LA+FK+++E PV ML+
Sbjct: 529 NEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFKKFLEKPVTMLL 574



 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 49/72 (68%), Gaps = 4/72 (5%)

Query: 15 MTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSP 74
          M  G +++W K+EGDKI+ GD++ E+ETDKA + FES++E  + +ILVP GT ++    P
Sbjct: 1  MQMGTISRWEKKEGDKINEGDLIAEVETDKATVGFESLEECYLAKILVPEGTRDV----P 56

Query: 75 ILNILMDSTEIP 86
          I  I+  + E P
Sbjct: 57 IGAIICITVEKP 68


>gi|269958409|ref|YP_003328196.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Anaplasma
           centrale str. Israel]
 gi|269848238|gb|ACZ48882.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Anaplasma
           centrale str. Israel]
          Length = 431

 Score =  318 bits (814), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 180/457 (39%), Positives = 264/457 (57%), Gaps = 69/457 (15%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDE-GIIDEILVPA 64
           + MP+LSPTM  G +AKW K+EGD + PGD++ +IETDKA+MEFE VDE G++ +IL   
Sbjct: 5   VLMPALSPTMKSGIVAKWHKKEGDPVKPGDVIADIETDKAVMEFEYVDEPGVLHKILTQE 64

Query: 65  GTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREK---------- 114
           GT ++ VN  I  + +   +I        E + EV    +   P   +EK          
Sbjct: 65  GTRDVPVNQVIAVVRVGDEDIGSV----DEALCEVGHSATAKGPTAAQEKPATAAPASPC 120

Query: 115 -------------HSKNR-----PI----------ASPLARRLAGEHGIDLSSLSGSGPH 146
                        H + +     PI          A+PLA++LA    +D++ +SG+GP+
Sbjct: 121 AASTEKAAQPQLKHQQPKMGVAYPIPDFVEERKIKATPLAKKLAARLSVDITKISGTGPY 180

Query: 147 GRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIA 206
           GR+VK+DI           D ++  SF     + DA      A D  EV    ++R+ IA
Sbjct: 181 GRVVKADI----------LDATSAGSF---PSTTDA------AGDVVEV---SSMRRVIA 218

Query: 207 CRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAM 266
            RL +SK T+PHFY+++DC +  LL LR ++N +      +   +I+VND +LKA ALAM
Sbjct: 219 DRLLESKLTVPHFYLAVDCMVGELLKLRAEINGSCA----DRGTRITVNDFVLKAAALAM 274

Query: 267 IQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRA 326
            + PE N SW  + +  H+ ++IS AVSI GG++TP+++  D K + +IS   K L  RA
Sbjct: 275 REFPEINSSWEGDRIRYHRDVNISFAVSIDGGLITPVVKNVDVKPLSEISDTTKSLTTRA 334

Query: 327 KQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVAT 386
           K+RKL+P E+QGG  ++SN+GM G+  F A+INPPQS I+A+G  EK+ V  +  +  A 
Sbjct: 335 KERKLQPSEFQGGGFTVSNLGMFGVREFYAIINPPQSCIMAVGQSEKRAVVVDGCVVPAD 394

Query: 387 IMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           +M  TLS DHR VDG +A+K L +FK YIENP+ ML+
Sbjct: 395 VMTVTLSVDHRVVDGVLAAKFLNRFKFYIENPLLMLV 431


>gi|56417199|ref|YP_154273.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Anaplasma
           marginale str. St. Maries]
 gi|56388431|gb|AAV87018.1| dihydrolipoamide acetyltransferase component [Anaplasma marginale
           str. St. Maries]
          Length = 433

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 176/462 (38%), Positives = 262/462 (56%), Gaps = 77/462 (16%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDE-GIIDEILVPA 64
           + MP+LSPTM  G +A+W K+EGD + PGD++ +IETDKA+MEFE VDE G++ +IL   
Sbjct: 5   VLMPALSPTMKSGIVARWHKKEGDSVKPGDVIADIETDKAVMEFEYVDEPGVLYKILTQE 64

Query: 65  GTENIAVNSPI----------------LNILMDS-------------------------- 82
           GT ++ VN  I                 N+  D+                          
Sbjct: 65  GTRDVPVNQVIAVVRVGDEDVASVEALCNVAHDADAKGSAADSQGTAAVAAPASPSVVTN 124

Query: 83  TEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI-ASPLARRLAGEHGIDLSSLS 141
           TE P  P   ++     R E   + P+      ++ R I A+PLA++LA    +D++ ++
Sbjct: 125 TEKPSQPQPERQ-----RPERGVAYPI---PDFAEERKIKATPLAKKLASRLSVDITKVA 176

Query: 142 GSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNI 201
           G+GP+GR+VK+D+                     +D +      +       +V+   ++
Sbjct: 177 GTGPYGRVVKADV---------------------LDAAAGGGFPSTTGAAGGDVVEVSSM 215

Query: 202 RKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKA 261
           R+ IA RL +SK T+PHFY+++DC +  LL LR ++N +      +   KI+VND +LKA
Sbjct: 216 RRVIADRLLESKLTVPHFYLAVDCMVGELLKLRVEINDSCA----DRGTKITVNDFVLKA 271

Query: 262 FALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQ 321
            ALAM + PE N SW  + +  H+ I+IS AVSI GG++TP++   D KS+ +IS   K 
Sbjct: 272 VALAMREFPEINSSWEGDRIRYHRDINISFAVSIDGGLITPVVENVDAKSLSEISDITKS 331

Query: 322 LAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE 381
           LA RAK+RKL+P E+QGG  ++SN+GM G+  F A+INPPQS I+A+G  EK+ V  +  
Sbjct: 332 LATRAKERKLQPHEFQGGGFTVSNLGMFGVREFYAIINPPQSCIMAVGQSEKRAVVVDGC 391

Query: 382 IKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           +  A +M  TLS DHRSVDG +A+K L +FK YIENP+ ML+
Sbjct: 392 VVPADVMTVTLSVDHRSVDGVLAAKFLNRFKFYIENPLLMLV 433


>gi|321463356|gb|EFX74372.1| hypothetical protein DAPPUDRAFT_188759 [Daphnia pulex]
          Length = 502

 Score =  316 bits (810), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 173/437 (39%), Positives = 254/437 (58%), Gaps = 33/437 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G L  W KQEGDK++ GD+L EIETDKA M FE+ +EG + +I++PAG
Sbjct: 80  VELPALSPTMESGTLISWEKQEGDKLNEGDLLAEIETDKATMGFETPEEGYLAKIMIPAG 139

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHS--------- 116
           ++++ +   +  I+  + ++        +         S    ++   + S         
Sbjct: 140 SKDVPIGKLVCIIVEKAEDVAAFKDFKDDGAAVAAPAASQQPEIITPSQSSVATAAPVPS 199

Query: 117 ------KNRPIASPLARRLAGEHGIDLSSLSG-SGPHGRIVKSDIETLISTKTNVKDYST 169
                   R  ASPLAR++A E GI L+S+SG SG  G I   D++     K +V     
Sbjct: 200 STAATSSERVFASPLARKMAAEKGISLASVSGGSGFEGSITAKDLD-----KVSVAPKPV 254

Query: 170 IQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
                     I A      A   Y  +P  NIR  IA RL QSKQ+IPH+Y+++D  +D+
Sbjct: 255 AAVPPTAAAPIQA-----VAGQKYTDLPVTNIRGVIAKRLLQSKQSIPHYYLTVDVTMDS 309

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDI 289
           +LSLR++ N  L     +   K+SVND ++KA ALA  +VPE N SW    + ++  +DI
Sbjct: 310 VLSLRQEFNTLLG----KDGAKLSVNDFVIKAAALACRKVPEVNSSWQETFIRQYDTVDI 365

Query: 290 SVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGML 349
           SVAVS   G++TPI+  A++K +  IS +V+ LA +A+  KL+P E+QGGT SISN+GM 
Sbjct: 366 SVAVSTDRGLITPIVFNAERKGLASISADVRTLAGKARDGKLQPHEFQGGTFSISNLGMF 425

Query: 350 GINSFCAVINPPQSTILAIGAGEKKVVFQ---NEEIKVATIMNATLSADHRSVDGAIASK 406
           G+ +F A+INPPQS ILA+G  EK++V      +  + A +M  TLS+DHR VDGA+ ++
Sbjct: 426 GVRNFTAIINPPQSCILAVGGTEKRLVVDASAEQGFRAANVMTVTLSSDHRVVDGAVGAQ 485

Query: 407 LLAKFKEYIENPVWMLM 423
            LA FK Y+E P  ML+
Sbjct: 486 WLAAFKSYLEKPSTMLL 502


>gi|19075255|ref|NP_587755.1| dihydrolipoamide S-acetyltransferase E2 (predicted)
           [Schizosaccharomyces pombe 972h-]
 gi|3914192|sp|O59816|ODP2_SCHPO RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component of pyruvate dehydrogenase complex,
           mitochondrial; AltName: Full=Dihydrolipoamide
           acetyltransferase component of pyruvate dehydrogenase
           complex; AltName: Full=Pyruvate dehydrogenase complex
           component E2; Short=PDC-E2; Short=PDCE2; Flags:
           Precursor
 gi|3150120|emb|CAA19134.1| dihydrolipoamide S-acetyltransferase E2 (predicted)
           [Schizosaccharomyces pombe]
          Length = 483

 Score =  316 bits (809), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 179/440 (40%), Positives = 257/440 (58%), Gaps = 29/440 (6%)

Query: 4   HT-ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HT I MP+LSPTMT G +  + K+ GDKI PGD+LCEIETDKA ++FE  DEG + +IL+
Sbjct: 53  HTVINMPALSPTMTTGNIGAFQKKIGDKIEPGDVLCEIETDKAQIDFEQQDEGYLAKILI 112

Query: 63  PAGTENIAVNSPIL--------------NILMDSTEIPPSPPLSKENIVEVREEHSH--S 106
             GT+++ V  P+                 + DS+   PS    +E      E+ S   S
Sbjct: 113 ETGTKDVPVGKPLAVTVENEGDVAAMADFTIEDSSAKEPSAKSGEEKSAPSSEKQSKETS 172

Query: 107 SPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKD 166
           SP  V  +   +R  ASPLAR+LA E  +DLS + GSGP+GRI+K DIE     K  V  
Sbjct: 173 SPSNVSGEERGDRVFASPLARKLAEEKDLDLSQIRGSGPNGRIIKVDIENF---KPVVAP 229

Query: 167 YSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
             + ++         +        D YE +P  N+RK IA RL +SK   PH+YV++  N
Sbjct: 230 KPSNEAAAKATTPAASAADAAAPGD-YEDLPLSNMRKIIASRLAESKNMNPHYYVTVSVN 288

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           ++ ++ LR  +N            K+SVND+++KA   A+ QVPE N +W  + + ++K+
Sbjct: 289 MEKIIRLRAALNAMADGRY-----KLSVNDLVIKATTAALRQVPEVNAAWMGDFIRQYKN 343

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
           +DIS+AV+ P G++TP+IR      + +IS   K   QRA+  KLKPEEYQGGT +ISN+
Sbjct: 344 VDISMAVATPSGLITPVIRNTHALGLAEISTLAKDYGQRARNNKLKPEEYQGGTFTISNL 403

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVV---FQNEEIKVATIMNATLSADHRSVDGAI 403
           GM  ++ F A+INPPQ+ ILA+G     VV      +  KVA IM  TLS+DHR VDGA+
Sbjct: 404 GMFPVDQFTAIINPPQACILAVGTTVDTVVPDSTSEKGFKVAPIMKCTLSSDHRVVDGAM 463

Query: 404 ASKLLAKFKEYIENPVWMLM 423
           A++     K+ +ENP+ +++
Sbjct: 464 AARFTTALKKILENPLEIML 483


>gi|88608175|ref|YP_506817.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Neorickettsia sennetsu str. Miyayama]
 gi|88600344|gb|ABD45812.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Neorickettsia sennetsu str. Miyayama]
          Length = 403

 Score =  315 bits (808), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 178/428 (41%), Positives = 263/428 (61%), Gaps = 40/428 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG LAKW+  EG+KI  G ++ EIETDKA MEFE+VDEG++ +IL+PA 
Sbjct: 5   ILMPALSPTMKEGTLAKWLVSEGEKIEAGQVIAEIETDKATMEFEAVDEGVLGKILIPAK 64

Query: 66  TENIAVNSPILNILMDSTEIPPS-----PPLSKENIVEVREEHS-----HSSPVVVREKH 115
           T  + VN PI  +L+D  E           + K  + + + E S      ++P  +    
Sbjct: 65  TAGVKVNQPI-AVLLDDGEGEKELKKFLSTIDKPTVTDNKAETSDGDKIKNNPSSLPADK 123

Query: 116 SKNRPIASPLARRLAGEHGIDLSSL-SGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFG 174
            + R IA+PLAR++A  +GIDLS + SGSGP GRIVK+D+  L+       D   +Q  G
Sbjct: 124 QQGRVIATPLARKIASINGIDLSLIGSGSGPDGRIVKNDLLKLLD------DAPQVQMHG 177

Query: 175 LVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLR 234
              E+                IP   +R+ IA RL +SKQ +PHFY+S+ C + +LLS +
Sbjct: 178 HCTET---------------SIPISPMRRVIAQRLVESKQNVPHFYLSVTCYLQHLLSAK 222

Query: 235 EQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVS 294
           ++    L+        K++VND ++KA A A+ + P  NVSW    + +++ IDISVAV+
Sbjct: 223 KKFYDCLE-------TKVTVNDFVIKACAFALDKNPAMNVSWEGEFIRQNQTIDISVAVA 275

Query: 295 IPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSF 354
           IP G++TPI+  AD+ S+  IS EV++L  +AK  +L+P E+QGG+ ++SN+GM GI+ F
Sbjct: 276 IPDGLITPIVFSADKLSLSSISDEVRELVDKAKAGRLQPREFQGGSFTVSNLGMYGIDEF 335

Query: 355 CAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEY 414
            A+INPPQ+ ILA+GA  K      + + V+ ++  TLS DHR +DGA+A++ +   K+ 
Sbjct: 336 TAIINPPQAAILAVGAARKVPTVSADAVVVSDVVTLTLSCDHRVIDGALAARFMQSLKKA 395

Query: 415 IENPVWML 422
           IE+PV ML
Sbjct: 396 IEDPVIML 403


>gi|254797270|ref|YP_003082112.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Neorickettsia risticii str. Illinois]
 gi|254590511|gb|ACT69873.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Neorickettsia risticii str. Illinois]
          Length = 479

 Score =  315 bits (808), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 177/433 (40%), Positives = 264/433 (60%), Gaps = 40/433 (9%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           +M   I MP+LSPTM EG LAKW+  EG+KI  G ++ EIETDKA MEFE+VDEG++ +I
Sbjct: 76  LMPVKILMPALSPTMKEGTLAKWLVSEGEKIEAGQVIAEIETDKATMEFEAVDEGVLGKI 135

Query: 61  LVPAGTENIAVNSPILNILMDSTE----------IPPSPPLSKENIVEVREEHSHSSPVV 110
           L+ A T  + VN PI  IL+D  E          I   P ++        E+   S+P  
Sbjct: 136 LIHAKTAGVKVNEPI-AILLDDGEGERELEEFLSITDKPTITDNKAETPNEDKIKSNPSS 194

Query: 111 VREKHSKNRPIASPLARRLAGEHGIDLSSL-SGSGPHGRIVKSDIETLISTKTNVKDYST 169
           +  +  ++R  A+PLAR++A  + IDLS + SGSGP+GRIVK+D+               
Sbjct: 195 LPCEKQQDRIAATPLARKIASINSIDLSLIGSGSGPNGRIVKNDL--------------- 239

Query: 170 IQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
                L+D +    +   + + S   IP   +R+ IA RL +SKQ +PHFY+S+ C + +
Sbjct: 240 ---LKLLDSAPQVEMPGHYTETS---IPISPMRRVIAQRLVESKQNVPHFYLSVTCYLQH 293

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDI 289
           LLS +++    L+        K++VND ++KA A A+ + P  NVSW    + +++ IDI
Sbjct: 294 LLSAKKKFYDCLE-------TKVTVNDFVIKACAFALDKNPAMNVSWEGEFIRQNQTIDI 346

Query: 290 SVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGML 349
           SVAV+IP G++TPII  AD+ S+  IS +V++L  +AK  +L+P E+QGG+ ++SN+GM 
Sbjct: 347 SVAVAIPDGLITPIIFSADKLSLSSISDKVRELVDKAKMGRLQPREFQGGSFTVSNLGMY 406

Query: 350 GINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLA 409
           GI+ F A+INPPQ+ ILA+GA  K      + I V+ ++  TLS DHR +DGA+A++ + 
Sbjct: 407 GIDEFTAIINPPQAAILAVGAARKVPTVSGDAIVVSDVVTLTLSCDHRVIDGALAARFMQ 466

Query: 410 KFKEYIENPVWML 422
             K+ IE+PV ML
Sbjct: 467 SLKKAIEDPVIML 479


>gi|302695797|ref|XP_003037577.1| hypothetical protein SCHCODRAFT_81014 [Schizophyllum commune H4-8]
 gi|300111274|gb|EFJ02675.1| hypothetical protein SCHCODRAFT_81014 [Schizophyllum commune H4-8]
          Length = 451

 Score =  315 bits (807), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 173/444 (38%), Positives = 262/444 (59%), Gaps = 37/444 (8%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +    MP++SPTMTEG +A W K+EG+  + GD+L EIETDKA ++ E+ D+G++ +I+V
Sbjct: 22  LAQFNMPAMSPTMTEGGIASWKKKEGETFAAGDVLLEIETDKATIDVEAQDDGVLAKIIV 81

Query: 63  PAGTENIAVNSPILNILMDSTEIP-----------PSPPLSKENIVEVREEH------SH 105
             G + + V +PI  +  +  ++            P PP  +E   E  +        S 
Sbjct: 82  NDGAKGVKVGAPIAIVGEEGDDLSKAADMAKAAEAPEPPKKEEKAPEPPKSEAPPPSESK 141

Query: 106 SSPVVVREKH---SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKT 162
           S+P     K    + +R  ASP+A+++A E GI L+ + GSGP GRI++ D+E       
Sbjct: 142 SAPPKTESKADLPAGDRIFASPIAKKIALEKGIPLAKVKGSGPEGRILREDVEKF----- 196

Query: 163 NVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVS 222
             K  +   +   V     A      + + Y   P  N+R+ I  RL QSK  +PH+Y++
Sbjct: 197 --KPEAAASAPAGVSGGAPAA-----SPEEYTDTPLSNMRRVIGQRLLQSKVEVPHYYLT 249

Query: 223 IDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMI 282
           +D N+D +L LRE  N+TL    ++   K+SVND ++KA   A+  VPEAN ++  + + 
Sbjct: 250 VDINMDKVLKLREVFNKTLA--EKDKGAKLSVNDFVVKAVGCALADVPEANSAFFGDYIR 307

Query: 283 RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTS 342
            +K  DISVAV+ P G++TPII+    K +  IS E K LA++A+  KL+P+EYQGGT +
Sbjct: 308 TYKKADISVAVATPTGLITPIIKDVGGKGLATISAEAKSLAKKARDGKLQPQEYQGGTFT 367

Query: 343 ISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE---IKVATIMNATLSADHRSV 399
           ISN+GM  I+ F A+INPPQS ILA+G+ +  +V   EE    K A IM  TLS+DHR+V
Sbjct: 368 ISNLGMFDISHFTAIINPPQSCILAVGSTQPTLVPAPEEERGFKTANIMKVTLSSDHRTV 427

Query: 400 DGAIASKLLAKFKEYIENPVWMLM 423
           DGAI ++ L+ FK Y+ENP+  ++
Sbjct: 428 DGAIGARWLSAFKGYLENPLTFML 451


>gi|254995367|ref|ZP_05277557.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Anaplasma
           marginale str. Mississippi]
          Length = 433

 Score =  315 bits (807), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 175/462 (37%), Positives = 261/462 (56%), Gaps = 77/462 (16%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDE-GIIDEILVPA 64
           + MP+LSPTM  G +A+W K+EGD + PGD++ +IETDKA+MEFE VDE G++ +IL   
Sbjct: 5   VLMPALSPTMKSGIVARWHKKEGDSVKPGDVIADIETDKAVMEFEYVDEPGVLYKILTQE 64

Query: 65  GTENIAVNSPI----------------LNILMDS-------------------------- 82
           GT ++ VN  I                 N+  D+                          
Sbjct: 65  GTRDVPVNQVIAVVRVGDEDVASVEALCNVAHDADAKGSAADSQGTAAVAAPASPSVATN 124

Query: 83  TEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI-ASPLARRLAGEHGIDLSSLS 141
           TE P  P   ++     R E   + P+      ++ R I A+PLA++LA    +D++ ++
Sbjct: 125 TEKPSQPQPERQ-----RPERGVAYPI---PDFAEERKIKATPLAKKLASRLSVDITKVA 176

Query: 142 GSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNI 201
           G+GP+GR+VK+D+                     +D +      +       +V+   ++
Sbjct: 177 GTGPYGRVVKADV---------------------LDAAAGGGFPSTTGAAGGDVVEVSSM 215

Query: 202 RKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKA 261
           R+ IA RL +SK T+PHFY+++DC +  LL LR ++N +      +   KI+VND +LKA
Sbjct: 216 RRVIADRLLESKLTVPHFYLAVDCMVGELLKLRVEINDSCA----DRGTKITVNDFVLKA 271

Query: 262 FALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQ 321
            ALAM + PE N SW  + +  H+ I+IS AVSI GG++TP++   D KS+ +IS   K 
Sbjct: 272 VALAMREFPEINSSWEGDRIRYHRDINISFAVSIDGGLITPVVENVDAKSLSEISDITKS 331

Query: 322 LAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE 381
           L  RAK+RKL+P E+QGG  ++SN+GM G+  F A+INPPQS I+A+G  EK+ V  +  
Sbjct: 332 LVTRAKERKLQPHEFQGGGFTVSNLGMFGVREFYAIINPPQSCIMAVGQSEKRAVVVDGC 391

Query: 382 IKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           +  A +M  TLS DHRSVDG +A+K L +FK YIENP+ ML+
Sbjct: 392 VVPADVMTVTLSVDHRSVDGVLAAKFLNRFKFYIENPLLMLV 433


>gi|222475564|ref|YP_002563981.1| dihydrolipoamide acetyltransferase component (pdhC) [Anaplasma
           marginale str. Florida]
 gi|222419702|gb|ACM49725.1| dihydrolipoamide acetyltransferase component (pdhC) [Anaplasma
           marginale str. Florida]
          Length = 433

 Score =  315 bits (807), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 175/462 (37%), Positives = 261/462 (56%), Gaps = 77/462 (16%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDE-GIIDEILVPA 64
           + MP+LSPTM  G +A+W K+EGD + PGD++ +IETDKA+MEFE VDE G++ +IL   
Sbjct: 5   VLMPALSPTMKSGIVARWHKKEGDSVKPGDVIADIETDKAVMEFEYVDEPGVLYKILTQE 64

Query: 65  GTENIAVNSPI----------------LNILMDS-------------------------- 82
           GT ++ VN  I                 N+  D+                          
Sbjct: 65  GTRDVPVNQVIAVVRVGDEDVASVEALCNVAHDADAKGSAADSQGTAAVAAPASPSVATN 124

Query: 83  TEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI-ASPLARRLAGEHGIDLSSLS 141
           TE P  P   ++     R E   + P+      ++ R I A+PLA++LA    +D++ ++
Sbjct: 125 TEKPSQPQPERQ-----RPERGVAYPI---PDFAEERKIKATPLAKKLASRLSVDITKVA 176

Query: 142 GSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNI 201
           G+GP+GR+VK+D+                     +D +      +       +V+   ++
Sbjct: 177 GTGPYGRVVKADV---------------------LDAAAGGGFPSTTGAAGGDVVEVSSM 215

Query: 202 RKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKA 261
           R+ IA RL +SK T+PHFY+++DC +  LL LR ++N +      +   KI+VND +LKA
Sbjct: 216 RRVIADRLLESKLTVPHFYLAVDCMVGELLKLRVEINDSCA----DRGTKITVNDFVLKA 271

Query: 262 FALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQ 321
            ALAM + PE N SW  + +  H+ I+IS AVSI GG++TP++   D KS+ +IS   K 
Sbjct: 272 VALAMREFPEINSSWEGDRIRYHRDINISFAVSIDGGLITPVVENVDAKSLSEISDITKS 331

Query: 322 LAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE 381
           L  RAK+RKL+P E+QGG  ++SN+GM G+  F A+INPPQS I+A+G  EK+ V  +  
Sbjct: 332 LVTRAKERKLQPHEFQGGGFTVSNLGMFGVREFYAIINPPQSCIMAVGQSEKRAVVVDGC 391

Query: 382 IKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           +  A +M  TLS DHRSVDG +A+K L +FK YIENP+ ML+
Sbjct: 392 VVPADVMTVTLSVDHRSVDGVLATKFLNRFKFYIENPLLMLV 433


>gi|226477856|emb|CAX72635.1| putative dihydrolipoamide S-acetyltransferase (E2 component of
           pyruvate dehydrogenase complex) [Schistosoma japonicum]
          Length = 497

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 181/451 (40%), Positives = 261/451 (57%), Gaps = 54/451 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +  W K EGD++S GD+L EIETDKA M F++ + G + +IL PAG
Sbjct: 68  VKLPNLSPTMETGTVVSWAKNEGDEVSEGDLLAEIETDKATMSFDASESGYLAKILAPAG 127

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSH------SSPVVVREKHSK-- 117
           +++I V + +  I+ D   +P      K+ +VE  E+ +       S P  V    +   
Sbjct: 128 SKDIPVGTALCIIVQDENAVPAF----KDYVVESTEKVATPKAKEVSKPQTVSAATAPSP 183

Query: 118 -----------------NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETL-IS 159
                             R +ASP AR LA E G+DLS + G+G  G I   D+     S
Sbjct: 184 KPTPVTPTPTSKTPTCGERIVASPYARCLAAEKGLDLSQVVGTGIDGMIRSVDLSAAPTS 243

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
            K      S I   G                  +E I   N+R  IA RL QSKQTIPH+
Sbjct: 244 LKATTMTTSPIPVSG-----------------KFEDISVSNMRSVIAKRLIQSKQTIPHY 286

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREEISN----KISVNDIILKAFALAMIQVPEANVS 275
           Y+++D  +D +L +R ++N  L    +  S+    KIS+NDI++KA +LA ++VPE N S
Sbjct: 287 YLTMDIQLDEILEIRSKINANLSSLVDAKSDEPVLKISLNDILIKAASLACLKVPECNSS 346

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           W  + + R+ ++DISVAV++P G++TPII  AD K ++ I+ E++ L  +AKQ KL+P+E
Sbjct: 347 WQGDFIRRYHNVDISVAVAVPAGLITPIIFSADTKGLVQINKEMRMLVAKAKQNKLQPQE 406

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE---IKVATIMNATL 392
           YQGGT SISN+GM GI++F AVINPPQS ILA+G+  +K++  N      K A I++ TL
Sbjct: 407 YQGGTFSISNLGMFGISNFSAVINPPQSCILAVGSSRQKILPDNNNPAGFKKANILSVTL 466

Query: 393 SADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           S DHR VDGA+ +  L +FK  +ENP  ML+
Sbjct: 467 SCDHRVVDGAVGATWLGEFKNILENPALMLI 497


>gi|190337297|gb|AAI63278.1| Dihydrolipoamide S-acetyltransferase (E2 component of pyruvate
           dehydrogenase complex) [Danio rerio]
 gi|190340247|gb|AAI63264.1| Dihydrolipoamide S-acetyltransferase (E2 component of pyruvate
           dehydrogenase complex) [Danio rerio]
          Length = 652

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 173/439 (39%), Positives = 262/439 (59%), Gaps = 28/439 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +I++  G
Sbjct: 221 VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKIMISEG 280

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHS--------- 116
           T ++ + +P+  I+   ++I       +  +                             
Sbjct: 281 TRDVPLGTPLCIIVEKESDISAFADYVETGVAASPPPAPTPVATPPPAAAPAAPIPAPAA 340

Query: 117 ---------KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDY 167
                    K R  ASPLA++LA E G+D++ ++G+GP GR+ K DI++ +  K      
Sbjct: 341 APAAPAAARKGRVFASPLAKKLAAEKGVDITQVTGTGPDGRVTKKDIDSFVPPKLAPAAA 400

Query: 168 STIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNI 227
           +   +         A         ++  +P  NIRK IA RL QSKQTIPH+Y+SID N+
Sbjct: 401 AAPSA--PTPSPPAAPAYAAVPTGTFTDVPISNIRKVIAQRLMQSKQTIPHYYLSIDVNM 458

Query: 228 DNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI 287
           D +L LR+++N  ++   E I  K+SVND I+KA ALA ++VPEAN SW  + +IR  H+
Sbjct: 459 DQVLELRKELNAEVK--AENI--KLSVNDFIIKASALACLKVPEANSSWM-DTVIRQNHV 513

Query: 288 -DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
            D+SVAVS P G++TPI+  A  K + +IS +V  LA +A+  KL+P E+QGGT +ISN+
Sbjct: 514 VDVSVAVSTPVGLITPIVFNAHIKGLANISKDVSALAAKARDGKLQPHEFQGGTFTISNL 573

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGAIA 404
           GM GI  F A+INPPQ+ ILA+G  EK+++  + E    VA +M+ TLS DHR VDGA+ 
Sbjct: 574 GMYGIKHFSAIINPPQACILAVGGSEKRLLPADNEKGFDVANMMSVTLSCDHRVVDGAVG 633

Query: 405 SKLLAKFKEYIENPVWMLM 423
           ++ LA+F++++E P  ML+
Sbjct: 634 AQWLAEFRKFLEKPFTMLL 652



 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FE ++E  + +ILV  G
Sbjct: 95  VELPALSPTMQMGTIARWEKKEGDKINEGDLIAEVETDKATVGFEMLEECYLAKILVAEG 154

Query: 66  TENIAVNSPILNILMDSTEI 85
           T ++ + + ++ I +D  E+
Sbjct: 155 TRDVPIGA-VICITVDKPEL 173


>gi|332023094|gb|EGI63357.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex, mitochondrial [Acromyrmex
           echinatior]
          Length = 487

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 176/438 (40%), Positives = 262/438 (59%), Gaps = 43/438 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +  W K+EGDK++ GD+L EIETDKA M FE+ +EG + +ILVPAG
Sbjct: 70  VPLPALSPTMETGTIISWQKKEGDKLNEGDLLAEIETDKATMGFETPEEGYLAKILVPAG 129

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSH---SSPVVVRE--------- 113
           T+N+ +   +  I+ D + +        + +     + +    +SP +            
Sbjct: 130 TKNVPIGKLVCIIVQDESNVAAFKDFKDDTMAAPPPKPTTITPASPTITTPVAPSVSAVA 189

Query: 114 ------KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDY 167
                   SK R  ASPLA++LA E G+ L  L G+G +  I   D+E            
Sbjct: 190 KVPSIVPPSKERIYASPLAKKLAAEKGLSLQGLKGTGLYDSITSKDLE------------ 237

Query: 168 STIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNI 227
                 G V + +   I ++ A    + IP  NIR  IA RL +SKQTIPH+Y+S+D  +
Sbjct: 238 ------GAVVQPLQPVITSIGAPTGID-IPISNIRAIIAKRLSESKQTIPHYYLSVDIKM 290

Query: 228 DNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI 287
           D +L++REQ N+ L+  +++I  K+S+NDII+K  A+A  +VPE N +W  N + ++ ++
Sbjct: 291 DPVLAMREQFNKLLE--KDKI--KLSINDIIIKGMAMACKKVPEGNSAWLGNIIRQYNNV 346

Query: 288 DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMG 347
           D+SVAVS   G++TPI+  AD K I+ IS +VK LA +A++ KLKP E+QGGT ++SN+G
Sbjct: 347 DVSVAVSTDSGLITPIVFGADVKGIVQISKDVKALAMKAREGKLKPHEFQGGTITVSNLG 406

Query: 348 MLGINSFCAVINPPQSTILAIGAGEKKVV-FQNEE-IKVATIMNATLSADHRSVDGAIAS 405
           M GI +F A+INPPQS ILA G  E +++  +NE+    A  M+ T S DHR VDGAI +
Sbjct: 407 MFGIKNFSAIINPPQSIILATGVTEARLIPAKNEKGFTTAQYMSVTASCDHRIVDGAIGA 466

Query: 406 KLLAKFKEYIENPVWMLM 423
           + L  FK+ +ENP  ML+
Sbjct: 467 QWLTAFKDLMENPTTMLL 484


>gi|119946406|ref|YP_944086.1| dihydrolipoamide dehydrogenase E3 component of 3 enzyme complexes
           [Psychromonas ingrahamii 37]
 gi|119865010|gb|ABM04487.1| dihydrolipoamide dehydrogenase E3 component of 3 enzyme complexes
           [Psychromonas ingrahamii 37]
          Length = 431

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 173/430 (40%), Positives = 271/430 (63%), Gaps = 19/430 (4%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I +P +      G +A W   EGD I  GD++ E+ETDKA++E ES   G++ +ILV + 
Sbjct: 5   IKLPEVVSGFESGVIASWCVNEGDNIKKGDVIFEVETDKAVIEVESPGAGVLGKILVDSN 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPV----------VVREKH 115
           +  +AV++ +  IL+++ +  PS  LS E ++   ++ +  +PV          V     
Sbjct: 65  SSPVAVDTIVGMILLENED--PSV-LSGEPVI-TNDDANTPAPVSDVKPDKIQAVPSASS 120

Query: 116 SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKT-NVKDYSTIQSFG 174
             +R +ASPLA+ +A  + IDLS++ G+GP  RI+K+D+E +I+ K+ N     T  +  
Sbjct: 121 GASRIMASPLAKVIAANNNIDLSNVVGTGPRNRILKADVENIINNKSDNSPAIMTTSAEN 180

Query: 175 LVDESIDAN-ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSL 233
             D S+  + + +    ++ ++ PH  +RK IA RL +SK TIPHFYVSIDC +DNL  L
Sbjct: 181 KPDNSVPLDKVASTVNTENSDITPHTAMRKVIASRLTESKTTIPHFYVSIDCEVDNLNLL 240

Query: 234 REQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAV 293
           R + N    F+++  + K++VND I+KA ALA+ + PE N  W +  + ++K+IDISVAV
Sbjct: 241 RAEFN---AFYKDHENVKLTVNDFIIKAVALAIHKHPEINSMWLSEGVKKNKNIDISVAV 297

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
           S   G++TPI+  AD+K ++ +S  +K L  + +  KL+P EYQGG  +ISN+GM  I+S
Sbjct: 298 STDDGLMTPIVFNADRKGLITLSQNMKSLVSKTRSGKLQPNEYQGGGFTISNLGMYDIDS 357

Query: 354 FCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKE 413
           F A+INPPQS ILA+G  +K  V ++++I +A +MN TLS DHR +DG++A++ L  FK 
Sbjct: 358 FNAIINPPQSCILAVGRAKKIPVVKDDQILIANVMNCTLSVDHRVIDGSVAAEFLQTFKF 417

Query: 414 YIENPVWMLM 423
           YIENP  M++
Sbjct: 418 YIENPKHMML 427


>gi|224100693|ref|XP_002311977.1| predicted protein [Populus trichocarpa]
 gi|222851797|gb|EEE89344.1| predicted protein [Populus trichocarpa]
          Length = 588

 Score =  313 bits (802), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 180/421 (42%), Positives = 261/421 (61%), Gaps = 23/421 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G +AKW K+EGDKI  GD++CEIETDKA +EFE+++EG + +IL P G
Sbjct: 166 LGMPALSPTMNQGNIAKWRKKEGDKIEVGDVICEIETDKATLEFETLEEGYLAKILAPEG 225

Query: 66  TENIAVNSPILNILMDSTEIPP----SPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           ++++AV  PI   + DS +I      +   S + + E +  H  S     +EK +  R  
Sbjct: 226 SKDVAVGQPIAITVEDSNDIEAVKTSASSSSGKKVKEEKPTHHGSKAEASKEKGNFKR-- 283

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ-SFGLVDESI 180
            SP A+ L  EHG+D SSL  SGP+G ++K+D+   I +    K  +  + +        
Sbjct: 284 ISPSAKLLISEHGLDASSLHASGPYGTLLKTDVLAAIKSGKGKKSSAAEKGAPPPQKSPQ 343

Query: 181 DANILNLFAK--DSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMN 238
            + I +L  K  DS+E +P+  IRK IA RL +SKQT PH Y+S D  +D LLS R+++ 
Sbjct: 344 PSAIPSLEPKQSDSFEDLPNTQIRKVIARRLLESKQTTPHLYLSTDVILDPLLSFRKEL- 402

Query: 239 RTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTT--NAMIRHKHIDISVAVSIP 296
                 +E+   K+SVNDI++KA A+A+  VP+AN  W      +I    +DIS+AV+  
Sbjct: 403 ------KEQHDVKVSVNDIVIKAVAIALRNVPQANAYWNVEKGEIILCDSVDISIAVATE 456

Query: 297 GGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCA 356
            G++TPI+R ADQKSI  IS EVKQLA++A+  KL P E+QGGT SISN+GM  ++ F A
Sbjct: 457 KGLMTPIVRNADQKSISAISSEVKQLAEKARVGKLTPNEFQGGTFSISNLGMYPVDQFVA 516

Query: 357 VINPPQSTILAIGAGEKKV--VFQNEEIKVATI---MNATLSADHRSVDGAIASKLLAKF 411
           +INPPQ+ ILA+G G K V  +  ++ I+   +   MN TLSADHR  DG ++   L+  
Sbjct: 517 IINPPQAGILAVGRGNKVVEPLLGSDGIERPAVINKMNLTLSADHRVFDGQVSGAFLSAL 576

Query: 412 K 412
           +
Sbjct: 577 R 577



 Score = 97.4 bits (241), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 73/102 (71%), Gaps = 2/102 (1%)

Query: 4   HTIT-MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HT+  MP+LSPTMT+G +AKW K+EG+KI  GD+LCEIETDKA +EFE ++EG + +ILV
Sbjct: 38  HTVVGMPALSPTMTQGNIAKWKKKEGEKIEVGDVLCEIETDKATLEFECLEEGFLAKILV 97

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHS 104
           P G++++ V   I   + D+ +I  + P +  +  +V+EE S
Sbjct: 98  PEGSKDVPVGQAIAITVEDADDI-QNVPATVGSGSDVKEEKS 138


>gi|24214708|ref|NP_712189.1| dihydrolipoamide acetyltransferase [Leptospira interrogans serovar
           Lai str. 56601]
 gi|24195699|gb|AAN49207.1| dihydrolipoamide acetyltransferase [Leptospira interrogans serovar
           Lai str. 56601]
          Length = 458

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 185/480 (38%), Positives = 269/480 (56%), Gaps = 83/480 (17%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M     M  LSPTM EGK+ +W+KQ+GD +SPG+I+ E+ETDKA+ME E+ + GI+ EIL
Sbjct: 1   MAKIAEMTQLSPTMAEGKIVRWLKQKGDPVSPGEIIAEVETDKAVMEMEAFETGILLEIL 60

Query: 62  VPAGTENIAVNSPI---------LNILMDSTE--IPP---------SPPLSKENIV---- 97
            P GT  + V +P+         ++ L+++ +  IP            P S +N      
Sbjct: 61  APEGTL-LPVGAPVAIIGKQGEDVSALVETAKKSIPAKKESSITQGQAPTSTQNATSQSS 119

Query: 98  ----------------EVREEHSHSSPVVVREKHS---------KNRPI----------A 122
                           +   +++ S+ +   E+ S         ++ PI          A
Sbjct: 120 TTSGANTVKNLTTKASDASSQNTESNGLTTHEERSLKTQIPFDSEDSPIRSARGGRSIKA 179

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
           SPLA+ LA + G+DL  + GSGP GRI+K             +D    Q  G V +S   
Sbjct: 180 SPLAKNLALQKGVDLGEVIGSGPGGRIIK-------------RDLLAYQESGSVKKST-- 224

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
                F K     +    +RKTIA RL  S  TIPHFY++++ +   L +LR   N+ L+
Sbjct: 225 -----FVKRQDRKLEITGMRKTIASRLAHSTSTIPHFYLTLELDATPLDTLRNSYNKDLK 279

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
               E S+KIS+ND+I+KA +L++ +VPE N SW  + ++ H  IDI VAVSI GG++TP
Sbjct: 280 L---EGSSKISLNDLIIKACSLSLKEVPEVNSSWREDHILEHGRIDIGVAVSIEGGLITP 336

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
            IR ADQKS+ +I  E+K+LA RA++RKLKP EY  GT ++SN+GM GI+SF AVIN P+
Sbjct: 337 YIRNADQKSVSEIGREIKELASRARERKLKPAEYTDGTFTVSNLGMFGISSFTAVINEPE 396

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           + ILA+GA  +K V +   I V   +N TLS DHR VDGA  ++ L+ F++Y E P+ +L
Sbjct: 397 AAILAVGALVEKPVLKEGSIVVGKTLNVTLSCDHRVVDGATGARFLSSFRDYTEYPLRLL 456


>gi|316971165|gb|EFV54985.1| putative pyruvate dehydrogenase complex dihydrolipoamide
           acetyltransferase [Trichinella spiralis]
          Length = 530

 Score =  312 bits (799), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 171/453 (37%), Positives = 263/453 (58%), Gaps = 56/453 (12%)

Query: 4   HT-ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HT + MP+LSPTM +G +  W K+EG++++ GD+LCEIETDKA M FES +EG + +I++
Sbjct: 101 HTKVHMPALSPTMEKGNVVSWKKKEGEEVAEGDLLCEIETDKATMGFESGEEGYLAKIVI 160

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENI-------------------------- 96
           P G++++ V + +  I+ ++ ++     LS E +                          
Sbjct: 161 PEGSKDVPVGNLLCVIVENADDVAAFSKLSAEELGAQPVGQAPAPAAAAPAAPAAATAAA 220

Query: 97  -----VEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVK 151
                         ++P    +     R  ASPLA+++AGE  IDL S+ G+GP GRI+ 
Sbjct: 221 APPPPPVTAAAAPAAAPKPPVQAPPGGRVFASPLAKKMAGEQKIDLQSMKGTGPEGRILA 280

Query: 152 SDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQ 211
            D+    +    ++                   + L A   +  I   N+RKTIA RL +
Sbjct: 281 GDLSQPAAAGARMQ-------------------MVLPAGGKFTDIELSNMRKTIARRLLE 321

Query: 212 SKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPE 271
           SK +IPH+Y++++  +D +L LR ++N  L+    + + KISVND I+KA ALA  +VPE
Sbjct: 322 SKTSIPHYYLTVEIFVDKILQLRSKLNEELK----KENRKISVNDFIVKASALACKKVPE 377

Query: 272 ANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKL 331
            N  W    + R++ +D+SVAVS   G++TPI+  AD K IL+IS E+  L+ RA+  +L
Sbjct: 378 VNSFWMETFIRRNEFVDVSVAVSTDTGLITPIVFNADSKGILEISEEIIALSTRARAGQL 437

Query: 332 KPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNA 390
           KPEE+QGGT ++SN+GM G+N F A+INPPQS ILA+G  +K+VVF +++    A ++  
Sbjct: 438 KPEEFQGGTFTVSNLGMFGVNHFTAIINPPQSAILAVGTVQKRVVFDEDKRCAEANVLTV 497

Query: 391 TLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           TLS DHR +DGA+ +K L + K Y+E P  ML+
Sbjct: 498 TLSCDHRIIDGAVGAKWLQQLKRYLEKPYTMLL 530


>gi|162452075|ref|YP_001614442.1| dihydrolipoyllysine-residue acetyltransferase [Sorangium cellulosum
           'So ce 56']
 gi|161162657|emb|CAN93962.1| Dihydrolipoyllysine-residue acetyltransferase [Sorangium cellulosum
           'So ce 56']
          Length = 438

 Score =  312 bits (799), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 176/455 (38%), Positives = 258/455 (56%), Gaps = 51/455 (11%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P LSPTM EG+++ W K+EGD I   D+L E+ETDKA ME++S D G + +IL
Sbjct: 1   MAKVLELPKLSPTMEEGQISAWHKKEGDAIDIDDLLAEVETDKATMEYKSFDRGTLLKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEI----------------------------PPS---PP 90
           VPAG+  + +  P+  I     ++                            PP+    P
Sbjct: 61  VPAGS-VVQLGQPVAIIGTPGEDVSALAGGSGGAAAAKPSAAEAQPKGERAAPPAGGDAP 119

Query: 91  LSKENIVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIV 150
           ++        E  S  +     +  S  R  ASP  R+L  E G+DLSS++GSGP GRIV
Sbjct: 120 VTSPPPAARGEAVSPPTQPAAPQPSSNGRVKASPYVRKLGRERGLDLSSVAGSGPRGRIV 179

Query: 151 KSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQ 210
             D+E L          +                       + EV P   +RK IA RL 
Sbjct: 180 ARDLEGLKPAPAAAAKATAPGELA-----------------APEVRPLSMMRKAIARRLT 222

Query: 211 QSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISN--KISVNDIILKAFALAMIQ 268
           +SKQT+PHFY+SID + D L +LREQ+N  L     E     K+S ND+++KA A+A+++
Sbjct: 223 ESKQTVPHFYLSIDVDADPLNALREQINADLAATAAEGEKPAKVSFNDLLVKACAIALVR 282

Query: 269 VPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQ 328
           VPE N  +T +A++ H+ +DISVAV++P G+VTP++R  D+K +LDI+ EV++LA RAK 
Sbjct: 283 VPECNAQFTPDAILVHQRVDISVAVAVPEGLVTPVVRDVDRKQVLDIAAEVRELAGRAKA 342

Query: 329 RKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIM 388
           +KL+PEE   GT SISN+GM GI++F AVINPP+  ILA+G   ++ V + E+I     +
Sbjct: 343 KKLRPEEMANGTFSISNLGMYGIDNFGAVINPPEGAILAVGQVRREPVVRGEQIVPGRRL 402

Query: 389 NATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           + TLS DHR VDGA+ +  L   ++ +E+P  +L+
Sbjct: 403 SMTLSCDHRVVDGAVGATFLKVLRQLLEHPTQILI 437


>gi|282848170|ref|NP_001016320.2| dihydrolipoamide S-acetyltransferase [Xenopus (Silurana)
           tropicalis]
 gi|170285206|gb|AAI61043.1| Unknown (protein for MGC:184728) [Xenopus (Silurana) tropicalis]
          Length = 628

 Score =  312 bits (799), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 178/444 (40%), Positives = 259/444 (58%), Gaps = 39/444 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I +P+LSPTMT G + KW K+ G+K+S GD+L EIETDKA + FE  +EG + +IL+  G
Sbjct: 198 ICLPALSPTMTMGTVQKWEKKVGEKLSEGDLLAEIETDKATIGFEVPEEGYLAKILIEEG 257

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEV------------------------RE 101
           T ++ + +P+  I+   ++I      S E+  E+                          
Sbjct: 258 TRDVPLGTPLCIIVEKESDIG-----SFEDYKELTGVADIKPQPAAPTPTAAPPPVPQVA 312

Query: 102 EHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTK 161
               +          K R   SPLAR+LA E GID+  + GSGP GRI K DI++ +  K
Sbjct: 313 VPPPAPTPSAAPSAPKGRVFISPLARKLASEKGIDIKQVKGSGPEGRITKKDIDSFVPPK 372

Query: 162 TNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYV 221
                 +       V     A + +    D    +P  NIR+ IA RL QSKQTIPH+Y+
Sbjct: 373 AAPVPAAAPAPTVAVPSPAVAAVPSGVFTD----VPISNIRRVIAQRLMQSKQTIPHYYL 428

Query: 222 SIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAM 281
           SID N+  ++ LR+++N   +      + K+SVND I+KA ALA ++VPEAN SW    +
Sbjct: 429 SIDINMGEIVQLRKELNEVTKAD----NIKLSVNDFIIKASALACLKVPEANSSWLDTVI 484

Query: 282 IRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTT 341
            +H  +D+SVAVS P G++TPI+  A  K +  IS +V  LA RA++ KLKP E+QGGT 
Sbjct: 485 RQHHVVDVSVAVSTPVGLITPIVFNAHTKGLATISKDVLSLATRAREGKLKPHEFQGGTF 544

Query: 342 SISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSV 399
           ++SN+GM GI +F A+INPPQ+ ILA+G  E +++  + E    VA++M  TLS DHR V
Sbjct: 545 TVSNLGMYGIKNFSAIINPPQACILAVGGSENRLIPADNEKGFDVASMMFVTLSCDHRVV 604

Query: 400 DGAIASKLLAKFKEYIENPVWMLM 423
           DGA+ ++ LA+FK+++E P  ML+
Sbjct: 605 DGAVGAQWLAEFKKFLEKPTTMLL 628



 Score = 80.5 bits (197), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 58/80 (72%), Gaps = 1/80 (1%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +A+W K+EGDKI+ GD++ E+ETDKA + FES++EG + +ILV  G
Sbjct: 75  VPLPALSPTMQMGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEEGYMAKILVAEG 134

Query: 66  TENIAVNSPILNILMDSTEI 85
           T ++ + S ++ I +D  E 
Sbjct: 135 TRDVPIGS-VICITVDKPEF 153


>gi|221132467|ref|XP_002160241.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
          Length = 527

 Score =  311 bits (798), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 174/451 (38%), Positives = 270/451 (59%), Gaps = 46/451 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G +  W K+ GDKI+ GD+L  IETDK+ ME E+ + G + +I+VP G
Sbjct: 90  VLLPNLSPTMTTGTIVSWEKKVGDKINEGDVLALIETDKSTMEMETPEPGYLAKIIVPVG 149

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVRE-----------K 114
           T ++A+N  I  I+ +  ++      + E   +  +    +SP  V              
Sbjct: 150 TRDVAINQLIAIIVSNEEDLDAFKNYTGEETTKTLDAKLDASPSTVASHSPPVVEEPPPP 209

Query: 115 HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETL----------------I 158
            S NR  ASPLA+R+A E GID++++ GSGP GRI  +DIE                  I
Sbjct: 210 SSTNRVFASPLAKRVALEKGIDINNVVGSGPRGRITVADIENFKTPLIAPKIEKVTAAPI 269

Query: 159 STKTNVKDYSTIQSF--GLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTI 216
           S + + +  ST   F   LV   +   ++       ++ IP  N+RKTIA RL +SKQT+
Sbjct: 270 SKQPSPELQSTPSVFQPSLVQPPVAEGVM-------FKDIPLSNMRKTIAKRLTESKQTV 322

Query: 217 PHFYVSIDCNIDNLLSLREQMNRTLQFHREEI-SNKISVNDIILKAFALAMIQVPEANVS 275
           PH+Y++ + N+D +  LR Q+N       E + + K+S+ND ++KA AL++ +VPE N  
Sbjct: 323 PHYYLTSEINMDKVFELRSQLNA------ESLGAFKLSINDFVIKAAALSLRKVPECNSQ 376

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           W +  + + +++D+SVAVSI GG++TPI++ AD+K +  IS +V  LA +A+ + ++P E
Sbjct: 377 WFSEYIRQFENVDVSVAVSIDGGLITPIVKDADKKGLTAISADVVALANKARDKTIQPHE 436

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVV---FQNEEIKVATIMNATL 392
           + GGT ++SN+GM GI++F AVINPPQS ILA+ A E +VV        +K++ +M+ TL
Sbjct: 437 FLGGTFTVSNLGMYGISNFSAVINPPQSCILAVSASEDRVVPDQTSETRMKISKMMSVTL 496

Query: 393 SADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           S DHR VDGA+ +  L  F+ Y+E P+ ML+
Sbjct: 497 SCDHRVVDGAVGAAWLKTFRGYLEKPITMLL 527


>gi|88607441|ref|YP_505778.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Anaplasma
           phagocytophilum HZ]
 gi|88598504|gb|ABD43974.1| putative pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamide acetyltransferase [Anaplasma
           phagocytophilum HZ]
          Length = 420

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 173/442 (39%), Positives = 259/442 (58%), Gaps = 52/442 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDE-GIIDEILVPA 64
           + MP+LSPTM  G +AKW K  GD + PGDI+ +IETDKA++EFE  DE G++ +IL   
Sbjct: 5   VLMPALSPTMKSGTIAKWHKNAGDAVKPGDIVADIETDKAVIEFEYADEPGVMYKILKEE 64

Query: 65  GTENIAVNSPILNILMDSTE-------IPPSPPLSKENIVEVREEHSHSSPVVV------ 111
           G++N+AVN  I  I +D  E       +  +   S     E       ++P  V      
Sbjct: 65  GSKNVAVNQSIAVIKVDGDEEAALLEMVHSAEGASGSVSNEAASAALQATPAKVAGDMVA 124

Query: 112 ---REKHSK--------NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST 160
                K S+        +R  ASPLA++LA +  +D+S ++GSGP+GR+VK+D+   +  
Sbjct: 125 PSSANKASETAHITSGSDRVKASPLAKKLAAQLSVDISKITGSGPYGRVVKADV---LGA 181

Query: 161 KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
                D +TIQ                   +   V+    +RK I+ RL +SK+ IPHFY
Sbjct: 182 SVPTSD-TTIQ-------------------EGSRVVEVSTMRKVISERLAESKRNIPHFY 221

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           ++IDC +  LL +R ++N     + E +  KI+VND+++KA ALA  + PE N  W  + 
Sbjct: 222 LAIDCMVGELLEVRSRINS----NAEALGTKITVNDLVIKATALAAREFPEVNALWAGDK 277

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           ++ H+++DI+ AV++  G++TP+I  AD+ ++ ++S   K L  RAK RKL P E+QGG 
Sbjct: 278 IVYHQNVDIAFAVALDDGLLTPVIAGADKMTLSELSKTAKSLVARAKDRKLLPHEFQGGC 337

Query: 341 TSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVD 400
            +ISN+GM  I  F A+INPPQS I+A+G  EK+ V  +  +  A +M+ TLS DHR +D
Sbjct: 338 LTISNLGMFCIKEFYAIINPPQSCIMAVGQSEKRPVVVDNCVVAADVMSVTLSVDHRVID 397

Query: 401 GAIASKLLAKFKEYIENPVWML 422
           GA+A+K L +FK YIENP+ ML
Sbjct: 398 GALAAKFLNRFKFYIENPLAML 419


>gi|296090376|emb|CBI40195.3| unnamed protein product [Vitis vinifera]
          Length = 659

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 182/424 (42%), Positives = 257/424 (60%), Gaps = 28/424 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G +AKW K+EGDKI  GD++CEIETDKA +EFES++EG + +I+ P G
Sbjct: 236 LGMPALSPTMNQGNIAKWRKKEGDKIEVGDVICEIETDKATLEFESLEEGYLAKIVAPEG 295

Query: 66  TENIAVNSPILNILMD--STEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIAS 123
           ++++AV  PI   + D    EI  +   S  +I + + +   S   V  EK S  R   S
Sbjct: 296 SKDVAVGQPIAITVEDPDDIEIVKASVSSGSDIKKEKPQQQESRNEVRAEKSSFTR--IS 353

Query: 124 PLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGL-------- 175
           P A+ L  E G+D S+L  SGP G ++K D+  L + K  +   S+     +        
Sbjct: 354 PSAKLLITEFGLDASTLKASGPRGTLLKGDV--LAAIKAGIGSSSSSSKDKMPPPPVHSQ 411

Query: 176 VDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLRE 235
              S      +L   +S+E +P+  IRK IA RL +SKQ  PH Y+S D  +D LLS R+
Sbjct: 412 ASPSASPERSHLQQSESFEDMPNSQIRKVIATRLLESKQNTPHLYLSSDVILDPLLSFRK 471

Query: 236 QMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTT--NAMIRHKHIDISVAV 293
           ++       +E+   K+SVNDI++KA A+A+  VPEAN  W      +I    +DIS+AV
Sbjct: 472 EL-------KEKHDVKVSVNDIVIKAVAMALKNVPEANAYWNAEKGEVILSDSVDISIAV 524

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
           +   G++TPI+R ADQK+I  IS+EVK+LA++A+  KLKP E+QGGT SISN+GM  ++ 
Sbjct: 525 ATEKGLMTPIVRNADQKTISSISIEVKELAEKARAGKLKPNEFQGGTFSISNLGMFPVDH 584

Query: 354 FCAVINPPQSTILAIGAGEK---KVVFQN--EEIKVATIMNATLSADHRSVDGAIASKLL 408
           FCA+INPPQS ILA+G G K    VV  +  E+  V T MN TLSADHR  DG +    L
Sbjct: 585 FCAIINPPQSGILAVGRGNKVVEPVVGGDGLEKPAVVTKMNLTLSADHRVFDGKVGGAFL 644

Query: 409 AKFK 412
           +  +
Sbjct: 645 SALR 648



 Score =  102 bits (255), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 46/84 (54%), Positives = 63/84 (75%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTMT+G +AKW K+EGDKI PGD+LCEIETDKA +EFES++EG + +ILV  G
Sbjct: 110 LGMPALSPTMTQGNIAKWRKKEGDKIEPGDVLCEIETDKATLEFESLEEGFLAKILVAEG 169

Query: 66  TENIAVNSPILNILMDSTEIPPSP 89
           ++++ V  PI   + D  +I   P
Sbjct: 170 SKDVPVGQPIAITVEDEEDIQKVP 193


>gi|254450484|ref|ZP_05063921.1| dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Octadecabacter antarcticus 238]
 gi|198264890|gb|EDY89160.1| dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Octadecabacter antarcticus 238]
          Length = 409

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 177/414 (42%), Positives = 246/414 (59%), Gaps = 13/414 (3%)

Query: 15  MTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSP 74
           M+ G +A W K EG+ +  G+ L +IETDKA ME ES   G +  +    G + + +   
Sbjct: 3   MSSGTIASWYKSEGEMVEEGEALFDIETDKATMEVESPGTGTLHFVSAKEG-DIVPIGQS 61

Query: 75  ILNILMDSTEI--PPSPPLSKENIVEVR--EEHSHSSPVVVREKHSKNRPIASPLARRLA 130
           +  +  +  E+  P    +S  + V+    E  +   P+VV      +   A+PLARR+A
Sbjct: 62  VAWLFAEGEEVVEPAGSGVSTADTVQAAAVESDTTEEPIVVGSPVFLSGTRATPLARRVA 121

Query: 131 GEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAK 190
            +  IDL S+ GSGP GRIV+SD+E    + T      TI   G       A+ L L   
Sbjct: 122 KKLNIDLQSVGGSGPRGRIVRSDVEKAAKSGTASPPPQTITVGGKTGAQKTADELGL--- 178

Query: 191 DSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISN 250
            +Y  +P D +R  IA RL +SK T+PHFY++ D  ID LL +R Q+N  LQ      + 
Sbjct: 179 -AYTKVPVDRMRSIIAARLTESKSTVPHFYLNADLQIDKLLEMRVQINLALQ---NTDAK 234

Query: 251 KISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQK 310
           KISVND+++KA A A+  VPEAN SW  +++I+     ISVAVSI GG++TP++R A +K
Sbjct: 235 KISVNDLLVKACAAALKTVPEANASWDGDSIIKFDDAHISVAVSIDGGLITPVVRNAQKK 294

Query: 311 SILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGA 370
            I  IS E+  LA RAK  KL  +EYQGG+ SISN+GM G+ SF A+INPP+S ILA+G 
Sbjct: 295 DIQTISSEIADLAARAKTGKLGSKEYQGGSFSISNLGMFGVKSFNAIINPPESMILAVGQ 354

Query: 371 GEKKVVFQNE-EIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           G  + V  NE   K+AT+M+ TLS DHR VDGA+ +  L KFKE IENP  +++
Sbjct: 355 GAAQFVPDNEGNPKLATVMSVTLSCDHRVVDGALGAVWLKKFKELIENPTSLML 408


>gi|225449653|ref|XP_002262782.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 591

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 182/424 (42%), Positives = 257/424 (60%), Gaps = 28/424 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G +AKW K+EGDKI  GD++CEIETDKA +EFES++EG + +I+ P G
Sbjct: 168 LGMPALSPTMNQGNIAKWRKKEGDKIEVGDVICEIETDKATLEFESLEEGYLAKIVAPEG 227

Query: 66  TENIAVNSPILNILMD--STEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIAS 123
           ++++AV  PI   + D    EI  +   S  +I + + +   S   V  EK S  R   S
Sbjct: 228 SKDVAVGQPIAITVEDPDDIEIVKASVSSGSDIKKEKPQQQESRNEVRAEKSSFTR--IS 285

Query: 124 PLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGL-------- 175
           P A+ L  E G+D S+L  SGP G ++K D+  L + K  +   S+     +        
Sbjct: 286 PSAKLLITEFGLDASTLKASGPRGTLLKGDV--LAAIKAGIGSSSSSSKDKMPPPPVHSQ 343

Query: 176 VDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLRE 235
              S      +L   +S+E +P+  IRK IA RL +SKQ  PH Y+S D  +D LLS R+
Sbjct: 344 ASPSASPERSHLQQSESFEDMPNSQIRKVIATRLLESKQNTPHLYLSSDVILDPLLSFRK 403

Query: 236 QMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTT--NAMIRHKHIDISVAV 293
           ++       +E+   K+SVNDI++KA A+A+  VPEAN  W      +I    +DIS+AV
Sbjct: 404 EL-------KEKHDVKVSVNDIVIKAVAMALKNVPEANAYWNAEKGEVILSDSVDISIAV 456

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
           +   G++TPI+R ADQK+I  IS+EVK+LA++A+  KLKP E+QGGT SISN+GM  ++ 
Sbjct: 457 ATEKGLMTPIVRNADQKTISSISIEVKELAEKARAGKLKPNEFQGGTFSISNLGMFPVDH 516

Query: 354 FCAVINPPQSTILAIGAGEK---KVVFQN--EEIKVATIMNATLSADHRSVDGAIASKLL 408
           FCA+INPPQS ILA+G G K    VV  +  E+  V T MN TLSADHR  DG +    L
Sbjct: 517 FCAIINPPQSGILAVGRGNKVVEPVVGGDGLEKPAVVTKMNLTLSADHRVFDGKVGGAFL 576

Query: 409 AKFK 412
           +  +
Sbjct: 577 SALR 580



 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/84 (54%), Positives = 63/84 (75%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTMT+G +AKW K+EGDKI PGD+LCEIETDKA +EFES++EG + +ILV  G
Sbjct: 42  LGMPALSPTMTQGNIAKWRKKEGDKIEPGDVLCEIETDKATLEFESLEEGFLAKILVAEG 101

Query: 66  TENIAVNSPILNILMDSTEIPPSP 89
           ++++ V  PI   + D  +I   P
Sbjct: 102 SKDVPVGQPIAITVEDEEDIQKVP 125


>gi|66816929|ref|XP_642438.1| dihydrolipoamide acetyltransferase [Dictyostelium discoideum AX4]
 gi|166204147|sp|P36413|ODP2_DICDI RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component of pyruvate dehydrogenase complex,
           mitochondrial; AltName: Full=Dihydrolipoamide
           acetyltransferase component of pyruvate dehydrogenase
           complex; AltName: Full=Pyruvate dehydrogenase complex
           component E2; Short=PDC-E2; Short=PDCE2; Flags:
           Precursor
 gi|60470116|gb|EAL68096.1| dihydrolipoamide acetyltransferase [Dictyostelium discoideum AX4]
          Length = 635

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 172/439 (39%), Positives = 250/439 (56%), Gaps = 33/439 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVD-EGIIDEILVPA 64
           + MP+LSP+M  G +A W K+EGD+I  GD + E+ETDKA M+F+  D  G + +ILVP 
Sbjct: 209 VGMPALSPSMETGGIASWTKKEGDQIKAGDAIAEVETDKATMDFQYEDGNGYLAKILVPG 268

Query: 65  GTENIAVNSPILNILMDSTEIPPSPPLS-----------------KENIVEVREEHSHSS 107
           GT  I +N P+  I+ +  +       S                   +    +E     S
Sbjct: 269 GTSGIQINQPVCIIVKNKEDCDKFADYSVEEQSSSSSSSSQESTPSSSSSSSQESTPSQS 328

Query: 108 PVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDY 167
                 + S  R  A+P AR  A   G DLS+++G+GP+ RI+K+D+   +  K  V   
Sbjct: 329 SSQQTTRKSGERIFATPAARFEASSKGYDLSAINGTGPNNRILKADVLEFVPQKQEVAQQ 388

Query: 168 STIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNI 227
              Q+      +         +   +  IPH NIRK  A RL +SKQTIPH+Y++++C +
Sbjct: 389 QQQQT-----TTTTKKPTTPTSSGEFTDIPHSNIRKVTAARLTESKQTIPHYYLTMECRV 443

Query: 228 DNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI 287
           D LL LR ++N            KISVND I+KA A A+   P  N +WT   + R+ +I
Sbjct: 444 DKLLKLRSELNAMNTV-------KISVNDFIVKASAAALRDNPVVNSTWTDQFIRRYHNI 496

Query: 288 DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMG 347
           DI+VAV+ P G+ TPI+R  D K +  IS  VKQLA++A+  KL P E++ GT +ISN+G
Sbjct: 497 DINVAVNTPQGLFTPIVRGVDMKGLNSISTSVKQLAEKAQNGKLHPSEFESGTFTISNLG 556

Query: 348 MLGINSFCAVINPPQSTILAIGAGEKKVVFQNE---EIKVATIMNATLSADHRSVDGAIA 404
           MLGI  F AVINPPQ+ ILA+G  E +VV  N+     + ATI++ TLS DHR +DGA+ 
Sbjct: 557 MLGIKQFAAVINPPQAAILAVGTTETRVVLSNKPDSPYETATILSVTLSCDHRVIDGAVG 616

Query: 405 SKLLAKFKEYIENPVWMLM 423
           ++ L  FK+Y+ENP+ +++
Sbjct: 617 AEWLKSFKDYVENPIKLIL 635



 Score = 88.2 bits (217), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/113 (41%), Positives = 71/113 (62%), Gaps = 9/113 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVD-EGIIDEILVPA 64
           ITMP+LSP+MTEG + +W K+EGD+I  GD++ E+ETDKA M+F+  D  G + +IL+P 
Sbjct: 86  ITMPALSPSMTEGNIVQWKKKEGDQIKAGDVIAEVETDKATMDFQYEDGNGYLAKILIPE 145

Query: 65  GTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK 117
           GT+ I +N PI  I+    +I        E+ V+  +  S +S   V+E+  K
Sbjct: 146 GTKGIEINKPIAIIVSKKEDI--------ESAVKNYKPSSQASSTPVQEEAPK 190


>gi|328874824|gb|EGG23189.1| dihydrolipoamide acetyltransferase [Dictyostelium fasciculatum]
          Length = 642

 Score =  308 bits (790), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 162/436 (37%), Positives = 258/436 (59%), Gaps = 22/436 (5%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
           + + +P+LSP+M  G LAKW K  GDKI+ GDI+ E+ETDKA MEFE  + G + +ILVP
Sbjct: 213 NVVGLPALSPSMETGGLAKWRKNVGDKITAGDIIAEVETDKATMEFEITESGYLAKILVP 272

Query: 64  AGTENIAVNSPILNILMDSTEIPPSPPLS---------------KENIVEVREEHSHSSP 108
           AGT  + +NSPI  ++    ++      +               +      +++ +    
Sbjct: 273 AGTTGVDINSPICVMVNKKEDVEKFADFTVDGAAAGGAEAPAAVESTTAAPQQQAAPQQS 332

Query: 109 VVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYS 168
                  +  R  +SP AR  A E G +++ ++G+GP+GR++K D+   +  +   +  S
Sbjct: 333 SSSSSSSTGGRIFSSPAARFTAKEKGHNIADITGTGPNGRVIKVDVLEFVPQQKQ-QVVS 391

Query: 169 TIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNID 228
              +         A          +  IPH NIR+  A RL +SKQ IPH+Y++++C +D
Sbjct: 392 EAAATAAAPRPAAAAAAAAPEAGLFTDIPHTNIRRVTASRLTESKQQIPHYYLTMECKVD 451

Query: 229 NLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHID 288
            LL++R Q+N     ++     K+SVND ++KA A A+   P  N +W  +A+ R  +ID
Sbjct: 452 QLLNVRTQLN-----NQANNKYKLSVNDFVIKAAAAALRDCPTVNSTWMKDAVRRFHNID 506

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           I+VAV+   G+ TP+IR AD+K +  ++ +VK+LA++AK  KL+P+++  GT +ISN+GM
Sbjct: 507 INVAVNTDLGLFTPLIRDADKKGLASVANQVKELAEKAKIGKLQPQDFASGTFTISNLGM 566

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVA-TIMNATLSADHRSVDGAIASKL 407
            GI +F AVINPPQ+ ILA+G  EK++V   E+   + T++  TLS DHR +DGA+ ++ 
Sbjct: 567 FGIKNFSAVINPPQAAILAVGTTEKRIVAAGEDKYTSETVLTVTLSCDHRVIDGAVGAEW 626

Query: 408 LAKFKEYIENPVWMLM 423
           L KFK+YIENP+ +L+
Sbjct: 627 LQKFKDYIENPLKLLL 642



 Score = 83.6 bits (205), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 50/70 (71%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSP+M EG L KW K  GDKIS GDI+ E+ETDKA M+FE  + G + +IL P G
Sbjct: 87  VGMPALSPSMAEGNLVKWKKNVGDKISVGDIIAEVETDKATMDFEITESGYLAKILKPDG 146

Query: 66  TENIAVNSPI 75
           ++ IA+N  I
Sbjct: 147 SKGIAINDLI 156


>gi|109077345|ref|XP_001102823.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component
           of pyruvate dehydrogenase complex, mitochondrial-like
           [Macaca mulatta]
          Length = 608

 Score =  308 bits (790), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 174/440 (39%), Positives = 265/440 (60%), Gaps = 35/440 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 182 VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 241

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH--------------------SH 105
           T ++ + +P+  I+    +I          + +++ +                     + 
Sbjct: 242 TRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQAPPPTPPPVATVPLTPQPLAPTP 301

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S+P        K R   SPLA++LA E GIDL+ + G+GP GR+ K DI++ + +K    
Sbjct: 302 SAPCPATPAGPKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRVTKKDIDSFVPSKAAPA 361

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             + +   G          +     D +  IP  N+ + IA RL QSKQTIPH+Y+SID 
Sbjct: 362 PAAVVPPTG--------PGMAPVPTDVFTDIPISNVHQVIAQRLMQSKQTIPHYYLSIDV 413

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           N+  +L +++++N+ L     E  +KISVND I+KA ALA ++VPEAN SW    M ++ 
Sbjct: 414 NMGEVLLVQKELNKIL-----EGRSKISVNDFIIKASALACLKVPEANSSWMDTVMRQNH 468

Query: 286 HIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
            +DISVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +ISN
Sbjct: 469 IVDISVAVSTPIGLITPIVFNAHIKGLETITNDVVSLATKAREGKLQPHEFQGGTFTISN 528

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGAI 403
           +G+ GI +F A+IN  Q+ ILAIGA E K+V  + E    VA++M+ TLS DH+ VDGA+
Sbjct: 529 LGLFGIKNFSAIINLLQACILAIGASEDKLVPTDNEKGFDVASMMSVTLSCDHQVVDGAV 588

Query: 404 ASKLLAKFKEYIENPVWMLM 423
             + LA+F++Y+E P+ ML+
Sbjct: 589 RDQWLAEFRKYLEKPITMLL 608



 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 49/68 (72%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +PSLSPTM  G +A W K+EG KI+ GD++ E+ETDKA + FES++E  + +ILV  G
Sbjct: 55  VPLPSLSPTMQSGTIAHWEKKEGGKINEGDLIAEVETDKATVGFESLEECYMAKILVAEG 114

Query: 66  TENIAVNS 73
           T ++ + +
Sbjct: 115 TRDVPIGA 122


>gi|307296836|ref|ZP_07576654.1| catalytic domain-containing protein of component of various
           dehydrogenase complexes [Sphingobium chlorophenolicum
           L-1]
 gi|306877749|gb|EFN08975.1| catalytic domain-containing protein of component of various
           dehydrogenase complexes [Sphingobium chlorophenolicum
           L-1]
          Length = 425

 Score =  308 bits (790), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 175/442 (39%), Positives = 259/442 (58%), Gaps = 39/442 (8%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   +TMP+LSPTM +G LA+W+ + GDKI PGDI+ EIETDKA M++E+ D G+I  IL
Sbjct: 1   MAVELTMPALSPTMEKGTLARWLVKAGDKIKPGDIIAEIETDKATMDYEATDAGVIAAIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPL-------------SKENIVEVREEHSHSSP 108
           V  G+E++ V + ++  + +  E   +P L                +I            
Sbjct: 61  VAEGSEDVPVGT-VIATVAEGAEAIAAPVLETVSAAPAPAAPTPAADISPAPPAPVAVPV 119

Query: 109 VVVREKHSKNRPI-ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDI--ETLISTKTNVK 165
              +      R I A+PLARR+A   G+ LS ++GSGP GRIVK+D+   +L++  T + 
Sbjct: 120 AAPKAPALDERGINATPLARRIAAVRGLSLSGITGSGPRGRIVKADLGLPSLLTPATVIA 179

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNI-----RKTIACRLQQSKQTIPHFY 220
             + + +   V              D    +P D +     RKTIA RL +SKQT+PHFY
Sbjct: 180 ASTPVAAAAPV-------------YDPPAGVPVDTVKLTGMRKTIARRLTESKQTVPHFY 226

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           ++  CNID L  LR ++N  L         K+SVND+++KA ALAM  VP+ NV +  + 
Sbjct: 227 LTARCNIDALNRLRGELNANLSAR----GVKLSVNDMLIKAMALAMAAVPDVNVQFGGDV 282

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           + R   +DIS+AV+I GG++TP+I+ A   S+  I+   K LA +A+  KL PE+YQGGT
Sbjct: 283 LHRFSRVDISMAVAIEGGLITPVIQDAGALSLSAIAQASKALAAKARDGKLAPEDYQGGT 342

Query: 341 TSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVD 400
            SISN+GM GI+    VINPPQ+ IL + AG ++    +  I +ATIM AT S DHR++D
Sbjct: 343 ASISNLGMFGIDEMFPVINPPQALILGVAAGVEQPWKVDGAIALATIMAATASFDHRAID 402

Query: 401 GAIASKLLAKFKEYIENPVWML 422
           GA A++ +A F++ +E+P+ ++
Sbjct: 403 GATAAQFMAAFRDLVEDPMRII 424


>gi|115468212|ref|NP_001057705.1| Os06g0499900 [Oryza sativa Japonica Group]
 gi|52076491|dbj|BAD45370.1| putative dihydrolipoamide S-acetyltransferase [Oryza sativa
           Japonica Group]
 gi|52076799|dbj|BAD45742.1| putative dihydrolipoamide S-acetyltransferase [Oryza sativa
           Japonica Group]
 gi|113595745|dbj|BAF19619.1| Os06g0499900 [Oryza sativa Japonica Group]
 gi|215704190|dbj|BAG93030.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 484

 Score =  308 bits (790), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 186/428 (43%), Positives = 252/428 (58%), Gaps = 33/428 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G +AKW KQEG+KI  GD++CEIETDKA +EFES++EG + +IL P G
Sbjct: 60  VGMPALSPTMNQGNIAKWRKQEGEKIEVGDVICEIETDKATLEFESLEEGYLAKILAPEG 119

Query: 66  TENIAVNSPI---LNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
           ++++ V  PI   +  L D   IP       E     +E+   S    V    +K   I 
Sbjct: 120 SKDVQVGQPIAVTVEDLEDIKNIPADASFGGEQ----KEQSIASEAQKVETDAAKESSII 175

Query: 123 ---SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDES 179
              SP A+ L  EH +D S L+ SGP G ++K D+  L + K      ST Q       S
Sbjct: 176 TRISPAAKLLIKEHRLDQSVLNASGPRGTLLKGDV--LAALKLGASSSSTKQKNAPAAPS 233

Query: 180 ------IDANILNLFAK-DSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232
                   A  + +  + D+YE IP+  IRK IA RL +SKQT PH Y+S D  +D LL+
Sbjct: 234 SQPTHDFQAQSVTIPQQNDAYEDIPNSQIRKVIAKRLLESKQTTPHLYLSQDVILDPLLA 293

Query: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK--HIDIS 290
            R ++       +E+   K+SVNDI++KA ALA+  VPEAN  W  +     K   +DIS
Sbjct: 294 FRNEL-------KEQHGVKVSVNDIVIKAVALALRNVPEANAYWNNDKEQAQKCVSVDIS 346

Query: 291 VAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLG 350
           +AV+   G++TPIIR ADQK+I  IS EVKQLA++A+  KL P E+QGGT SISN+GM  
Sbjct: 347 IAVATEKGLMTPIIRNADQKTISAISSEVKQLAEKARAGKLAPNEFQGGTFSISNLGMYP 406

Query: 351 INSFCAVINPPQSTILAIGAGEK---KVVFQN--EEIKVATIMNATLSADHRSVDGAIAS 405
           ++ FCA+INPPQS ILA+G G K    VV  +  E+  V T M+ TLSADHR  DG +  
Sbjct: 407 VDHFCAIINPPQSGILAVGRGNKIIEPVVDSDGTEKATVVTKMSLTLSADHRVFDGQVGG 466

Query: 406 KLLAKFKE 413
           K   +  +
Sbjct: 467 KFFTELSQ 474


>gi|223934395|ref|ZP_03626316.1| catalytic domain of component of various dehydrogenase complexes
           [bacterium Ellin514]
 gi|223896858|gb|EEF63298.1| catalytic domain of component of various dehydrogenase complexes
           [bacterium Ellin514]
          Length = 411

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 175/427 (40%), Positives = 253/427 (59%), Gaps = 21/427 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + MP LS TMTEG + KW K  GD +  GDIL EIETDKA+ME ES +EG+++EI 
Sbjct: 1   MSAYVEMPKLSDTMTEGTVVKWRKAVGDTVEVGDILAEIETDKAVMEMESFEEGVLNEIY 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPP----SPPLSKENIVEVREEHSHSSPVVVREKHSK 117
           V  G E  A+   +  I     + P     +P   K  +   +       P    +  S 
Sbjct: 61  VQPG-EKAAIGQKLAMIGTAGEKAPAKANGAPVAEKAKVEATKAAVIAPQPAAKPQAVSG 119

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
           +R  ASPLA+++A   G+D+SSL GSGP GR+V  D+E   ++    K  +         
Sbjct: 120 SRVKASPLAKKIATSKGVDISSLQGSGPGGRVVAKDVEGASASAPAPKSAAPAPIAVPAP 179

Query: 178 ESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
              D  I            P   +RK IA RL QSK  IPHFY+ I+ N + L+  R Q+
Sbjct: 180 TLADKRI------------PLTGMRKVIAERLLQSKTQIPHFYLHIEVNAEELMRTRGQI 227

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
           N       +    K++VND +LKA  +A ++VP  N S+  +A++++ +I+++VAV+I  
Sbjct: 228 N---TLAEKSGQAKLTVNDFVLKAAIMAAVRVPAVNASFAGDAVVQYANINMAVAVAIDD 284

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G+VTP+IR+A +KS+ +I+  VK LA RA+ +KLKP+EYQGGT ++SN+G  GI +F A+
Sbjct: 285 GLVTPVIREAQKKSLREINEIVKDLATRARTKKLKPDEYQGGTITVSNLGSYGIENFSAI 344

Query: 358 INPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIE 416
           INPPQ+ IL++GA  KK VV   ++I V   M+  LSADHR VDGAI ++ LA+ ++ +E
Sbjct: 345 INPPQAMILSVGAIVKKPVVNDKDQIVVGQRMSVGLSADHRVVDGAIGAQYLAELRQILE 404

Query: 417 NPVWMLM 423
           NPV ML+
Sbjct: 405 NPVTMLL 411


>gi|222635641|gb|EEE65773.1| hypothetical protein OsJ_21455 [Oryza sativa Japonica Group]
          Length = 565

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 186/428 (43%), Positives = 252/428 (58%), Gaps = 33/428 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G +AKW KQEG+KI  GD++CEIETDKA +EFES++EG + +IL P G
Sbjct: 141 VGMPALSPTMNQGNIAKWRKQEGEKIEVGDVICEIETDKATLEFESLEEGYLAKILAPEG 200

Query: 66  TENIAVNSPI---LNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
           ++++ V  PI   +  L D   IP       E     +E+   S    V    +K   I 
Sbjct: 201 SKDVQVGQPIAVTVEDLEDIKNIPADASFGGEQ----KEQSIASEAQKVETDAAKESSII 256

Query: 123 ---SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDES 179
              SP A+ L  EH +D S L+ SGP G ++K D+  L + K      ST Q       S
Sbjct: 257 TRISPAAKLLIKEHRLDQSVLNASGPRGTLLKGDV--LAALKLGASSSSTKQKNAPAAPS 314

Query: 180 ------IDANILNLFAK-DSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232
                   A  + +  + D+YE IP+  IRK IA RL +SKQT PH Y+S D  +D LL+
Sbjct: 315 SQPTHDFQAQSVTIPQQNDAYEDIPNSQIRKVIAKRLLESKQTTPHLYLSQDVILDPLLA 374

Query: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK--HIDIS 290
            R ++       +E+   K+SVNDI++KA ALA+  VPEAN  W  +     K   +DIS
Sbjct: 375 FRNEL-------KEQHGVKVSVNDIVIKAVALALRNVPEANAYWNNDKEQAQKCVSVDIS 427

Query: 291 VAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLG 350
           +AV+   G++TPIIR ADQK+I  IS EVKQLA++A+  KL P E+QGGT SISN+GM  
Sbjct: 428 IAVATEKGLMTPIIRNADQKTISAISSEVKQLAEKARAGKLAPNEFQGGTFSISNLGMYP 487

Query: 351 INSFCAVINPPQSTILAIGAGEK---KVVFQN--EEIKVATIMNATLSADHRSVDGAIAS 405
           ++ FCA+INPPQS ILA+G G K    VV  +  E+  V T M+ TLSADHR  DG +  
Sbjct: 488 VDHFCAIINPPQSGILAVGRGNKIIEPVVDSDGTEKATVVTKMSLTLSADHRVFDGQVGG 547

Query: 406 KLLAKFKE 413
           K   +  +
Sbjct: 548 KFFTELSQ 555


>gi|302789866|ref|XP_002976701.1| hypothetical protein SELMODRAFT_105711 [Selaginella moellendorffii]
 gi|300155739|gb|EFJ22370.1| hypothetical protein SELMODRAFT_105711 [Selaginella moellendorffii]
          Length = 605

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 180/419 (42%), Positives = 251/419 (59%), Gaps = 34/419 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTMT+G + +W K+E DK+S GD+LC IETDKA ++FESV+EG + +I  P+G
Sbjct: 128 LGMPALSPTMTQGNIVEWKKKERDKVSAGDVLCTIETDKATVDFESVEEGYLAKIASPSG 187

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREK-----HSKNRP 120
           ++N+ +   I  ++ DST     PP +K    E + +   SS V V  K      SK   
Sbjct: 188 SKNVPIGQTIGVMVRDSTPCSGQPPATK---TEGKPQADASSKVSVMSKPPAAAGSKALS 244

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNV-KDYSTIQSFGLVDES 179
              P  RRL  E G+D SS++G+GP G ++K D+   I   T   K     +S      S
Sbjct: 245 RVGPSVRRLLAESGLDASSINGTGPRGVVLKGDVLAAIKGGTKPGKPPKDAKSRPSPPTS 304

Query: 180 IDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
           +D           +E IP   IR+ IA RL +SK  IPHFY+S D  +D+ L LR++M  
Sbjct: 305 LD-----------FEDIPTSQIRRIIAKRLIESKFGIPHFYISADAILDSTLLLRKEM-- 351

Query: 240 TLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA--MIRHKHIDISVAVSIPG 297
                +E+    +SVND +++A ALA+  VPEAN  W   A  ++ HK IDIS+AV+   
Sbjct: 352 -----KEKHGAAVSVNDFVIRATALALRSVPEANAFWDEKAEEIVFHKTIDISIAVATDK 406

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G++TPI++ AD K++  IS EVK LA+RA+  KLKPEE+QGGT SISN+GM  ++ FCA+
Sbjct: 407 GLITPIVKNADLKTLSAISTEVKALAERARTGKLKPEEFQGGTFSISNLGMFPVDRFCAI 466

Query: 358 INPPQSTILAIGAGEKKVVFQN-----EEIKVATIMNATLSADHRSVDGAIASKLLAKF 411
           INPPQ+ ILA+G GEK VV+++        +  T M  TLSAD+R  D  IA K    F
Sbjct: 467 INPPQACILAVGKGEKVVVWEDCSESGGRPRTVTKMGMTLSADNRVFDTTIAGKSTPFF 525



 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 64/80 (80%)

Query: 6  ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
          + MP+LSPTMT+G + +W K+EGDK+SPGD+LC IETDKA ++FESV+EG + +ILVP G
Sbjct: 2  LGMPALSPTMTQGNVIQWKKKEGDKVSPGDVLCVIETDKATVDFESVEEGFLAKILVPGG 61

Query: 66 TENIAVNSPILNILMDSTEI 85
          T N++V   I  ++ DS++I
Sbjct: 62 TNNVSVGQTIGVMVEDSSDI 81


>gi|218198250|gb|EEC80677.1| hypothetical protein OsI_23094 [Oryza sativa Indica Group]
          Length = 557

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 186/428 (43%), Positives = 252/428 (58%), Gaps = 33/428 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G +AKW KQEG+KI  GD++CEIETDKA +EFES++EG + +IL P G
Sbjct: 133 VGMPALSPTMNQGNIAKWRKQEGEKIEVGDVICEIETDKATLEFESLEEGYLAKILAPEG 192

Query: 66  TENIAVNSPI---LNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
           ++++ V  PI   +  L D   IP       E     +E+   S    V    +K   I 
Sbjct: 193 SKDVQVGQPIAVTVEDLEDIKNIPADASFGGEQ----KEQSIASEAQKVETDAAKESSII 248

Query: 123 ---SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDES 179
              SP A+ L  EH +D S L+ SGP G ++K D+  L + K      ST Q       S
Sbjct: 249 TRISPAAKLLIKEHRLDQSVLNASGPRGTLLKGDV--LAALKLGASSSSTKQKNAPAAPS 306

Query: 180 ------IDANILNLFAK-DSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232
                   A  + +  + D+YE IP+  IRK IA RL +SKQT PH Y+S D  +D LL+
Sbjct: 307 SQPTHDFQAQSVTIPQQNDAYEDIPNSQIRKVIAKRLLESKQTTPHLYLSQDVILDPLLA 366

Query: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK--HIDIS 290
            R ++       +E+   K+SVNDI++KA ALA+  VPEAN  W  +     K   +DIS
Sbjct: 367 FRNEL-------KEQHGVKVSVNDIVIKAVALALRNVPEANAYWNNDKEQAQKCVSVDIS 419

Query: 291 VAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLG 350
           +AV+   G++TPIIR ADQK+I  IS EVKQLA++A+  KL P E+QGGT SISN+GM  
Sbjct: 420 IAVATEKGLMTPIIRNADQKTISAISSEVKQLAEKARAGKLAPNEFQGGTFSISNLGMYP 479

Query: 351 INSFCAVINPPQSTILAIGAGEK---KVVFQN--EEIKVATIMNATLSADHRSVDGAIAS 405
           ++ FCA+INPPQS ILA+G G K    VV  +  E+  V T M+ TLSADHR  DG +  
Sbjct: 480 VDHFCAIINPPQSGILAVGRGNKIIEPVVDSDGTEKATVVTKMSLTLSADHRVFDGQVGG 539

Query: 406 KLLAKFKE 413
           K   +  +
Sbjct: 540 KFFTELSQ 547


>gi|296115653|ref|ZP_06834279.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex [Gluconacetobacter hansenii ATCC
           23769]
 gi|295977630|gb|EFG84382.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex [Gluconacetobacter hansenii ATCC
           23769]
          Length = 410

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 169/432 (39%), Positives = 259/432 (59%), Gaps = 40/432 (9%)

Query: 8   MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTE 67
           MP L  +     L++W++ EGD IS GDIL E+E DKA +E E+   GI+  I VP GTE
Sbjct: 1   MPDLCASSGTITLSRWLRAEGDAISAGDILAEMEADKATIEIEAPAGGILGRIFVPDGTE 60

Query: 68  NIAVNSPILNILMDSTE-IPPSP----------------PLSKENIVEVREEHSHSSPVV 110
            ++V+  ++ +++D  E IP +P                P+++   V    E   S P +
Sbjct: 61  GVSVDQ-VIGMVVDPGEPIPDAPGNLNVQAPAAICPDTGPMTQA--VSPCSERGISLPDI 117

Query: 111 VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
            R+  ++ R  ASP+ARRLA  H +DL  + GSGP GRI++ DIE L+S +  ++     
Sbjct: 118 SRDV-TRTRVFASPVARRLARLHELDLRRVGGSGPRGRILRRDIECLLSNEKIIQ----- 171

Query: 171 QSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNL 230
                V E           K   + +    +R+TIA RL  +KQTIPHFYVS+D  +D L
Sbjct: 172 -----VKEK---------TKPDVDRVVMSGMRRTIAARLTNAKQTIPHFYVSVDVQVDAL 217

Query: 231 LSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDIS 290
           L LRE++NR + FH    + +ISVND++++A  +A   VP  NV +  +A++  + +DI+
Sbjct: 218 LDLREELNRVVPFHGAPDAFRISVNDMLIRACGVAFATVPSMNVLYAEDALLFPRQVDIA 277

Query: 291 VAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLG 350
           VAVS+  G++TP++R    KS+L  S EV+ L  RA++ KL  EE +GG+ +ISN+GM G
Sbjct: 278 VAVSVSDGLLTPVLRDVGGKSLLVTSCEVRALIMRAREGKLSVEEMRGGSFTISNVGMFG 337

Query: 351 INSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAK 410
           I+S   +INPP + IL IGA  +  + ++ +I +A++M  TLS DHR VDGA+A++ LA 
Sbjct: 338 IDSVTPIINPPHAAILGIGAIRRLPIVRDGQIAIASLMTCTLSVDHRVVDGALAAQWLAA 397

Query: 411 FKEYIENPVWML 422
           F+  +E+P+ +L
Sbjct: 398 FRNIVEHPIRLL 409


>gi|308804175|ref|XP_003079400.1| putative dihydrolipoamide S-acetyltransferase (ISS) [Ostreococcus
           tauri]
 gi|116057855|emb|CAL54058.1| putative dihydrolipoamide S-acetyltransferase (ISS) [Ostreococcus
           tauri]
          Length = 503

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 166/442 (37%), Positives = 255/442 (57%), Gaps = 35/442 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTMT G +A W  + G  I  GD + ++ETDKA M  E+ ++G +  ILV AG
Sbjct: 73  VPMPALSPTMTRGGIASWHVEVGQAIRAGDAIADVETDKATMAMEATEDGFMAAILVEAG 132

Query: 66  TENIAVNSPILNILMDSTEI----------------------PPSPPLSKENIVEVREEH 103
            ++I V +P+     ++ ++                       PS P+   ++  V    
Sbjct: 133 AQDIEVGTPVCVTCENAEDVEAFKDYASTVAIKAESAAPVASAPSGPVESPSVAPVASAP 192

Query: 104 SHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
           S  +      + S +R  ASPLA+RLA E G+ L ++ G+GP+GR++ +D+     T  N
Sbjct: 193 SARA-TRAETRASGDRVFASPLAKRLAKERGVRLDNVRGTGPNGRVIAADVYEAHETGVN 251

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
             + +        + ++D  +   F    +E +    I++  A RL +SKQ +PHFY+++
Sbjct: 252 ATEAAR-------EVTVDHPLSKFF--PDFEDVSVTAIKRVTAQRLTESKQQVPHFYLTV 302

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           D  +DN++S+R+ +N+ L   +     KISVND I+KA A A++ VPE N SW  + + R
Sbjct: 303 DVRLDNMISIRQTLNKQLADDKAAEGAKISVNDFIVKASAKALLAVPEVNSSWLGDKIRR 362

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
           +K  DISVAV    G++ PI+R A    +  IS EVK LA RA++  L P++  GGT +I
Sbjct: 363 YKKADISVAVQTERGLMVPIVRSACCLGLKTISSEVKALASRAREGSLTPQDMTGGTFTI 422

Query: 344 SNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDG 401
           SN+GM G+ SF A++NPPQ+ ILA+G G +K V +NE    +  T+M+ATLS DHR VDG
Sbjct: 423 SNLGMFGVKSFAAIVNPPQAAILAVG-GARKEVIKNESGGYEEITVMSATLSCDHRVVDG 481

Query: 402 AIASKLLAKFKEYIENPVWMLM 423
           A+ +  L  FK YIE+P+ ML+
Sbjct: 482 AVGAMWLQSFKGYIEDPMTMLL 503


>gi|145347119|ref|XP_001418025.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144578253|gb|ABO96318.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 421

 Score =  306 bits (785), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 165/432 (38%), Positives = 254/432 (58%), Gaps = 27/432 (6%)

Query: 8   MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTE 67
           MP+LSPTM  G +A+W +  GD+I  GD + ++ETDKA M  E+ D+G +  ILVP G  
Sbjct: 1   MPALSPTMERGGIARWHRAIGDEIKAGDAIADVETDKATMAMEATDDGYLAAILVPEGAT 60

Query: 68  NIAVNSPILNILMDSTEIPPSPPLSKENIVEVRE-----EHSHSSPVV---------VRE 113
           ++ V +P+  +  +++ +           V         E + + PVV         +  
Sbjct: 61  DVEVGTPVCVMCEEASAVAAFKDYKATETVTTEPAKSAVETAVTMPVVRASTRATARMSA 120

Query: 114 KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSF 173
           + S  R  ASPLARRLA E G+ L ++SGSGP+GR++  D+ T  ++  +     T+   
Sbjct: 121 RASGERVFASPLARRLAEERGVRLETVSGSGPNGRVIAEDVLTARASSASEAVTHTV--- 177

Query: 174 GLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSL 233
                 +  + L+ F  D +E +    I++  A RL +SKQ +PHFY+++D  +DN++ +
Sbjct: 178 ------VAEHPLSKFFPD-FEDVSVSAIKRVTAERLTESKQQLPHFYLTVDVRLDNMMGI 230

Query: 234 REQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAV 293
           RE +N+ L   +     KISVND I+KA A A++ VP+ N SW  + + ++K  DISVAV
Sbjct: 231 RETLNKQLADDKAAEGAKISVNDFIVKASAKALLAVPDVNASWLGDKIRKYKKADISVAV 290

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
               G++ PI+R A    +  IS EVK LA RA+   L P++  GGT +ISN+GM G+ +
Sbjct: 291 QTERGLMVPIVRSACCLGLKSISAEVKSLAGRARSGSLTPQDMTGGTFTISNLGMFGVKN 350

Query: 354 FCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGAIASKLLAKF 411
           F A++NPPQ+ ILA+G G +K V +N E   +   +M+ATLS DHR VDGA+ ++ L  F
Sbjct: 351 FAAIVNPPQAAILAVG-GARKEVVKNAEGGYEEVLVMSATLSCDHRVVDGAVGAQWLQSF 409

Query: 412 KEYIENPVWMLM 423
           K Y+E+P+ ML+
Sbjct: 410 KCYLEDPMTMLL 421


>gi|54289583|gb|AAV32094.1| pyruvate dehydrogenase E2 subunit [Nyctotherus ovalis]
          Length = 485

 Score =  306 bits (783), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 163/439 (37%), Positives = 264/439 (60%), Gaps = 34/439 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT+G + KW K+EGD ++ GD++C++ETDKA + +E V++G+I +IL+P G
Sbjct: 60  LDLPNLSPTMTKGNITKWYKKEGDPVAAGDVICDVETDKATVGYEMVEDGVIAKILMPEG 119

Query: 66  TENIAVNSPILNILMDSTEIPP--------------SPPLSKENIVEVREEHSHSSPVVV 111
           ++++ +  P+  +  ++ ++                    + +   + REE    S    
Sbjct: 120 SKDVPLGKPVAIMGTEAKDVAAFKDYKPEAAAKPAAKKEEAPKKETKSREEAPRES---- 175

Query: 112 REKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
             K S+ R  A+P A++ A E+ IDLS ++GSGP GRI+K DI   + ++T  K  +  +
Sbjct: 176 --KRSEGRVRAAPAAKKYAEENNIDLSEVTGSGPGGRILKEDIVAFMESQTKEKPKAESK 233

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
           S    +       +N+     +  I   N ++  A RL ++KQT+PHFYVS++C +D LL
Sbjct: 234 SEATSEPKKSKPPVNIPGMPEFTDIELTNYKRVTAERLTEAKQTVPHFYVSVECEVDKLL 293

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISV 291
           +LR Q+N+         S KIS+ND+++KA +LA ++VP  N SW  + + R+K +D+SV
Sbjct: 294 TLRSQLNKI-------ASTKISINDMLIKACSLACLKVPVTNSSWMGDFVRRYKDVDMSV 346

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGI 351
           AV  P G++TPI+ +A+ K    I+   K+L  +AK   LKPE++ GGT +ISN GM GI
Sbjct: 347 AVQTPNGLITPIVPRANLKGFEQIAKITKELIAKAKDGTLKPEQFIGGTFTISNAGMYGI 406

Query: 352 NSFCAVINPPQSTILAIGAGEKKVVF---QNEE----IKVATIMNATLSADHRSVDGAIA 404
           +    ++NPPQ+ IL + A EKKVV    +NE     +++A+ M  +LS DHR VDGA  
Sbjct: 407 SQLIPIVNPPQACILGVSAVEKKVVVDEAKNEHMPGPLRIASKMTVSLSCDHRVVDGAGG 466

Query: 405 SKLLAKFKEYIENPVWMLM 423
           ++   +FK+ IENP  M++
Sbjct: 467 AEWTQEFKKLIENPALMML 485


>gi|156545418|ref|XP_001606561.1| PREDICTED: similar to dihydrolipoamide acetyltransferase component
           of pyruvate dehydrogenase [Nasonia vitripennis]
          Length = 489

 Score =  305 bits (782), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 174/444 (39%), Positives = 251/444 (56%), Gaps = 51/444 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +  W K+EGDK++ GD+L EIETDKA M FE+ +EG + +ILVPAG
Sbjct: 71  VPLPALSPTMETGTIISWQKKEGDKLNEGDLLAEIETDKATMGFETPEEGYLAKILVPAG 130

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKEN------------------------IVEVRE 101
            +N+ +   +  I+ D   +        +                           +   
Sbjct: 131 EKNVTIGRLVCIIVADEGSVAAFKDYKDDGSTVAAAPPSAPAPPPPAAPAAVPPPPKAAA 190

Query: 102 EHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTK 161
             + S+P +     S  R  ASPLARRLA E G+ L  L GSG  G +   D+       
Sbjct: 191 PAAVSTPSLAT---SGERVFASPLARRLASEQGLSLQGLKGSGLFGSVTAKDLA------ 241

Query: 162 TNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYV 221
                       G     + A      A    + IP  N+R  IA RL +SKQTIPH+Y+
Sbjct: 242 ------------GASPAGVGAPAGAAVAAPGGKDIPISNVRGVIAKRLLESKQTIPHYYL 289

Query: 222 SIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAM 281
           +I+  +D  LS+R+Q N+ L+  +E+I  K+SVND+I+K  A+A  +VPE N +W  + +
Sbjct: 290 TIEVKMDEALSMRQQFNKLLE--KEKI--KLSVNDLIIKGMAMACKKVPEGNSAWLGDKI 345

Query: 282 IRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTT 341
            ++ H+D+SVAVS   G++TPI+  AD K I+ IS +VK LA +A++ KL+P E+QGGT 
Sbjct: 346 RQYDHVDVSVAVSTDNGLITPIVFGADVKGIVQISNDVKALAAKAREGKLQPHEFQGGTI 405

Query: 342 SISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSV 399
           ++SN+GM GI SF A+INPPQS ILAIG  E ++V  + E     A  M  T S DHR+V
Sbjct: 406 TVSNLGMFGIKSFSAIINPPQSIILAIGTTETRLVPADNEKGFTTAQYMCVTASCDHRTV 465

Query: 400 DGAIASKLLAKFKEYIENPVWMLM 423
           DGA+ ++ L  FK ++ENP  ML+
Sbjct: 466 DGAVGAQWLTAFKNFMENPTTMLL 489


>gi|323508135|emb|CBQ68006.1| probable dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex, mitochondrial precursor
           [Sporisorium reilianum]
          Length = 490

 Score =  305 bits (782), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 168/447 (37%), Positives = 254/447 (56%), Gaps = 29/447 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
             MP++SPTMTEG +A W K+ G+  S GD+L EIETDKA M+ E+ D+G++ +ILV  G
Sbjct: 44  FNMPAMSPTMTEGGIAAWKKKPGEAFSAGDVLLEIETDKATMDVEAQDDGVLAKILVGDG 103

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVRE-------EHSHSSPV--------- 109
           ++ + VNS I  +  +  ++  +   + +   E  +       +   S+P          
Sbjct: 104 SKAVQVNSLIAIMAEEGDDLSGADAFADKAASEAGDAKPAEQPKKEESAPAESSSSSSSS 163

Query: 110 ----VVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI-STKTNV 164
                   + S +R  A+P+ARRLA + GI L+ + G+GP GRI+K+D+E          
Sbjct: 164 SSGSSFGSQSSGDRIFATPVARRLAQDKGIALNKIKGTGPDGRIIKADVENYKPEAAAAA 223

Query: 165 KDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
              ++  +         +      ++  Y  IP  N+R+TIA RL +SK T+PH+YVSID
Sbjct: 224 APAASKSASSAAAAPAKSAPAPASSEGDYTDIPVSNMRRTIAARLTESKSTVPHYYVSID 283

Query: 225 CNIDNLLSLREQMNRTLQFH-----REEISNKISVNDIILKAFALAMIQVPEANVSWTTN 279
             +D +L LRE  N+           +  + K+SV D I KA  +A+ +VPE N +W  +
Sbjct: 284 VEMDKVLKLREVFNKAAAEKAGKDVEKAKAAKLSVGDFITKAAGVALKEVPEVNSAWYGD 343

Query: 280 AMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
            + +H   DIS+AVS P G++TPI++      +  IS   KQLA +A+  KL P EYQGG
Sbjct: 344 FIRQHNKADISIAVSTPTGLITPIVKDVGGSGLATISAATKQLAAKARAGKLAPHEYQGG 403

Query: 340 TTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE---IKVATIMNATLSADH 396
           + +ISNMGM GI  F A+INPPQS ILAIG  E +++   E     + + +M AT+SADH
Sbjct: 404 SFTISNMGMFGITHFTAIINPPQSCILAIGGTEARLIPDAESEQGFRKSMVMQATISADH 463

Query: 397 RSVDGAIASKLLAKFKEYIENPVWMLM 423
           R+VDGA A+K +  FK+ +ENP+  ++
Sbjct: 464 RTVDGATAAKWMKAFKDALENPLSFML 490


>gi|328696627|ref|XP_001943838.2| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component
           of pyruvate dehydrogenase complex, mitochondrial-like
           [Acyrthosiphon pisum]
          Length = 492

 Score =  305 bits (781), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 175/451 (38%), Positives = 265/451 (58%), Gaps = 62/451 (13%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +  W K+EG++++ GD L EIETDKAIM+FE+ +EG + +I+VPAG
Sbjct: 71  VALPALSPTMESGTIINWTKKEGERLNEGDKLAEIETDKAIMDFETPEEGYLAKIMVPAG 130

Query: 66  TENIAVNSPILNILMDSTEIPPSPPL----------------------------SKENIV 97
            +++ V   +  I+ + +++                                      + 
Sbjct: 131 QKDVTVGKLVCIIVENESDVAAFKDFVDNTSAGAPAPAAPSPSPKPSTSAPAPPPPAPVA 190

Query: 98  EVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSL-SGSGPHGRIVKSDIET 156
                 + S P+ +      +R +ASPLA+RLA E G+DLS++  GSG  G I  +D++ 
Sbjct: 191 PKASAPTKSVPIPI-----GSRILASPLAKRLATEKGLDLSTIRQGSGLFGSIKSTDLDK 245

Query: 157 ---LISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSK 213
                S KT V D   I+  G VD+                  P  N+RK IA RL +SK
Sbjct: 246 ASITSSQKTAVAD--GIRGDGFVDK------------------PVTNVRKIIAKRLLESK 285

Query: 214 QTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEAN 273
           QTIPH+Y+++D  +DN++SLR++MN  L+  +E +  K+S+ND I+KA ALA  +VPEAN
Sbjct: 286 QTIPHYYLTVDLGLDNIVSLRKRMNELLE--KEGV--KLSINDFIIKAAALACKKVPEAN 341

Query: 274 VSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKP 333
            SW  N + ++  +D+SVAVS   G++TPI+  AD K ++ IS +VK+LA +A+Q KL+P
Sbjct: 342 SSWMDNFIRQYDAVDVSVAVSTETGLITPIVFNADTKGLIAISTDVKELAAKARQGKLQP 401

Query: 334 EEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVV-FQNEEIKVATIMNATL 392
           +EYQGGT S+SN+GM G+ S  ++INPPQS IL IGA  +++V  +    +    +  TL
Sbjct: 402 QEYQGGTFSVSNLGMFGVKSVSSIINPPQSCILGIGAMTQRLVPDKTNGTRAQDTLQVTL 461

Query: 393 SADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           S DHR VDGA+ ++ L  F+ Y+E P  ML+
Sbjct: 462 SCDHRVVDGAVGAQWLQAFRRYVEEPHNMLL 492


>gi|189219015|ref|YP_001939656.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide
           acyltransferase (E2) component or related enzyme
           [Methylacidiphilum infernorum V4]
 gi|189185873|gb|ACD83058.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide
           acyltransferase (E2) component or related enzyme
           [Methylacidiphilum infernorum V4]
          Length = 413

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 176/430 (40%), Positives = 262/430 (60%), Gaps = 32/430 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP LSP+MTEG++ +W+K+EG+ I  G+++ E+ETDKA+M+ E+ + GI+ +IL+P G
Sbjct: 4   ITMPLLSPSMTEGQIVRWLKKEGEPIQEGEVIAEVETDKAVMDLEAFESGILKQILLPEG 63

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSK--ENIVEVREEHSHSS---PVV------VREK 114
           +    VN+PI  I  +S E   +  LS   E ++E +E+    S   P V      V EK
Sbjct: 64  S-RAPVNTPIALIETESEE---TGQLSTAHEPVMEAKEKSETPSLPKPSVQLKQGPVEEK 119

Query: 115 HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFG 174
             + +  +SPLAR++AGE GIDLS++ G+GP GRIVK D+   +  K   K    +Q  G
Sbjct: 120 PQRIK--SSPLARKIAGEEGIDLSAVQGTGPGGRIVKRDVLEKVEQK---KKMLPVQEPG 174

Query: 175 LVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLR 234
           ++       +           IP   +R+ IA RL +SK TIPHFY+  +  +  L  LR
Sbjct: 175 VISPRPSPGVTK---------IPLSLMREKIAKRLLESKTTIPHFYLETEIVVTALSQLR 225

Query: 235 EQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVS 294
            ++N+    H  E   K + ND ILKA   A+ +VP  N SW  ++++ H  I ++ AV+
Sbjct: 226 NELNQYYSQH--EQPWKFTYNDFILKATIEAIKRVPAVNASWNGDSILHHDAIHLAFAVA 283

Query: 295 IPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSF 354
           I  G++TP+I+ A  KS++ +S E K+L Q+A++RKL PEEY GGT ++SN+GM GI SF
Sbjct: 284 IEDGLITPVIKDAQNKSLMVLSKEAKELIQKAQERKLSPEEYSGGTITVSNLGMFGIESF 343

Query: 355 CAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKE 413
            A+I+PPQ  ILAIG+  KK +V     I +  +M    S DHR +DGA  +K L +FK+
Sbjct: 344 YAIIDPPQDMILAIGSIMKKPLVDGQNNIVIGEVMKVNASCDHRVIDGATGAKFLKEFKQ 403

Query: 414 YIENPVWMLM 423
            +ENP+ ML+
Sbjct: 404 IMENPLSMLV 413


>gi|255571622|ref|XP_002526756.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase, putative [Ricinus communis]
 gi|223533883|gb|EEF35610.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase, putative [Ricinus communis]
          Length = 633

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 184/416 (44%), Positives = 254/416 (61%), Gaps = 27/416 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G +AKW K+EGDKI  GD++CEIETDKA +EFE ++EG + +IL P G
Sbjct: 214 LEMPALSPTMNQGNIAKWRKKEGDKIEVGDVICEIETDKATLEFECLEEGYLAKILAPEG 273

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH--SHSSPVVVREKHSKNRPIAS 123
           ++++AV  PI   + D  +I  +   S  N +EV+EE    H S    RE+      I S
Sbjct: 274 SKDVAVGQPIALTVEDPNDIE-TVKTSISNGMEVKEEKFTRHDSKDETREEKPSFSRI-S 331

Query: 124 PLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI-----STKTNV---KDYSTIQSFGL 175
           P AR L  E+G+D S+L  SGP G ++K D+   I     S+K +V   K+  + Q    
Sbjct: 332 PSARLLISEYGLDASTLKASGPFGTLLKIDVLAAIKAGKGSSKKSVPKEKEAPSPQKGPY 391

Query: 176 VDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLRE 235
              ++     +    DS+E IP+  IRK IA RL +SKQT PH Y+S D  +D L+S R+
Sbjct: 392 ASTTVLPEPQSQ-QSDSFEDIPNTQIRKVIARRLLESKQTTPHLYLSTDVILDPLISFRK 450

Query: 236 QMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA--MIRHKHIDISVAV 293
           ++       +E    K+SVNDI++KA A+A+  VPEAN  W  +   ++    +DIS+AV
Sbjct: 451 EL-------KEHHDIKVSVNDIVIKAVAIALRNVPEANAYWNEDKGEIVFCDSVDISIAV 503

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
           +   G++TPI+R ADQKSI  IS EVKQLA+RA+  KL P E+QGGT SISN+GM  ++ 
Sbjct: 504 ATEKGLMTPIVRNADQKSISSISAEVKQLAERARAGKLTPNEFQGGTFSISNLGMYPVDH 563

Query: 354 FCAVINPPQSTILAIGAGEKKV-----VFQNEEIKVATIMNATLSADHRSVDGAIA 404
           F A+INPPQ+ ILA+G G K V         E+  V T M  TLSADHR  DG + 
Sbjct: 564 FAAIINPPQAGILAVGRGNKVVEPLLGSDGCEKPAVVTKMTLTLSADHRVFDGKVG 619



 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 57/70 (81%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTMT+G +AKW K+EGDK+  GD+LCEIETDKA +EFES++EG + +IL P G
Sbjct: 90  IGMPALSPTMTQGNVAKWRKKEGDKVKVGDVLCEIETDKATLEFESLEEGFLAKILTPEG 149

Query: 66  TENIAVNSPI 75
           ++++ V  PI
Sbjct: 150 SKDVPVGQPI 159


>gi|195437950|ref|XP_002066902.1| GK24306 [Drosophila willistoni]
 gi|194162987|gb|EDW77888.1| GK24306 [Drosophila willistoni]
          Length = 507

 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 169/447 (37%), Positives = 253/447 (56%), Gaps = 50/447 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +  W K+EGDK++ GD+LCEIETDKA M FE+ +EG + +IL+  G
Sbjct: 82  VPLPALSPTMERGSIVSWEKKEGDKLNEGDLLCEIETDKATMGFETPEEGYLAKILIAGG 141

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVV--------------- 110
           T+++ V   +  I+ D   I        +         + + P                 
Sbjct: 142 TKDVPVGQLVCIIVPDQGSIAAFKDFKDDGAGAAPPAAAAAPPPPPAAAAAPAPVAAAAP 201

Query: 111 -----------VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
                         +   +R  ASP+A++LA    + L    GSG HG I   D+    +
Sbjct: 202 APPPPAPAAGQTASEQRGDRVYASPMAKKLAEAQKLRLQG-KGSGVHGSIKSGDLAEASA 260

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
                   +  ++ G                  Y  IP  N+R  IA RL +SK  +PH+
Sbjct: 261 RAAASGGAAASRAPGA----------------RYTDIPVTNMRAIIAKRLLESKTQLPHY 304

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN 279
           YV++ C +DNLL LR ++N+      E+   ++SVND I+KA A+A ++VPEAN SW  +
Sbjct: 305 YVTVQCQVDNLLKLRARINKKY----EKKGVRVSVNDFIIKATAIASLKVPEANSSWMDS 360

Query: 280 AMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
            + ++  +D+SVAVS   G++TPII  AD+K ++DIS +VK+LA++A+Q KL+P E+QGG
Sbjct: 361 VIRQYDDVDVSVAVSTDKGLITPIIFNADRKGVIDISKDVKELAEKARQNKLQPHEFQGG 420

Query: 340 TTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVA---TIMNATLSADH 396
           T S+SN+GM G+N FCAVINPPQS ILAIG   K++V   + IK      ++  TLSADH
Sbjct: 421 TISVSNLGMFGVNQFCAVINPPQSCILAIGTTTKQLVLDPDNIKGFKEINLLTVTLSADH 480

Query: 397 RSVDGAIASKLLAKFKEYIENPVWMLM 423
           R VDGA+A++ L  F+++IE+P  M++
Sbjct: 481 RVVDGAVAARWLQHFRDFIEDPANMIL 507


>gi|281201985|gb|EFA76192.1| dihydrolipoamide acetyltransferase [Polysphondylium pallidum PN500]
          Length = 695

 Score =  303 bits (777), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 167/439 (38%), Positives = 267/439 (60%), Gaps = 31/439 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSP+M  G LAKW K+ GD++  GDI+ ++ETDKA M+FE ++ G + +ILVPAG
Sbjct: 267 VGMPALSPSMETGGLAKWNKKVGDQVKVGDIIAQVETDKATMDFECLESGYVAKILVPAG 326

Query: 66  TENIAVNSPILNI--------------LMDSTEIPPSPPLSKENIVEVREEHSHSSPVVV 111
           T  + ++SP+  +              +  ST  P     ++    +     S SS    
Sbjct: 327 TSGVNIDSPVCILAAKKEDIDKFNDYTVGTSTSAPAESAPAESAAPQQTSTPSSSSSSAP 386

Query: 112 REKHSKN-RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
           R+++++  R  +SP AR +A E G++++ +SG+GP+ RIVK+D+          K    +
Sbjct: 387 RQQNNEGGRIFSSPAARFVAKEKGVNIADVSGTGPNQRIVKADV-----LNYQPKAVEEV 441

Query: 171 QSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNL 230
                   +     +       Y  IPH NIRK  A RL +SKQTIPH+Y++++C +D L
Sbjct: 442 APAAAATTTATRPAVATEQVGEYTDIPHSNIRKVTAARLTESKQTIPHYYLTMECRVDKL 501

Query: 231 LSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDIS 290
           L +R ++N      + +   K+SVND I+KA + A+  VP  N +W T+A+ R  ++DI+
Sbjct: 502 LKVRTELN-----GQADGKYKLSVNDFIIKAASAALKDVPTVNSTWMTSAVRRFHNVDIN 556

Query: 291 VAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLG 350
           VAV+   G+ TP++R +D+K +  I+ +V+++A +AK+ KL+P+++Q GT +ISN+GM G
Sbjct: 557 VAVNTDIGLFTPLVRDSDKKGLATIANQVREMADKAKKGKLQPQDFQSGTFTISNLGMFG 616

Query: 351 INSFCAVINPPQSTILAIGAGEKKVVFQNE------EIKVATIMNATLSADHRSVDGAIA 404
           I SF AVINPPQ+ ILAIG  E ++V   +        + ATI++ TLS DHR +DGA+ 
Sbjct: 617 IKSFSAVINPPQAAILAIGTTESRLVPAEKPKEGELPYETATILSVTLSCDHRVIDGAVG 676

Query: 405 SKLLAKFKEYIENPVWMLM 423
           ++ L +FK+YIENP+ +L+
Sbjct: 677 AEWLQRFKDYIENPLKLLL 695



 Score = 80.9 bits (198), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 51/70 (72%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSP+MTEG +  W K+ GD+I  GDI+ +IETDKA M+FE ++ G + +I+ P G
Sbjct: 135 IDMPALSPSMTEGNIVAWNKKVGDQIKVGDIIAQIETDKATMDFECLESGYLAKIIAPEG 194

Query: 66  TENIAVNSPI 75
           T+ I +NS I
Sbjct: 195 TKGIPINSLI 204


>gi|183220944|ref|YP_001838940.1| pyruvate dehydrogenase complex dihydrolipoyllysine-residue
           acetyltransferase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|167779366|gb|ABZ97664.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 464

 Score =  303 bits (775), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 178/479 (37%), Positives = 270/479 (56%), Gaps = 75/479 (15%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           MM     M  LSPTM EG + KW+K EGD ISPGDIL E+ETDKA+ME E+ D G+I +I
Sbjct: 1   MMAKIQEMTQLSPTMEEGTIVKWLKNEGDAISPGDILAEVETDKAVMEMEAYDAGVILKI 60

Query: 61  LVPAGT-----ENIAV--------NSPILNILMDSTEI----PPSPPLSKENIVE----- 98
           +   GT     E +A+        +S + N+    T+     P SP  S E   E     
Sbjct: 61  IQQEGTKLRVGEAMAIIGKPGEDISSLLSNLPKKETQAKGPNPTSPSPSGEVSSESGANG 120

Query: 99  ----------VREEHSHSSP------------VVVREKHSKNRPI-------------AS 123
                     ++E+ +  +P            +  +   S  +P+             AS
Sbjct: 121 NDRAITQEKAIQEKQTLETPTEAQFPVAQGSAIPTKNSSSSQKPLPLSNIPRGSLRVLAS 180

Query: 124 PLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDAN 183
           PLA+ +A EHGIDL  + G+GP GRI K D+   ++              G    S D++
Sbjct: 181 PLAKSIAIEHGIDLHQVLGTGPEGRITKKDVLDSLNK-------------GFRPSSFDSD 227

Query: 184 ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQF 243
            ++       EV+  + +RKTIA RL +SKQ +PHFY+++D N   L S R+++N     
Sbjct: 228 KMS-----QDEVVSLNGMRKTIAKRLTESKQNLPHFYLNVDINAKALESFRKEINDFQTS 282

Query: 244 HREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPI 303
              + +NK+S+NDII+KA A A+   P+ N S+  +++++   +D+ +AVSI GG++TP+
Sbjct: 283 QNPDSANKVSLNDIIVKATAAALKLHPKVNASFQGDSILQFGRVDVGIAVSIDGGLLTPV 342

Query: 304 IRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQS 363
           IR A++KSIL+IS EVK+LA++A+ RKLKPEE+  GT +ISN+GM GI+ F A+IN P+ 
Sbjct: 343 IRDANRKSILEISKEVKELAKKARDRKLKPEEFTNGTFTISNLGMYGISRFTAIINEPEG 402

Query: 364 TILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
            ILA+G+ E K V +N  +    +++ TLS DHR +DGA+ ++ L   + ++E P  +L
Sbjct: 403 AILAVGSAEDKPVVENGVVVAGRVISLTLSCDHRVIDGAVGAEFLKTLRSFLEKPNLLL 461


>gi|302783122|ref|XP_002973334.1| hypothetical protein SELMODRAFT_99356 [Selaginella moellendorffii]
 gi|300159087|gb|EFJ25708.1| hypothetical protein SELMODRAFT_99356 [Selaginella moellendorffii]
          Length = 590

 Score =  302 bits (774), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 177/414 (42%), Positives = 248/414 (59%), Gaps = 34/414 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTMT+G + +W K+E DK+S GD+LC IETDKA ++FESV+EG + +I  P+G
Sbjct: 128 LGMPALSPTMTQGNIVEWKKKERDKVSAGDVLCTIETDKATVDFESVEEGFLAKIASPSG 187

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREK-----HSKNRP 120
           ++N+ +   I  ++ DST     P  +K    E + +    S V V  K      SK   
Sbjct: 188 SKNVPIGQTIGVMVRDSTPCSGQPSATK---TEGKPQADAPSKVSVMSKPPAAAGSKALS 244

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNV-KDYSTIQSFGLVDES 179
              P  RRL  E G+D SS++G+GP G ++K D+   I   T   K     +S      S
Sbjct: 245 RVGPSVRRLLAESGLDASSINGTGPRGVVLKGDVLAAIKGGTKPGKPPKDAKSRPSPPTS 304

Query: 180 IDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
           +D           +E IP   IR+ IA RL +SK  IPHFY+S D  +D+ L LR++M  
Sbjct: 305 LD-----------FEDIPTSQIRRIIAKRLIESKFGIPHFYISADAILDSTLLLRKEM-- 351

Query: 240 TLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA--MIRHKHIDISVAVSIPG 297
                +E+    +SVND +++A ALA+  VPEAN  W   A  ++ HK IDIS+AV+   
Sbjct: 352 -----KEKHGAAVSVNDFVIRATALALRSVPEANAFWDEKAGEIVFHKTIDISIAVATDK 406

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G++TPI++ AD K++  IS EVK LA+RA+  KLKPEE+QGGT SISN+GM  ++ FCA+
Sbjct: 407 GLITPILKNADLKTLSAISTEVKALAERARTGKLKPEEFQGGTFSISNLGMFPVDRFCAI 466

Query: 358 INPPQSTILAIGAGEKKVVFQN-----EEIKVATIMNATLSADHRSVDGAIASK 406
           INPPQ+ ILA+G GEK VV+++        +  T M  TLSAD+R  D  IA K
Sbjct: 467 INPPQACILAVGKGEKVVVWEDCSESGGRPRTVTKMGMTLSADNRVFDTTIAGK 520



 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 64/80 (80%)

Query: 6  ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
          + MP+LSPTMT+G + +W K+EGDK+SPGD+LC IETDKA ++FESV+EG + +ILVP G
Sbjct: 2  LGMPALSPTMTQGNVIQWKKKEGDKVSPGDVLCVIETDKATVDFESVEEGFLAKILVPGG 61

Query: 66 TENIAVNSPILNILMDSTEI 85
          T N++V   I  ++ D+++I
Sbjct: 62 TNNVSVGQTIGVMVEDASDI 81


>gi|297816492|ref|XP_002876129.1| dihydrolipoamide S-acetyltransferase 3 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297321967|gb|EFH52388.1| dihydrolipoamide S-acetyltransferase 3 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 636

 Score =  302 bits (773), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 182/434 (41%), Positives = 264/434 (60%), Gaps = 28/434 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G +AKW K+EGDKI  GD++ EIETDKA +EFES++EG + +IL+P G
Sbjct: 215 LEMPALSPTMNQGNIAKWWKKEGDKIEVGDVIGEIETDKATLEFESLEEGYLAKILIPEG 274

Query: 66  TENIAVNSPILNILMDSTEI---PPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
           ++++AV  PI  I+ D+  I     S   S E  VE  +E  HS   VV +   +     
Sbjct: 275 SKDVAVGKPIALIVEDAESIEVIKSSSAGSSE--VETVKEVPHS---VVDKPTGRKAGFT 329

Query: 123 --SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST----KTNVKDYSTIQSFGLV 176
             SP A+ L   HG++ SS+  SGP+G ++KSD+   I++    KT+V       S    
Sbjct: 330 KISPAAKLLILGHGLEASSIEASGPYGTLLKSDVAAAIASGKVSKTSVSTKKKQPSKETP 389

Query: 177 DESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
            +S   +  ++   D+YE  P+  IRK IA RL +SKQ  PH Y+  D  +D LL+ R++
Sbjct: 390 SKSSSTSKSSVTQSDNYEDFPNSQIRKIIAKRLLESKQKTPHLYLQSDVVLDPLLAFRKE 449

Query: 237 MNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA--MIRHKHIDISVAVS 294
           +       +E    K+SVNDI++KA A+A+  V +AN  W      ++    +DIS+AV+
Sbjct: 450 L-------QENHGVKVSVNDIVIKAVAVALRNVRQANAYWDAEKGDIVMCDSVDISIAVA 502

Query: 295 IPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSF 354
              G++TPII+ ADQKSI  ISLEVK+LAQ+A+  KL P E+QGGT SISN+GM  ++ F
Sbjct: 503 TEKGLMTPIIKNADQKSISAISLEVKELAQKARSGKLAPHEFQGGTFSISNLGMYPVDHF 562

Query: 355 CAVINPPQSTILAIGAGEKKV-----VFQNEEIKVATIMNATLSADHRSVDGAIASKLLA 409
           CA+INPPQ+ ILA+G G K V     +   E+  V T MN TLSADHR  DG + +  ++
Sbjct: 563 CAIINPPQAGILAVGRGNKVVEPVIGLDGIEKPSVVTKMNVTLSADHRIFDGQVGASFMS 622

Query: 410 KFKEYIENPVWMLM 423
           + +   E+   +L+
Sbjct: 623 ELRSNFEDVRRLLL 636



 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/70 (58%), Positives = 56/70 (80%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM+ G + KW+K+EGDK+  GD+LCEIETDKA +EFES +EG + +ILV  G
Sbjct: 88  LAMPALSPTMSHGNVVKWMKKEGDKVEVGDVLCEIETDKATVEFESQEEGFLAKILVTEG 147

Query: 66  TENIAVNSPI 75
           +++I VN PI
Sbjct: 148 SKDIPVNEPI 157


>gi|189911040|ref|YP_001962595.1| bifunctional dihydrolipoyllysine-residue
           acetyltransferase/dihydrolipoyllysine-residue
           succinyltransferase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167775716|gb|ABZ94017.1| Bifunctional dihydrolipoyllysine-residue
           acetyltransferase/dihydrolipoyllysine-residue
           succinyltransferase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
          Length = 463

 Score =  301 bits (770), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 176/472 (37%), Positives = 268/472 (56%), Gaps = 75/472 (15%)

Query: 8   MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGT- 66
           M  LSPTM EG + KW+K EGD ISPGDIL E+ETDKA+ME E+ D G+I +I+   GT 
Sbjct: 7   MTQLSPTMEEGTIVKWLKNEGDAISPGDILAEVETDKAVMEMEAYDAGVILKIIQQEGTK 66

Query: 67  ----ENIAV--------NSPILNILMDSTEI----PPSPPLSKENIVE------------ 98
               E +A+        +S + N+    T+     P SP  S E   E            
Sbjct: 67  LRVGEAMAIIGKPGEDISSLLSNLPKKETQAKGPNPTSPSPSGEVSSESGANGNDRAITQ 126

Query: 99  ---VREEHSHSSP------------VVVREKHSKNRPI-------------ASPLARRLA 130
              ++E+ +  +P            +  +   S  +P+             ASPLA+ +A
Sbjct: 127 EKAIQEKQTLETPTEAQFPVAQGSAIPTKNSSSSQKPLPLSNIPRGSLRVLASPLAKSIA 186

Query: 131 GEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAK 190
            EHGIDL  + G+GP GRI K D+   ++              G    S D++ ++    
Sbjct: 187 IEHGIDLHQVLGTGPEGRITKKDVLDSLNK-------------GFRPSSFDSDKMS---- 229

Query: 191 DSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISN 250
              EV+  + +RKTIA RL +SKQ +PHFY+++D N   L S R+++N        + +N
Sbjct: 230 -QDEVVSLNGMRKTIAKRLTESKQNLPHFYLNVDINAKALESFRKEINDFQTSQNPDSAN 288

Query: 251 KISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQK 310
           K+S+NDII+KA A A+   P+ N S+  +++++   +D+ +AVSI GG++TP+IR A++K
Sbjct: 289 KVSLNDIIVKATAAALKLHPKVNASFQGDSILQFGRVDVGIAVSIDGGLLTPVIRDANRK 348

Query: 311 SILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGA 370
           SIL+IS EVK+LA++A+ RKLKPEE+  GT +ISN+GM GI+ F A+IN P+  ILA+G+
Sbjct: 349 SILEISKEVKELAKKARDRKLKPEEFTNGTFTISNLGMYGISRFTAIINEPEGAILAVGS 408

Query: 371 GEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
            E K V +N  +    +++ TLS DHR +DGA+ ++ L   + ++E P  +L
Sbjct: 409 AEDKPVVENGVVVAGRVISLTLSCDHRVIDGAVGAEFLKTLRSFLEKPNLLL 460


>gi|5881965|gb|AAD55140.1|AF066080_1 dihydrolipoamide S-acetyltransferase [Arabidopsis thaliana]
          Length = 637

 Score =  300 bits (769), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 178/441 (40%), Positives = 267/441 (60%), Gaps = 41/441 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G +AKW K+EGDKI  GD++ EIETDKA +EFES++EG + +IL+P G
Sbjct: 215 LEMPALSPTMNQGNIAKWWKKEGDKIEVGDVIGEIETDKATLEFESLEEGYLAKILIPEG 274

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPV-VVREKHSK--NRPIA 122
           ++++AV  PI  I+ D+           E+I  ++   + SS V  V+E      ++P  
Sbjct: 275 SKDVAVGKPIALIVEDA-----------ESIEAIKSSSAGSSEVDTVKEVPDSVVDKPTE 323

Query: 123 --------SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFG 174
                   SP A+ L  EHG++ SS+  SGP+G ++KSD+   I++    K  +  +   
Sbjct: 324 RKAGFTKISPAAKLLILEHGLEASSIEASGPYGTLLKSDVVAAIASGKASKSSAFTKKKQ 383

Query: 175 LVDESIDANILNLF-----AKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
              E+   +          + ++YE  P+  IRK IA RL +SKQ IPH Y+  D  +D 
Sbjct: 384 PSKETPSKSSSTSKPSVTQSDNNYEDFPNSQIRKIIAKRLLESKQKIPHLYLQSDVVLDP 443

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA--MIRHKHI 287
           LL+ R+++       +E    K+SVNDI++KA A+A+  V +AN  W      ++    +
Sbjct: 444 LLAFRKEL-------QENHGVKVSVNDIVIKAVAVALRNVRQANAFWDAEKGDIVMCDSV 496

Query: 288 DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMG 347
           DIS+AV+   G++TPII+ ADQKSI  ISLEVK+LAQ+A+  KL P E+QGGT SISN+G
Sbjct: 497 DISIAVATEKGLMTPIIKNADQKSISAISLEVKELAQKARSGKLAPHEFQGGTFSISNLG 556

Query: 348 MLGINSFCAVINPPQSTILAIGAGEKKV--VFQNEEIK---VATIMNATLSADHRSVDGA 402
           M  +++FCA+INPPQ+ ILA+G G K+V  V   + I+   V T MN TLSADHR  DG 
Sbjct: 557 MYPVDNFCAIINPPQAGILAVGRGNKEVEPVIGLDGIEKPCVVTKMNVTLSADHRIFDGQ 616

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + +  +++ +   E+   +L+
Sbjct: 617 VGASFMSELRSNFEDVRRLLL 637



 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 90/149 (60%), Gaps = 8/149 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM+ G + KW+K+EGDK+  GD+LCEIETDKA +EFES +EG + +ILV  G
Sbjct: 88  LAMPALSPTMSHGNVVKWMKKEGDKVEVGDVLCEIETDKATVEFESQEEGFLAKILVTEG 147

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREE---HSHSSPVVVREKHSKNRPIA 122
           +++I VN PI  ++ +  +I  + P + E   + +EE   H    P    ++ S  +P A
Sbjct: 148 SKDIPVNEPIAIMVEEEDDI-KNVPATIEGGRDGKEETSAHQVMKPDESTQQKSSIQPDA 206

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVK 151
           S L   +     +++ +LS +   G I K
Sbjct: 207 SDLPPHVV----LEMPALSPTMNQGNIAK 231


>gi|307203962|gb|EFN82869.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex, mitochondrial [Harpegnathos
           saltator]
          Length = 465

 Score =  300 bits (769), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 168/445 (37%), Positives = 259/445 (58%), Gaps = 52/445 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +  W K+EGDK++ GD+L EIETDKA M FE+ +EG + +I+VPAG
Sbjct: 46  VQLPALSPTMETGTIVSWQKKEGDKLNEGDLLAEIETDKATMGFETPEEGYLAKIVVPAG 105

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKH---------- 115
           T+N+ +   +  I+ +   +        + +       +      V  K           
Sbjct: 106 TKNVPIGKLVCIIVEEQASVAAFKDFKDDGLDVAPAAPAPPPVAPVSAKPPPIPAAQPAP 165

Query: 116 ---------------SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST 160
                          S  R  ASPLAR+LA E G++L  L+G+G +G I   D++  +  
Sbjct: 166 VTAAAAAPPPSVSTISGERIYASPLARKLASEKGVNLQGLTGTGLYGSITSKDLQQAVPA 225

Query: 161 KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
                          V   + A +           IP  +IR  IA RL +SKQTIPH+Y
Sbjct: 226 AGPA-----------VTTGVPAGV----------DIPVSSIRAVIAKRLLESKQTIPHYY 264

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           +S+D  +D ++++REQ N+ L+  +E+I  K+SVNDII+KA A+A  +VPE N +W  N 
Sbjct: 265 LSLDIKMDAVMAMREQFNKILE--KEKI--KLSVNDIIIKAIAMACKKVPEGNSAWLGNM 320

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           + ++ ++D+SVAVS   G++TPI+  AD K ++ IS +++ LA +A++ KL+ +E+QGGT
Sbjct: 321 IRQYNNVDVSVAVSTDIGLITPIVFSADTKGLVQISKDMRVLATKAREGKLQLQEFQGGT 380

Query: 341 TSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATI--MNATLSADHRS 398
            ++SN+GM GI +F A+INPPQS ILA+G  E ++V    E   +T+  M+ T S DHR+
Sbjct: 381 ITLSNLGMFGIKNFSAIINPPQSIILAVGTTELRLVPAKNEKGFSTVQYMSVTASCDHRT 440

Query: 399 VDGAIASKLLAKFKEYIENPVWMLM 423
           VDGAI ++ L+ FK ++ENP  ML+
Sbjct: 441 VDGAIGAQWLSAFKNFMENPTTMLL 465


>gi|54289587|gb|AAV32096.1| pyruvate dehydrogenase E2 subunit [Nyctotherus ovalis]
          Length = 485

 Score =  300 bits (768), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 164/435 (37%), Positives = 265/435 (60%), Gaps = 26/435 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTMT+G + KW K+EGD ++ GD++C++ETDKA + +E V++G+I +IL+P G
Sbjct: 60  LDLPNLSPTMTKGYITKWYKKEGDPVTAGDVICDVETDKATVGYEMVEDGVIAKILMPEG 119

Query: 66  TENIAVNSPILNILMDSTEIPP---------SPPLSKENIVEVREEHSHSSPVVVRE-KH 115
           ++ + +  P+  ++ ++ ++           + P +K+     RE  S       RE K 
Sbjct: 120 SKEVPLGKPVAIMVTEAKDVAAFKDYKPEAAAKPAAKKEEAPKRETKSREE--APRESKR 177

Query: 116 SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGL 175
           S+ R  A+P A++ A E+ IDLS ++GSGP GRI+K DI   + ++T  K  +  +    
Sbjct: 178 SEGRVRAAPAAKKFAEENNIDLSEVTGSGPGGRILKEDIIAFMESQTKEKPKAESKPEAT 237

Query: 176 VDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLRE 235
            +       +N+     +  I   N ++  A RL ++KQT+P FYVS++C +D LL+LR 
Sbjct: 238 SEPKKSKPPVNIPGMPEFTDIELTNYKRVTAERLTEAKQTVPLFYVSVECEVDKLLTLRS 297

Query: 236 QMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSI 295
           Q+N+         S KIS+ND+++KA +LA ++VP  N SW  + + R+K +D+SVAV  
Sbjct: 298 QLNKI-------ASTKISINDMLIKACSLACLKVPVTNSSWMGDFVRRYKDVDMSVAVQT 350

Query: 296 PGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFC 355
           P G++TPI+ +A+ K    I+   K+L  +AK   LKPE++ GGT +ISN GM GI+   
Sbjct: 351 PNGLITPIVPRANLKGFEQIAKITKELIAKAKDGTLKPEQFIGGTFTISNAGMYGISQLI 410

Query: 356 AVINPPQSTILAIGAGEKKVVF---QNEE----IKVATIMNATLSADHRSVDGAIASKLL 408
            ++NPPQ+ IL + A EKKVV    +NE     +++A+ M  +LS DHR VDGA  ++  
Sbjct: 411 PIVNPPQACILGVSAVEKKVVVDEAKNEHMPAPLRIASKMTVSLSCDHRVVDGAGGAEWT 470

Query: 409 AKFKEYIENPVWMLM 423
            +FK+ IENP  M++
Sbjct: 471 QEFKKLIENPALMML 485


>gi|302831351|ref|XP_002947241.1| dihydrolipoamide acetyltransferase [Volvox carteri f. nagariensis]
 gi|300267648|gb|EFJ51831.1| dihydrolipoamide acetyltransferase [Volvox carteri f. nagariensis]
          Length = 613

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 161/457 (35%), Positives = 250/457 (54%), Gaps = 50/457 (10%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
             + MP+LSPTM++G + +W K+ GD ++PGD+ CE+ETDKA + +ES +EG +  IL+P
Sbjct: 168 QVLNMPALSPTMSQGNIVEWKKKVGDPVAPGDVYCEVETDKATISWESQEEGFVARILLP 227

Query: 64  AGTENIAVNSPILNILMD---------------------------------STEIPPSPP 90
            G ++I V  P L ++ D                                   E+PP+  
Sbjct: 228 DGAKDIEVGRPALVLVDDKETVPFFASFTASDAASGEQTPPAPAAATATAAKAEVPPASA 287

Query: 91  LSKENIVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIV 150
           +S +   E  E +     V      S  R  ASP AR+LA E G+ L +LSG+G  GRIV
Sbjct: 288 VSVQRPPETGETN-----VAAPAAASTGRLRASPYARKLAAELGVALEALSGTGSVGRIV 342

Query: 151 KSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQ 210
             D+     +   +   +   +        D          +Y  +PH+ IR+ +A RL 
Sbjct: 343 ADDVRGATGSAAAIPPVAAPAAVSSATPQAD-------TAAAYVDLPHNQIRRVVARRLL 395

Query: 211 QSKQTIPHFYVSIDCNIDNLLSLREQMN-----RTLQFHREEISNKISVNDIILKAFALA 265
           +SKQT+PH+Y++++C ++ +  LRE++N              ++ K+SVND ++KA A A
Sbjct: 396 ESKQTVPHYYLTMECRVEEIQQLRERLNALNSAGQKGGKGGAVAPKLSVNDFVVKAAAKA 455

Query: 266 MIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQR 325
           + +VP  N SW  + + ++ ++DIS+AV  P G+  PI+R AD KS+  IS E++ LA +
Sbjct: 456 LKEVPGVNASWFPDFIRQYNNVDISIAVQTPSGLQVPIVRNADLKSLGAISSEIRALAGK 515

Query: 326 AKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVA 385
           AK+ KL P +Y GGT ++SN+GM GI  F A++NPPQ+ ILA+GA    +   +   K  
Sbjct: 516 AKEGKLLPGDYAGGTFTVSNLGMYGIKQFAAIVNPPQAAILAVGAMTPTIARVDGVFKEV 575

Query: 386 TIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
             + ATLS DHR +DGA+ ++ L  FK  IENP+ + 
Sbjct: 576 PTILATLSCDHRVIDGAMGAEWLVAFKAQIENPLLLF 612



 Score = 90.9 bits (224), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 61/80 (76%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MPSLSPTMT+G + KW KQ G++++PG IL E+ETDKA +E+E+ +EG + + LVP G
Sbjct: 51  LNMPSLSPTMTQGNITKWRKQPGEQVAPGQILAEVETDKATIEWEAQEEGFMAKHLVPEG 110

Query: 66  TENIAVNSPILNILMDSTEI 85
           T++IAV +P+  +  ++ ++
Sbjct: 111 TQDIAVGTPVAVLAEEAGDV 130


>gi|50291443|ref|XP_448154.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49527465|emb|CAG61105.1| unnamed protein product [Candida glabrata]
          Length = 469

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 183/460 (39%), Positives = 269/460 (58%), Gaps = 65/460 (14%)

Query: 4   HT-ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HT I MP+LSPTM++G LA W K+EGD ++PGD+L EIETDKA M+FE  DEG + +ILV
Sbjct: 35  HTVIGMPALSPTMSQGNLAVWSKKEGDSLAPGDVLAEIETDKAQMDFEFQDEGYLAKILV 94

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKEN--------------------------- 95
           PAGT+++AV+ PI   + D  ++      + E+                           
Sbjct: 95  PAGTKDVAVSRPIAVYVEDEADVAAFKDFTVEDAGGSQSSSAPAAEEQKEEPKKEEVKEE 154

Query: 96  IVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE 155
             E +   S+S+P  V    S +R IASPLA+ +A E GI L S+ G+GP GRI K+D+E
Sbjct: 155 KSEKKAAKSNSTPSSV---ASGDRIIASPLAKTIALEKGIALKSVKGTGPRGRITKADVE 211

Query: 156 TLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQT 215
             + +    K  ST         +  A         SYE +   N+R+ I  RL QS+Q+
Sbjct: 212 KYLESAP--KSTSTAAPSATPSTTGGA---------SYEDLEITNMRQIIGDRLLQSRQS 260

Query: 216 IPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVS 275
           IP + VS D ++  LL LR+ +N T +        K+S+NDI++KA  +A  +VP+AN  
Sbjct: 261 IPSYIVSSDISVSKLLKLRKSLNATAKDQY-----KLSINDILIKAVTVAARRVPDANSY 315

Query: 276 WTTN-AMIRH-KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKP 333
           W  N  +IR  K++D+SVAV+ P G++TPI++ A+ K +++IS EVK+LA RAK  KL P
Sbjct: 316 WLQNEGIIRQFKNVDVSVAVATPTGLLTPIVKNAESKGLIEISKEVKELASRAKINKLVP 375

Query: 334 EEYQGGTTSISNMGM-LGINSFCAVINPPQSTILAIG---------AGEKKVVFQNEEIK 383
           EE+QGGT  ISN+GM   ++ F ++INPPQSTILAIG         AG +  +  ++++ 
Sbjct: 376 EEFQGGTICISNLGMNPAVSMFTSIINPPQSTILAIGTVKRVAVEDAGAENGIAFDDQVT 435

Query: 384 VATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           +      T + DHR++DGA  +  + + K  IENP+ +L+
Sbjct: 436 I------TGTFDHRTIDGAKGADFMRELKTVIENPLQLLL 469


>gi|164661005|ref|XP_001731625.1| hypothetical protein MGL_0893 [Malassezia globosa CBS 7966]
 gi|159105526|gb|EDP44411.1| hypothetical protein MGL_0893 [Malassezia globosa CBS 7966]
          Length = 487

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 176/468 (37%), Positives = 261/468 (55%), Gaps = 59/468 (12%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +   TMP++SPTM +G +A W K+EG+  + GD+L EIETDKA ME E+ D+G++ +I+ 
Sbjct: 32  LSKFTMPAMSPTMQDGGIAAWRKKEGESFNGGDVLLEIETDKATMEVEAQDDGVLAKIIA 91

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIV------------------------- 97
            AG++N+ VNS I  I  +  ++  +  L+KE                            
Sbjct: 92  DAGSKNVPVNSTIAIIGEEGDDLSGADALAKEAESESASASAGEAEKAAKQEESAKEEES 151

Query: 98  ---EVREEHSHSSPVVVREKHSKNRPI-----------ASPLARRLAGEHGIDLSSLSGS 143
              E + E     P   + + S +              ASP+A+R+A E GI L  + GS
Sbjct: 152 KQKEAKSEE-EDKPAAPKPRESDDSGTASKLASMDHLSASPIAKRIALERGIPLLQVKGS 210

Query: 144 GPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRK 203
           GP+GRIVK D+E   S        +T  +                +  +Y   P  N+R+
Sbjct: 211 GPNGRIVKEDVEKFASGSGAAAAAATAST-----------AAAGGSAPAYTDQPLSNMRR 259

Query: 204 TIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR-TLQFHREEISN----KISVNDII 258
           TIA RL +SK T+PH+YV+ D  +  +L LRE   R + +  R + +     K+SVND I
Sbjct: 260 TIAKRLTESKSTVPHYYVTFDIEMARVLQLREVFTRASAEAARGDEAKAKQAKLSVNDFI 319

Query: 259 LKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLE 318
           +KA ALA+ QVP AN +W    +  +   DIS+AV+ P G++TPIIR      + +I  +
Sbjct: 320 VKAAALALKQVPAANSAWHGEYIREYHTQDISMAVATPNGLITPIIRNCGAIGLTEIGKQ 379

Query: 319 VKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVV-- 376
            K+LA++A+  KLKPEEYQGGT +ISNMGM+G + F A+INPPQS ILAIGA E ++V  
Sbjct: 380 SKELAKKARDGKLKPEEYQGGTFTISNMGMMGTSHFTAIINPPQSCILAIGATEARLVPD 439

Query: 377 -FQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
              ++  +   +M AT+SADHR VDGA+A++ +  FK  +ENP+  ++
Sbjct: 440 ESTDKGFRTVQVMKATISADHRVVDGALAAQWMQAFKAALENPLSFML 487


>gi|72163450|ref|YP_291107.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Thermobifida fusca YX]
 gi|71917182|gb|AAZ57084.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Thermobifida fusca YX]
          Length = 431

 Score =  297 bits (761), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 158/434 (36%), Positives = 251/434 (57%), Gaps = 22/434 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP LS TM EG ++ W+KQ GDK+S GD+L EIETDKA+ME+E+ ++G + +  V  G
Sbjct: 4   IYMPRLSDTMEEGVISSWVKQVGDKVSVGDVLVEIETDKAVMEYEAYEDGYLVQQTVREG 63

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVV--------------- 110
            E + + + ++ ++ DS +  P+ P   E   +  EE    +P                 
Sbjct: 64  -ETVPIGA-VIGVIADSPDAVPAAPEGGEGAEQKAEEPQQPAPAAQEAKEEQPTVPAPAA 121

Query: 111 VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
             E+  K RP++SPLARRLA E+G+D++ + GSGP GR+V++D+E     K   +  +  
Sbjct: 122 PAEQGGKPRPLSSPLARRLAREYGLDITKIQGSGPKGRVVRADVEAAAQQKREQEAAAPQ 181

Query: 171 QSFGLVDESIDANILNLFAK-DSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
            +         A     F    + E +P  NIR+ IA RL Q+KQ IPHFY+    + + 
Sbjct: 182 PAAAKAPAPAAAPPQPEFEDLRASEEVPVTNIRRVIARRLTQAKQEIPHFYLRRRIDAEA 241

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDI 289
           L   R Q+N  L         K+SVND+I+KA A  +   PE N SW  + ++RHK I++
Sbjct: 242 LREFRAQINEQLA----PTGVKVSVNDLIVKAVATVLRDHPEVNSSWVDDKLLRHKRINV 297

Query: 290 SVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGML 349
            +AV++  G+V P++  AD  ++ +++   + L ++A+  KL P++  GGT S+SN+GM 
Sbjct: 298 GIAVAVDTGLVVPVLHDADTLALSEVARRSRALVEKARDGKLSPQDMSGGTFSVSNLGMF 357

Query: 350 GINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLA 409
           G+ SF AVINPP++ ILA+GA +++ V ++ EI     +   LS DHR+VDGA+ +  L 
Sbjct: 358 GVESFSAVINPPEAAILAVGAMQQEPVVRDGEIVARHTIALELSVDHRAVDGAVGAAFLK 417

Query: 410 KFKEYIENPVWMLM 423
              E +E+P+ +++
Sbjct: 418 DLAEVLESPMRIVL 431


>gi|198429137|ref|XP_002128829.1| PREDICTED: similar to Dihydrolipoamide S-acetyltransferase (E2
           component of pyruvate dehydrogenase complex) [Ciona
           intestinalis]
          Length = 630

 Score =  297 bits (761), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 171/438 (39%), Positives = 256/438 (58%), Gaps = 33/438 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I +P+LSPTMT G +  W K  GDK+  GD +  IETDKA M  E  + G + +IL+  G
Sbjct: 206 ILLPALSPTMTTGTIVSWEKNVGDKVDEGDSIAVIETDKASMALEYQESGYLAKILLEEG 265

Query: 66  TENIAVNSPILNILMDSTEIPP--------SPPLSKENIVEVREEHSHSSPV-------- 109
            +++ + +P+  I+ +  +IP         S   +              +PV        
Sbjct: 266 AKDLPLGTPLCVIVTNEEDIPAFANYTATDSAAAAPAAAPTPSAPTPTKAPVSSPGIPPP 325

Query: 110 -VVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYS 168
                  S +R   SPLA++LA E GIDL++L+GSGP GRI   D++             
Sbjct: 326 TPPPATQSGDRLFVSPLAKKLAAEKGIDLATLAGSGPQGRIRAQDLDKAGKVAPVAP--- 382

Query: 169 TIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNID 228
                 LVD +  +   ++    S+  IP  NIRK  A RL +SKQTIPH+YV++D  +D
Sbjct: 383 -----ALVD-ATPSTPASIATDGSFVDIPLSNIRKVTAKRLCESKQTIPHYYVTVDVEMD 436

Query: 229 NLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHID 288
             ++LR+  N+ L+  +E I  K+SVND ++KA A+A ++VPEAN SW    + +H  +D
Sbjct: 437 KTMALRKSFNQDLE--KEGI--KVSVNDFLIKASAMACLKVPEANSSWRDTFIRQHNTVD 492

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           +S+AVS   G++TPI+  AD K +  IS +V  LA +A++ KL+P E+ GGT ++SN+GM
Sbjct: 493 MSIAVSTDTGLITPIVFDADTKGLASISQDVVALAAKAREGKLQPNEFMGGTFTLSNLGM 552

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVV-FQNEE--IKVATIMNATLSADHRSVDGAIAS 405
            G+  F A+INPPQS ILA+GA  ++ V   N E  ++ AT+++ TLS DHR VDGA+ +
Sbjct: 553 FGVKHFSAIINPPQSCILAVGAARREFVPDSNAENGMREATLVSVTLSCDHRVVDGAVGA 612

Query: 406 KLLAKFKEYIENPVWMLM 423
           + L  FK++IE+PV ML+
Sbjct: 613 QWLQHFKKFIEDPVKMLL 630



 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 56/82 (68%), Gaps = 2/82 (2%)

Query: 4   HT-ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HT + +P+LSPTM  G + KW  QEG+  S GD+L EI+TDKA + FE+ D+G + +I+ 
Sbjct: 77  HTKMLLPALSPTMESGSIVKWEIQEGESFSAGDLLAEIKTDKATVGFEANDDGFMAKIIA 136

Query: 63  PAGTENIAVNSPILNILMDSTE 84
             GT++I + + ++ I +D+ E
Sbjct: 137 QDGTDDIPLGT-LVAISVDTEE 157


>gi|320160832|ref|YP_004174056.1| putative pyruvate dehydrogenase E2 component [Anaerolinea
           thermophila UNI-1]
 gi|319994685|dbj|BAJ63456.1| putative pyruvate dehydrogenase E2 component [Anaerolinea
           thermophila UNI-1]
          Length = 427

 Score =  296 bits (759), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 173/446 (38%), Positives = 256/446 (57%), Gaps = 43/446 (9%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M  TI MP L   M EG L +W++QEG+ +  G +L EIETDKA +E E+   GI+   L
Sbjct: 1   MAETIKMPKLGFDMQEGTLVRWVRQEGEAVEKGQVLAEIETDKATVEVEASVSGIVHRHL 60

Query: 62  VPAGTENIAVNSPILNILMDS---TEIPPSPPLSKENIVEVREEH--SHSSPVVVREKHS 116
           V  G   + V +PI  I        E P +  L  +N+ E  E+   S + P V  E+  
Sbjct: 61  VEQGA-VVPVGTPIAIIAAPGETVAEEPVAGVLPAKNVEEAAEKEAVSLAQPSVSGEEQ- 118

Query: 117 KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST-KTNVKDYSTI----- 170
             R  ASPLA+RLA EH +DL+++ GSGP GRIV+ DIE  ++  +T V     +     
Sbjct: 119 --RIKASPLAKRLAKEHQVDLNAVQGSGPGGRIVRKDIEAYLAMIRTAVPQAVEVPIPTP 176

Query: 171 ---------QSFGL----VDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIP 217
                      F L      ES+ A+          E +P D +R+ I  R+  SKQ  P
Sbjct: 177 SVSTSPAPSSGFTLPVWTAPESVPAD----------ETVPMDRLRQAIGRRMVDSKQNYP 226

Query: 218 HFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWT 277
           HFY++   N++ L++LREQ+N+ +         K+++ND ++KA ALA+   P  N S +
Sbjct: 227 HFYITRSFNVEALMALREQINQVMPE-----GQKLTLNDFVIKAVALALRSYPNLNASIS 281

Query: 278 TNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQ 337
            NA++RH  ++I VAV++ GG++T + + ADQK +  IS E++ +  RA+Q K++PE+ +
Sbjct: 282 GNAILRHGRVNIGVAVAVEGGLLTVVCKDADQKPLRVISSEIRDMVSRARQGKVRPEDIE 341

Query: 338 GGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHR 397
           G T SISN+GM  + +F A+INPP+S ILA+GA +K  V   +EIK    M ATLSADHR
Sbjct: 342 GSTFSISNLGMFDVENFMAIINPPESGILAVGAAQKVPVVVGDEIKTGLRMKATLSADHR 401

Query: 398 SVDGAIASKLLAKFKEYIENPVWMLM 423
             DGA A++ +     Y+ENP+ +L+
Sbjct: 402 VTDGAEAAQFMQVLARYLENPILLLV 427


>gi|559395|emb|CAA86300.1| dihydrolipoamide acetyltransferase (E2) subunit of PDC [Arabidopsis
           thaliana]
          Length = 610

 Score =  296 bits (759), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 178/435 (40%), Positives = 266/435 (61%), Gaps = 29/435 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G +AKW K+EGDKI  GD++ EIETDKA +EFES++EG + +IL+P G
Sbjct: 188 LEMPALSPTMNQGNIAKWWKKEGDKIEVGDVIGEIETDKATLEFESLEEGYLAKILIPEG 247

Query: 66  TENIAVNSPILNILMD--STEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP--- 120
           ++++AV  PI  I+ D  S E   S       +  V+E      P  V +K ++ +    
Sbjct: 248 SKDVAVGKPIALIVEDAESIEAIKSSSAGSSEVDTVKE-----VPDSVVDKPTERKAGFT 302

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
             SP A+ L  EHG++ SS+  SGP+G ++KSD+   I++    K  ++ +      E+ 
Sbjct: 303 KISPAAKLLILEHGLEASSIEASGPYGTLLKSDVVAAIASGKASKSSASTKKKQPSKETP 362

Query: 181 DANILNLF-----AKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLRE 235
             +          + ++YE  P+  IRK IA RL +SKQ IPH Y+  D  +D LL+ R+
Sbjct: 363 SKSSSTSKPSVTQSDNNYEDFPNSQIRKIIAKRLLESKQKIPHLYLQSDVVLDPLLAFRK 422

Query: 236 QMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA--MIRHKHIDISVAV 293
           ++       +E    K+SVNDI++KA A+A+  V +AN  W      ++    +DIS+AV
Sbjct: 423 EL-------QENHGVKVSVNDIVIKAVAVALRNVRQANAFWDAEKGDIVMCDSVDISIAV 475

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
           +   G++TPII+ ADQKSI  ISLEVK+LAQ+A+  KL P E+QGGT SISN+GM  +++
Sbjct: 476 ATEKGLMTPIIKNADQKSISAISLEVKELAQKARSGKLAPHEFQGGTFSISNLGMYPVDN 535

Query: 354 FCAVINPPQSTILAIGAGEKKV--VFQNEEIK---VATIMNATLSADHRSVDGAIASKLL 408
           FCA+INPPQ+ ILA+G G K+V  V   + I+   V T MN TLSADHR  DG + +  +
Sbjct: 536 FCAIINPPQAGILAVGRGNKEVEPVIGLDGIEKPCVVTKMNVTLSADHRIFDGQVGASFM 595

Query: 409 AKFKEYIENPVWMLM 423
           ++ +   E+   +L+
Sbjct: 596 SELRSNFEDVRRLLL 610



 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 90/149 (60%), Gaps = 8/149 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM+ G + KW+K+EGDK+  GD+LCEIETDKA +EFES +EG + +ILV  G
Sbjct: 61  LAMPALSPTMSHGNVVKWMKKEGDKVEVGDVLCEIETDKATVEFESQEEGFLAKILVTEG 120

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREE---HSHSSPVVVREKHSKNRPIA 122
           +++I VN PI  ++ +  +I  + P + E   + +EE   H    P    ++ S  +P A
Sbjct: 121 SKDIPVNEPIAIMVEEEDDI-KNVPATIEGGRDGKEETSAHQVMKPDESTQQKSSIQPDA 179

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVK 151
           S L   +     +++ +LS +   G I K
Sbjct: 180 SDLPPHVV----LEMPALSPTMNQGNIAK 204


>gi|110737396|dbj|BAF00642.1| dihydrolipoamide S-acetyltransferase precursor [Arabidopsis
           thaliana]
          Length = 637

 Score =  296 bits (758), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 177/441 (40%), Positives = 266/441 (60%), Gaps = 41/441 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G +AKW K+EGDKI  GD++ EIETDKA +EFES++EG + +IL+P G
Sbjct: 215 LEMPALSPTMNQGNIAKWWKKEGDKIEVGDVIGEIETDKATLEFESLEEGYLAKILIPEG 274

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPV-VVREKHSK--NRPIA 122
           ++++AV  PI  I+ D+           E+I  ++   + SS V  V+E      ++P  
Sbjct: 275 SKDVAVGKPIALIVEDA-----------ESIEAIKSSSAGSSEVDTVKEVPDSVVDKPTE 323

Query: 123 --------SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFG 174
                   SP A+ L  EHG++ SS+  SGP+G ++KSD+   I++    K  ++ +   
Sbjct: 324 RKAGFTKISPAAKLLILEHGLEASSIEASGPYGTLLKSDVVAAIASGKASKSSASTKKKQ 383

Query: 175 LVDESIDANILNLF-----AKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
              E+   +          + ++YE  P+  IRK IA RL +SKQ IPH Y+  D  +D 
Sbjct: 384 PSKETPSKSSSTSKPSVTQSDNNYEDFPNSQIRKIIAKRLLESKQKIPHLYLQSDVVLDP 443

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA--MIRHKHI 287
           LL+ R+++       +E    K+SVNDI++KA A+A+  V +AN  W      ++    +
Sbjct: 444 LLAFRKEL-------QENHGVKVSVNDIVIKAVAVALRNVRQANAFWDAEKGDIVMCDSV 496

Query: 288 DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMG 347
           DIS+AV+   G++TPII+ ADQKSI  ISLEVK+LAQ+A+  KL P E+QGGT SISN+G
Sbjct: 497 DISIAVATEKGLMTPIIKNADQKSISAISLEVKELAQKARSGKLAPHEFQGGTFSISNLG 556

Query: 348 MLGINSFCAVINPPQSTILAIGAGEKKV-----VFQNEEIKVATIMNATLSADHRSVDGA 402
           M  +++FCA+INPPQ+ ILA+G G K V     +   E+  V T MN TLSADHR  DG 
Sbjct: 557 MYPVDNFCAIINPPQAGILAVGRGNKVVEPVIGLDGIEKPSVVTKMNVTLSADHRIFDGQ 616

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + +  +++ +   E+   +L+
Sbjct: 617 VGASFMSELRSNFEDVRRLLL 637



 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 90/149 (60%), Gaps = 8/149 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM+ G + KW+K+EGDK+  GD+LCEIETDKA +EFES +EG + +ILV  G
Sbjct: 88  LAMPALSPTMSHGNVVKWMKKEGDKVEVGDVLCEIETDKATVEFESQEEGFLAKILVTEG 147

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREE---HSHSSPVVVREKHSKNRPIA 122
           +++I VN PI  ++ +  +I  + P + E   + +EE   H    P    ++ S  +P A
Sbjct: 148 SKDIPVNEPIAIMVEEEDDI-KNVPATIEGGRDGKEETSAHQVMKPDESTQQKSSIQPDA 206

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVK 151
           S L   +     +++ +LS +   G I K
Sbjct: 207 SDLPPHVV----LEMPALSPTMNQGNIAK 231


>gi|15231159|ref|NP_190788.1| LTA3; ATP binding / dihydrolipoyllysine-residue acetyltransferase
           [Arabidopsis thaliana]
 gi|117940179|sp|Q0WQF7|OPD21_ARATH RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component 1 of pyruvate dehydrogenase complex,
           mitochondrial; AltName: Full=Dihydrolipoamide
           S-acetyltransferase component 1 of pyruvate
           dehydrogenase complex; AltName: Full=Pyruvate
           dehydrogenase complex component E2 1; Short=PDC-E2 1;
           Short=PDCE2 1; Flags: Precursor
 gi|4678949|emb|CAB41340.1| dihydrolipoamide S-acetyltransferase precursor [Arabidopsis
           thaliana]
 gi|332645391|gb|AEE78912.1| dihydrolipoyllysine-residue acetyltransferase component 1 of
           pyruvate dehydrogenase complex [Arabidopsis thaliana]
          Length = 637

 Score =  296 bits (758), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 177/441 (40%), Positives = 266/441 (60%), Gaps = 41/441 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G +AKW K+EGDKI  GD++ EIETDKA +EFES++EG + +IL+P G
Sbjct: 215 LEMPALSPTMNQGNIAKWWKKEGDKIEVGDVIGEIETDKATLEFESLEEGYLAKILIPEG 274

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPV-VVREKHSK--NRPIA 122
           ++++AV  PI  I+ D+           E+I  ++   + SS V  V+E      ++P  
Sbjct: 275 SKDVAVGKPIALIVEDA-----------ESIEAIKSSSAGSSEVDTVKEVPDSVVDKPTE 323

Query: 123 --------SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFG 174
                   SP A+ L  EHG++ SS+  SGP+G ++KSD+   I++    K  ++ +   
Sbjct: 324 RKAGFTKISPAAKLLILEHGLEASSIEASGPYGTLLKSDVVAAIASGKASKSSASTKKKQ 383

Query: 175 LVDESIDANILNLF-----AKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
              E+   +          + ++YE  P+  IRK IA RL +SKQ IPH Y+  D  +D 
Sbjct: 384 PSKETPSKSSSTSKPSVTQSDNNYEDFPNSQIRKIIAKRLLESKQKIPHLYLQSDVVLDP 443

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA--MIRHKHI 287
           LL+ R+++       +E    K+SVNDI++KA A+A+  V +AN  W      ++    +
Sbjct: 444 LLAFRKEL-------QENHGVKVSVNDIVIKAVAVALRNVRQANAFWDAEKGDIVMCDSV 496

Query: 288 DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMG 347
           DIS+AV+   G++TPII+ ADQKSI  ISLEVK+LAQ+A+  KL P E+QGGT SISN+G
Sbjct: 497 DISIAVATEKGLMTPIIKNADQKSISAISLEVKELAQKARSGKLAPHEFQGGTFSISNLG 556

Query: 348 MLGINSFCAVINPPQSTILAIGAGEKKV-----VFQNEEIKVATIMNATLSADHRSVDGA 402
           M  +++FCA+INPPQ+ ILA+G G K V     +   E+  V T MN TLSADHR  DG 
Sbjct: 557 MYPVDNFCAIINPPQAGILAVGRGNKVVEPVIGLDGIEKPSVVTKMNVTLSADHRIFDGQ 616

Query: 403 IASKLLAKFKEYIENPVWMLM 423
           + +  +++ +   E+   +L+
Sbjct: 617 VGASFMSELRSNFEDVRRLLL 637



 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 90/149 (60%), Gaps = 8/149 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM+ G + KW+K+EGDK+  GD+LCEIETDKA +EFES +EG + +ILV  G
Sbjct: 88  LAMPALSPTMSHGNVVKWMKKEGDKVEVGDVLCEIETDKATVEFESQEEGFLAKILVTEG 147

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREE---HSHSSPVVVREKHSKNRPIA 122
           +++I VN PI  ++ +  +I  + P + E   + +EE   H    P    ++ S  +P A
Sbjct: 148 SKDIPVNEPIAIMVEEEDDI-KNVPATIEGGRDGKEETSAHQVMKPDESTQQKSSIQPDA 206

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVK 151
           S L   +     +++ +LS +   G I K
Sbjct: 207 SDLPPHVV----LEMPALSPTMNQGNIAK 231


>gi|194762262|ref|XP_001963271.1| GF15860 [Drosophila ananassae]
 gi|190616968|gb|EDV32492.1| GF15860 [Drosophila ananassae]
          Length = 513

 Score =  296 bits (758), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 164/448 (36%), Positives = 246/448 (54%), Gaps = 47/448 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +  W K+EGDK++ GD+LCEIETDKA M FE+ +EG + +IL+P G
Sbjct: 83  VPLPALSPTMERGSIVSWEKKEGDKLNEGDLLCEIETDKATMGFETPEEGYLAKILIPGG 142

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKH---------- 115
           T+++ V   +  I+ D   +        +           ++P                 
Sbjct: 143 TKDVPVGKLLCIIVPDQGSVAAFKDFKDDGPAPAAAAPPPAAPAAAPAPAAAPAPAPAAA 202

Query: 116 -----------------SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI 158
                               R  ASP+A++LA    + L    GSG HG I   D+    
Sbjct: 203 PAPAAPAPAPAAAPAAAGTGRVYASPMAKKLAEAQQLRLQG-KGSGVHGSIKSGDLAAQK 261

Query: 159 STKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPH 218
           S            +                A   Y+ IP  N+R  IA RL +SK  +PH
Sbjct: 262 SGAKAAAAAPAGPA------------PPAPAGARYQDIPVTNMRAIIAKRLLESKTQLPH 309

Query: 219 FYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTT 278
           +YV++ C +D L+  R Q+N+      E+   ++SVND I+KA A+A ++VPEAN +W  
Sbjct: 310 YYVTVQCQVDKLMKFRAQVNKKY----EKKGVRVSVNDFIIKATAIASLKVPEANSAWMG 365

Query: 279 NAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQG 338
             + ++  +D+SVAVS   G++TPI+  AD+K +++IS  VK+LA +A++ KLKP+E+QG
Sbjct: 366 QVIRQYDDVDVSVAVSTDKGLITPIVFNADRKGVIEISKNVKELAGKARENKLKPQEFQG 425

Query: 339 GTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE---IKVATIMNATLSAD 395
           GT S+SN+GM G+N FCAVINPPQS ILAIG   K++V   +     K   ++  TLSAD
Sbjct: 426 GTISVSNLGMFGVNQFCAVINPPQSCILAIGTTTKQLVADPDSPKGFKEVNLLTVTLSAD 485

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR VDGA+A++ L  F++Y+E+P  M++
Sbjct: 486 HRVVDGAVAARWLQHFRDYMEDPASMIL 513


>gi|17560088|ref|NP_506579.1| hypothetical protein F23B12.5 [Caenorhabditis elegans]
 gi|74964045|sp|Q19749|ODP2_CAEEL RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component of pyruvate dehydrogenase complex,
           mitochondrial; AltName: Full=Dihydrolipoamide
           acetyltransferase component of pyruvate dehydrogenase
           complex; AltName: Full=Pyruvate dehydrogenase complex
           component E2; Short=PDC-E2; Short=PDCE2; Flags:
           Precursor
 gi|3876313|emb|CAB01163.1| C. elegans protein F23B12.5, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 507

 Score =  296 bits (758), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 179/447 (40%), Positives = 258/447 (57%), Gaps = 48/447 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +  W K+EGD++S GD+LCEIETDKA M FE+ +EG + +IL+  G
Sbjct: 80  VALPALSPTMELGTVVSWQKKEGDQLSEGDLLCEIETDKATMGFETPEEGYLAKILIQEG 139

Query: 66  TENIAVNSPILNILMD-----------------------STEIPPSPPLSKENIVEVREE 102
           ++++ +   +L I++D                       + E  P P     +       
Sbjct: 140 SKDVPIGK-LLCIIVDNEADVAAFKDFKDDGASSGGSAPAAEKAPEPAKPAASSQPSPPA 198

Query: 103 HSHSSPVVVREK----HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI 158
             + +P V +       S  R  ASP A++LA E+G+DLS +SGSGP GRI+ SD+    
Sbjct: 199 QMYQAPSVPKSAPIPHSSSGRVSASPFAKKLAAENGLDLSGVSGSGPGGRILASDL---- 254

Query: 159 STKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPH 218
                    S   + G    +  A      +   Y  IP  N+RKTIA RL +SK TIPH
Sbjct: 255 ---------SQAPAKGATSTTTQA-----VSGQDYTDIPLSNMRKTIAKRLTESKSTIPH 300

Query: 219 FYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTT 278
           +Y++ +  +D LL +RE++N  L       + KIS+ND I+KA ALA  +VPEAN  W  
Sbjct: 301 YYLTSEIQLDTLLQVREKLNGLLAKGTSGQATKISINDFIIKASALACQRVPEANSYWMD 360

Query: 279 NAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQG 338
           + +  + H+D+SVAVS P G++TPII  A  K +  I+ E+ +LAQRA++ KL+P E+QG
Sbjct: 361 SFIRENHHVDVSVAVSTPAGLITPIIFNAHAKGLATIASEIVELAQRAREGKLQPHEFQG 420

Query: 339 GTTSISNMGMLG-INSFCAVINPPQSTILAIGAGEKKVV-FQNEEIKVATIMNATLSADH 396
           GT ++SN+GM G ++ F A+INPPQS ILAIG    K+V  + E  K    M  TLS DH
Sbjct: 421 GTFTVSNLGMFGSVSDFTAIINPPQSCILAIGGASDKLVPDEAEGYKKIKTMKVTLSCDH 480

Query: 397 RSVDGAIASKLLAKFKEYIENPVWMLM 423
           R+VDGA+ +  L  FKE++E P  ML+
Sbjct: 481 RTVDGAVGAVWLRHFKEFLEKPHTMLL 507


>gi|332645392|gb|AEE78913.1| dihydrolipoyllysine-residue acetyltransferase component 1 of
           pyruvate dehydrogenase complex [Arabidopsis thaliana]
          Length = 713

 Score =  296 bits (758), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 177/435 (40%), Positives = 264/435 (60%), Gaps = 29/435 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM +G +AKW K+EGDKI  GD++ EIETDKA +EFES++EG + +IL+P G
Sbjct: 291 LEMPALSPTMNQGNIAKWWKKEGDKIEVGDVIGEIETDKATLEFESLEEGYLAKILIPEG 350

Query: 66  TENIAVNSPILNILMD--STEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP--- 120
           ++++AV  PI  I+ D  S E   S       +  V+E      P  V +K ++ +    
Sbjct: 351 SKDVAVGKPIALIVEDAESIEAIKSSSAGSSEVDTVKE-----VPDSVVDKPTERKAGFT 405

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
             SP A+ L  EHG++ SS+  SGP+G ++KSD+   I++    K  ++ +      E+ 
Sbjct: 406 KISPAAKLLILEHGLEASSIEASGPYGTLLKSDVVAAIASGKASKSSASTKKKQPSKETP 465

Query: 181 DANILNLF-----AKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLRE 235
             +          + ++YE  P+  IRK IA RL +SKQ IPH Y+  D  +D LL+ R+
Sbjct: 466 SKSSSTSKPSVTQSDNNYEDFPNSQIRKIIAKRLLESKQKIPHLYLQSDVVLDPLLAFRK 525

Query: 236 QMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA--MIRHKHIDISVAV 293
           ++       +E    K+SVNDI++KA A+A+  V +AN  W      ++    +DIS+AV
Sbjct: 526 EL-------QENHGVKVSVNDIVIKAVAVALRNVRQANAFWDAEKGDIVMCDSVDISIAV 578

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
           +   G++TPII+ ADQKSI  ISLEVK+LAQ+A+  KL P E+QGGT SISN+GM  +++
Sbjct: 579 ATEKGLMTPIIKNADQKSISAISLEVKELAQKARSGKLAPHEFQGGTFSISNLGMYPVDN 638

Query: 354 FCAVINPPQSTILAIGAGEKKV-----VFQNEEIKVATIMNATLSADHRSVDGAIASKLL 408
           FCA+INPPQ+ ILA+G G K V     +   E+  V T MN TLSADHR  DG + +  +
Sbjct: 639 FCAIINPPQAGILAVGRGNKVVEPVIGLDGIEKPSVVTKMNVTLSADHRIFDGQVGASFM 698

Query: 409 AKFKEYIENPVWMLM 423
           ++ +   E+   +L+
Sbjct: 699 SELRSNFEDVRRLLL 713



 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 91/146 (62%), Gaps = 2/146 (1%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM+ G + KW+K+EGDK+  GD+LCEIETDKA +EFES +EG + +ILV  G
Sbjct: 164 LAMPALSPTMSHGNVVKWMKKEGDKVEVGDVLCEIETDKATVEFESQEEGFLAKILVTEG 223

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASPL 125
           +++I VN PI  ++ +  +I  + P + E   + +EE S +  V+  ++ ++ +    P 
Sbjct: 224 SKDIPVNEPIAIMVEEEDDI-KNVPATIEGGRDGKEETS-AHQVMKPDESTQQKSSIQPD 281

Query: 126 ARRLAGEHGIDLSSLSGSGPHGRIVK 151
           A  L     +++ +LS +   G I K
Sbjct: 282 ASDLPPHVVLEMPALSPTMNQGNIAK 307


>gi|89890164|ref|ZP_01201675.1| dihydrolipoyllysine-residue acetyltransferase [Flavobacteria
           bacterium BBFL7]
 gi|89518437|gb|EAS21093.1| dihydrolipoyllysine-residue acetyltransferase [Flavobacteria
           bacterium BBFL7]
          Length = 539

 Score =  296 bits (757), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 171/443 (38%), Positives = 256/443 (57%), Gaps = 54/443 (12%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGI--------- 56
           +TMP LS TM EG +A W+K EGD +  GDIL EIETDKA MEFES +EG          
Sbjct: 126 VTMPRLSDTMEEGTVASWLKSEGDTVEEGDILAEIETDKATMEFESFNEGTLLKIGIQEG 185

Query: 57  ----IDEILV---PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREE-HSHSSP 108
               +D +L    PAGT+   +N       ++++   P+P   ++ +   + E     +P
Sbjct: 186 ETAKVDALLAIIGPAGTDVSGIN-------LEASAKAPAPKKEEKKVEAPKAEPKKDKAP 238

Query: 109 VVVREKHSK--------NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST 160
           V      +          R  ASPLA+++A + GIDLS +SGSG +GRIVKSDI   ++ 
Sbjct: 239 VAASSSSNANSSSSSKGGRIFASPLAKKMADDKGIDLSQVSGSGENGRIVKSDI---VNF 295

Query: 161 KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
           K +    ++  SF  V              +++E +P+  +RKTIA RL +SK T PH+Y
Sbjct: 296 KPSAGGSASASSFVAV------------GTETFEEVPNSQMRKTIAKRLGESKFTAPHYY 343

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           + +D ++DN ++ R+ +N       E    KIS ND+++KA A+A+   P+ N  WT   
Sbjct: 344 LGLDLDMDNAIASRKAIN-------ELPDTKISFNDMVIKAAAMALRLHPKVNTQWTDKN 396

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
            I  KHI + VAV++  G++ P++  ADQ S+  I  +V++LA +A+ +KL+P+E QG T
Sbjct: 397 TIVAKHIHVGVAVAVDDGLLVPVLPFADQMSMQQIGAKVRELAGKARNKKLQPDEMQGST 456

Query: 341 TSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVD 400
            +ISN+GM GI  F ++IN P S I+++GA  +K V +N +I V  +M  TL+ DHR+VD
Sbjct: 457 FTISNLGMFGITEFTSIINQPNSAIMSVGAIVQKPVVKNGQIVVGNVMKITLACDHRTVD 516

Query: 401 GAIASKLLAKFKEYIENPVWMLM 423
           GA  +  L  FK YIENP+ M +
Sbjct: 517 GATGAAFLQTFKSYIENPIVMYV 539



 Score = 73.9 bits (180), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 42/64 (65%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   + MP LS TM EG +A W+K  GDK+  GDIL EIETDKA MEFES  EG++  I 
Sbjct: 1  MAEIVNMPRLSDTMEEGVVAAWLKNVGDKVEEGDILAEIETDKATMEFESFQEGVLLHIG 60

Query: 62 VPAG 65
          V  G
Sbjct: 61 VQEG 64


>gi|255083889|ref|XP_002508519.1| dihydrolipoamide s-acetyltransferase of the pyruvate dehydrogenase
           [Micromonas sp. RCC299]
 gi|226523796|gb|ACO69777.1| dihydrolipoamide s-acetyltransferase of the pyruvate dehydrogenase
           [Micromonas sp. RCC299]
          Length = 401

 Score =  295 bits (755), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 166/423 (39%), Positives = 257/423 (60%), Gaps = 29/423 (6%)

Query: 8   MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTE 67
           MP+LSPTMT+G +A+W    GDK++ GD++ +IETDKA M  ES+++G + +ILVPAG  
Sbjct: 1   MPALSPTMTQGNIAEWKIAAGDKVNAGDVIADIETDKATMALESMEDGYVAKILVPAGAT 60

Query: 68  NIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHS-----HSSPVVVREKHSKNRPIA 122
           ++ V   ++ I++D           +EN      + +      ++    R   S +R  A
Sbjct: 61  DVKVGE-LVAIMVD-----------EENDCAKFADFTPGAAAPAAAAAPRAAPSGSRVFA 108

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
           SP AR +A   G+ +  ++G+GP+GR+V +D++T I  +  V   +T+ S    D S  A
Sbjct: 109 SPKARAMAEAAGVAIERIAGTGPNGRVVMADVQTAI--RDGVPS-ATVASATSGDTS--A 163

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
                F    +E +    I+K  A RL +SK+T+PHFY+S+D  +D L+++R  +N  LQ
Sbjct: 164 GFAKFFPP--FEDVSVSTIKKVTAQRLTESKRTVPHFYLSVDVRMDRLMAMRSSLNGALQ 221

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
               +  +KISVND ++KA AL++ +VP+ N SW  + + R++  DISVAV    G++ P
Sbjct: 222 ---SDGGSKISVNDFVVKASALSLKKVPDVNASWMGDKIRRYQKADISVAVQTDLGLMVP 278

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R A    +  IS EV+ LA +AK  KL   +  GGT +ISN+GM GI  F A++NPPQ
Sbjct: 279 VVRGACGLGLSGISGEVRLLAGKAKDGKLSATDMIGGTFTISNLGMFGIKQFAAIVNPPQ 338

Query: 363 STILAIGAGEKKVVFQNE--EIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           + ILA+GA  K+VV + +    + A +M+ATLS DHR VDGA+ ++ L  FK Y+E+PV 
Sbjct: 339 AAILAVGAARKEVVKKADGSGYEEALMMSATLSCDHRVVDGAVGAQWLGAFKSYMEDPVT 398

Query: 421 MLM 423
           ML+
Sbjct: 399 MLL 401


>gi|213405199|ref|XP_002173371.1| pyruvate dehydrogenase protein X component [Schizosaccharomyces
           japonicus yFS275]
 gi|212001418|gb|EEB07078.1| pyruvate dehydrogenase protein X component [Schizosaccharomyces
           japonicus yFS275]
          Length = 481

 Score =  295 bits (755), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 172/443 (38%), Positives = 251/443 (56%), Gaps = 37/443 (8%)

Query: 4   HTI-TMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HTI  +P+LSPTM+EG +  + K  GDKI  GD+LCEIETDKA M+FE  +EG + +I +
Sbjct: 53  HTIINVPALSPTMSEGNIGAYHKAIGDKIEVGDVLCEIETDKAQMDFEQQEEGYLAKIFI 112

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKEN----------IVEVREEHSHSSPVVVR 112
            +G +N+ V  P+   + D  ++P       E+                +   + P    
Sbjct: 113 ESGAQNVPVGVPLCLTVDDPEDVPAFADFKLEDAKPEEAAAAPASSEAPKTEAAEPAKAT 172

Query: 113 EKH---------SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
           E           + +R  ASP+AR+LA E  I+L+ +  SGP+GR++KSD+  L      
Sbjct: 173 ENAPASSETGAAAGDRIFASPIARKLAAEKNINLADVKASGPNGRVIKSDV--LGFQPAE 230

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
           VK                A    + A   Y+ IP  N+RK IA RL +SK   PH+YV++
Sbjct: 231 VKQAPAQAQ-------AQAPAAQVAAAAEYDDIPLTNMRKIIASRLSESKNVNPHYYVTV 283

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
             N+D +L LR  +N            K+SVND+I+KA A A+ QVPEAN +W  + + +
Sbjct: 284 SLNMDKILRLRTALNAMADGRY-----KLSVNDMIIKATAAALRQVPEANSAWMGDFIRQ 338

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
           +K +DIS+AV+   G++TP+I+ A    + +IS + K L  RA+  KL PEEYQGGT +I
Sbjct: 339 YKTVDISMAVATATGLLTPVIKGAQALGLSEISQKAKDLGLRARDNKLSPEEYQGGTFTI 398

Query: 344 SNMGMLGINSFCAVINPPQSTILAIGAGEKKVV---FQNEEIKVATIMNATLSADHRSVD 400
           SN+GM  I  F ++INPPQ+ ILA+G   + VV      +  K+A IM  TLSADHR VD
Sbjct: 399 SNLGMFPIEHFTSIINPPQACILAVGTTTETVVPDATSEKGFKIAPIMKCTLSADHRVVD 458

Query: 401 GAIASKLLAKFKEYIENPVWMLM 423
           GAIA++  +  K+ +ENP+ +L+
Sbjct: 459 GAIAARFTSALKKVVENPLELLL 481


>gi|196010185|ref|XP_002114957.1| hypothetical protein TRIADDRAFT_50632 [Trichoplax adhaerens]
 gi|190582340|gb|EDV22413.1| hypothetical protein TRIADDRAFT_50632 [Trichoplax adhaerens]
          Length = 408

 Score =  295 bits (755), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 173/434 (39%), Positives = 244/434 (56%), Gaps = 51/434 (11%)

Query: 15  MTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSP 74
           M  G L  W K EGD++  GD+L  IETDKA M++E+ + G + +I+ P GT++I V   
Sbjct: 1   MQMGTLLSWEKAEGDELEDGDLLASIETDKATMDWETPEAGYLAKIVTPEGTKDIPVGKL 60

Query: 75  ILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVV---VREKHSK-------------- 117
           +  I+ +  +I        E   EV E  S SS  V    R +  K              
Sbjct: 61  VCIIVENKEDINAFKDFKDEG-GEVTEAVSVSSETVHEPARSQEEKPMQQSVDTTSAKSA 119

Query: 118 -----NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQS 172
                +R  ASPLAR +A E G+DL+S++GSGP G+I K D+    ST T      +   
Sbjct: 120 LTPAGDRIFASPLARSIASEQGVDLASIAGSGPGGQIRKDDVLNFASTPTTTAAPPS--- 176

Query: 173 FGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232
                            +  Y  IP   +RK IA RL +SKQTIPH+Y+++D N+D +LS
Sbjct: 177 -----------------EAQYVDIPISGVRKIIANRLSESKQTIPHYYLTVDINVDEILS 219

Query: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVA 292
           LR++ N     +      K+SVND ++KA AL+M +VPE N SW    + ++K +D+SVA
Sbjct: 220 LRKRFNDMANGNY-----KLSVNDFVVKAAALSMKEVPEVNSSWHDTYIRQYKGVDVSVA 274

Query: 293 VSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGIN 352
           V    G++TPII  A  K +  IS +V  LA RA++ KLKPEE+QGGT +ISN+GM GI 
Sbjct: 275 VDTGTGLITPIIFDAHNKGLSSISSDVTSLALRARENKLKPEEFQGGTFTISNLGMFGIK 334

Query: 353 SFCAVINPPQSTILAIGAGEKKVVFQNE---EIKVATIMNATLSADHRSVDGAIASKLLA 409
            F A+INPPQ+ ILA+G  EK+++  N+       AT M+ TLS DHR VDGA  ++ L+
Sbjct: 335 QFTAIINPPQACILAVGTTEKRMIPDNDVESGYSTATFMSVTLSCDHRIVDGATGARWLS 394

Query: 410 KFKEYIENPVWMLM 423
            F+  +E P  ML+
Sbjct: 395 VFRSLMEKPETMLL 408


>gi|458426|gb|AAA16511.1| dihydrolipoamide acetyltransferase [Dictyostelium discoideum]
          Length = 592

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 169/440 (38%), Positives = 248/440 (56%), Gaps = 35/440 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVD-EGIIDEILVPA 64
           + MP+LSP+M  G +A W K+EGD+I  GD + E+ETDKA M+F+  D  G + +ILVP 
Sbjct: 166 VGMPALSPSMETGGIASWTKKEGDQIKAGDAIAEVETDKATMDFQYEDGNGYLAKILVPG 225

Query: 65  GTENIAVNSPILNILMDSTEIPPSPPLS-----------------KENIVEVREEHSHSS 107
           GT  I +N P+  I+ +  +       S                   +    +E     S
Sbjct: 226 GTSGIQINQPVCIIVKNKEDCDKFADYSVEEQSSSSSSSSQESTPSSSSSSSQESTPSQS 285

Query: 108 PVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDY 167
                 + S  R  A+P AR  A   G DLS+++G+GP+ RI+K+D+   +  K  V   
Sbjct: 286 SSQQTTRKSGERIFATPAARFEASSKGYDLSAINGTGPNNRILKADVLEFVPQKQEVAQQ 345

Query: 168 STIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNI 227
              Q+      +         +   +  IPH NIRK  A RL +SKQTIPH+Y++++C +
Sbjct: 346 QQQQT-----TTTTKKPTTPTSSGEFTDIPHSNIRKVTAARLTESKQTIPHYYLTMECRV 400

Query: 228 DNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI 287
           D LL LR ++N            KISVND I+KA   A+   P  N +WT   + R+ +I
Sbjct: 401 DKLLKLRSELNAMNTV-------KISVNDFIVKASLPALRDNPVVNSTWTDQFIRRYHNI 453

Query: 288 DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMG 347
           DI+VAV+ P G+ TPI+R  D K +  IS  VKQLA++A+  KL P E++ GT +ISN+G
Sbjct: 454 DINVAVNTPQGLFTPIVRGVDMKGLNSISTSVKQLAEKAQNGKLHPSEFESGTFTISNLG 513

Query: 348 MLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE----IKVATIMNATLSADHRSVDGAI 403
           MLGI  F AVINPPQ+ ILA+   +K V F + +     + ATI++ TLS DHR +DGA+
Sbjct: 514 MLGIKQFAAVINPPQAAILAL-VPQKLVSFLSNKPDSPYETATILSVTLSCDHRVIDGAV 572

Query: 404 ASKLLAKFKEYIENPVWMLM 423
            ++ L  FK+Y+ENP+ +++
Sbjct: 573 GAEWLKSFKDYVENPIKLIL 592



 Score = 80.1 bits (196), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 67/112 (59%), Gaps = 8/112 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSP+MT G + +W K+EGD+I  GD++ E+ETDKA M+      G + +IL+P G
Sbjct: 44  ITMPALSPSMTVGNIVQWKKKEGDQIKAGDVIREVETDKATMDSYEDGNGYLAKILIPEG 103

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK 117
           T+ I +N PI  I+    +I        E+ V+  +  S +S   V+E+  K
Sbjct: 104 TKGIEINKPIAIIVSKKEDI--------ESAVKNYKPSSQASSTPVQEEAPK 147


>gi|308500976|ref|XP_003112673.1| hypothetical protein CRE_30653 [Caenorhabditis remanei]
 gi|308267241|gb|EFP11194.1| hypothetical protein CRE_30653 [Caenorhabditis remanei]
          Length = 507

 Score =  293 bits (750), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 179/449 (39%), Positives = 259/449 (57%), Gaps = 50/449 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +  W K+EGD++S GD+LCEIETDKA M FE+ +EG + +IL+  G
Sbjct: 78  VALPALSPTMELGTVVSWQKKEGDQLSEGDLLCEIETDKATMGFETPEEGYLAKILIQEG 137

Query: 66  TENIAVNSPILNILMD----------------------STEIPPSPPLSKENIVEVREEH 103
           +++I +   +L I+++                      S E  P  P   ++        
Sbjct: 138 SKDIPIGK-LLCIIVESEADVAAFKDFTDDGSSAGGAPSAEKAPEQPKKAQSSPPAAASP 196

Query: 104 S---HSSPVVVRE----KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIET 156
               + +P + +       S  R  ASP A++LA E G+DLS +SGSGP GRI+ SD+  
Sbjct: 197 PTPMYQAPSIPQSAPIPSASSGRVSASPFAKKLAAEQGLDLSGVSGSGPGGRILASDL-- 254

Query: 157 LISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTI 216
                      S   + G    +  A+     +   Y  +P  N+RKTIA RL +SK TI
Sbjct: 255 -----------SQAPAKGATSTTSQAS-----SGQDYTDVPLSNMRKTIAKRLTESKSTI 298

Query: 217 PHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSW 276
           PH+Y++ +  +D LL +RE++N  L       + KIS+ND I+KA ALA  +VPEAN  W
Sbjct: 299 PHYYLTSEIQLDTLLQVREKLNGLLAKGTSGQATKISINDFIIKASALACQRVPEANSYW 358

Query: 277 TTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEY 336
             + +  + H+DISVAVS P G++TPII  A  K +  I+ E+ +LAQRA++ KL+P E+
Sbjct: 359 MDSFIRENHHVDISVAVSTPAGLITPIIFNAHAKGLATIASEIVELAQRAREGKLQPHEF 418

Query: 337 QGGTTSISNMGMLG-INSFCAVINPPQSTILAIGAGEKKVV-FQNEEIKVATIMNATLSA 394
           QGGT ++SN+GM G ++ F A+INPPQS ILAIG    K+V  + E  K    M  TLS 
Sbjct: 419 QGGTFTVSNLGMFGSVSDFTAIINPPQSCILAIGGASDKLVPDEAEGYKKVKTMKVTLSC 478

Query: 395 DHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           DHR+VDGA+ +  L  FKE++E P  ML+
Sbjct: 479 DHRTVDGAVGAVWLRHFKEFLEKPHTMLL 507


>gi|145533731|ref|XP_001452610.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124420309|emb|CAK85213.1| unnamed protein product [Paramecium tetraurelia]
          Length = 616

 Score =  293 bits (749), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 172/446 (38%), Positives = 263/446 (58%), Gaps = 37/446 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM +G L KW+ +EGD+ISPGD++CEIETDKA + FE  +EG I +++VPAG
Sbjct: 180 LGLPALSPTMEKGNLMKWLVKEGDQISPGDVICEIETDKATVGFEVQEEGYIAKLMVPAG 239

Query: 66  TENI------AVNSP-------ILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVR 112
           +++I      A+++P         N  +D    P     ++    + +  +S +    V 
Sbjct: 240 SKDIKLGTILAISTPKKDNVSSFANYTLDGAAAPAKTTQAQPAQEQQQSTNSDTPIQTVS 299

Query: 113 EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI--STKTNVKDYSTI 170
           +  S  R   SPLA+  A ++ + L  + G+G  G IVK D+E  +   +K  V+  + I
Sbjct: 300 Q--SGQRIFVSPLAKEFAKKNNVALEYVKGTGIEGSIVKKDVERFLQSGSKPEVQQQAAI 357

Query: 171 QSFGLVDESI---DANILNLFAKDSYEVI----PH-----DNIRKTIACRLQQSKQTIPH 218
            S   + ++    +A      A  S  V     P+      N+R TIA RL +SK TIPH
Sbjct: 358 SSEQPIQQTTPPAEAKQQTKPATPSKPVAIEGNPYIDTELTNMRLTIAARLLESKTTIPH 417

Query: 219 FYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTT 278
           +Y+++   +D +L +RE++N+  +        KISVND I+KA ALA+  +P+AN  W  
Sbjct: 418 YYLTMTVTMDKVLKVREELNKLQKV-------KISVNDFIIKASALALKDIPQANSQWHG 470

Query: 279 NAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQG 338
             + +  + DIS+AV+   G++TPI+  A  K +  I+  VK+LA +AK  KLKP+E+ G
Sbjct: 471 TYIRKFANADISIAVATDAGLITPIVFNAGSKGLGTIASTVKELADKAKANKLKPQEFIG 530

Query: 339 GTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVV-FQNEEIKVATIMNATLSADHR 397
           GT +ISN+GM GI+ F AVINPPQ+ ILA+G   K+ V  +N + KV   M+ TLS DHR
Sbjct: 531 GTFTISNLGMFGIDQFIAVINPPQAAILAVGKTSKRFVPDENGQPKVENQMDVTLSCDHR 590

Query: 398 SVDGAIASKLLAKFKEYIENPVWMLM 423
            VDGA+ ++ L +FK YIE+P  +L+
Sbjct: 591 VVDGAVGAQWLQRFKYYIEDPNTLLL 616



 Score = 79.7 bits (195), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 55/80 (68%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM  G + K++K+ GD I+ GD+LCE+ETDKA + FE  DEG + +ILVP G
Sbjct: 50  LEMPALSPTMETGNIQKYLKKIGDPITAGDVLCEVETDKATVGFEMQDEGFLAQILVPEG 109

Query: 66  TENIAVNSPILNILMDSTEI 85
           ++ + V   +  I+   +++
Sbjct: 110 SKGVKVGQLVAVIVPKQSDV 129


>gi|108759682|ref|YP_630887.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Myxococcus xanthus DK 1622]
 gi|108463562|gb|ABF88747.1| pyruvate dehydrogenase complex , E2 component, dihydrolipoamide
           acetyltransferase [Myxococcus xanthus DK 1622]
          Length = 527

 Score =  292 bits (748), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 159/421 (37%), Positives = 258/421 (61%), Gaps = 21/421 (4%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            I MPSLSPTMTEGK+ KW+K++GDK+S GD + E+ETDK+ +E E+ D G + EI+V  
Sbjct: 126 AIQMPSLSPTMTEGKIVKWLKKQGDKVSSGDAVAEVETDKSNLEIEAYDNGTLAEIVV-- 183

Query: 65  GTENIA-VNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI-A 122
           G   +A V +PI  +     +  P+ P ++        E   ++        +  R + A
Sbjct: 184 GENQMAKVGAPIAYLTAKGAKAAPAAPAAQPKPPAPAPEKPAAAKPAAAPAQAGGRRLRA 243

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
           SP+A+R+A E G+DL+ +SGSGP GR+VK DIE  ++        +           +  
Sbjct: 244 SPVAKRIAREKGLDLTQVSGSGPSGRVVKRDIEEALARGPAAVPAAKKAPAAQPAPGV-- 301

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
                  +    V+P  ++RK IA R+ + K  +PHFY++I+ +++    +RE+      
Sbjct: 302 -------RPEPTVLPLSSMRKVIAQRMTEVKPGVPHFYLTIEVDMEAASKVREEA----- 349

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
              + +  K+SVND+I+KA A+A+ + P+ NVS   + +++   +D+ +AV++  G++TP
Sbjct: 350 ---KAMDLKVSVNDLIVKAVAMAVRRYPKINVSLQGDKVVQFHSVDVGIAVALEEGLITP 406

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           I+R ADQK +  I+  V++LA+RA++R LKPEEY GG+ ++SN+GM GI+ F AVINPPQ
Sbjct: 407 ILRDADQKGLQAIASGVRELAERARKRALKPEEYTGGSITVSNLGMYGIDQFVAVINPPQ 466

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           ++ILA+GA  +K V ++ ++ V  +M ATLS DHR +DGAI ++ L + +  +E+P  +L
Sbjct: 467 ASILAVGAVSEKAVVRDGQLAVRKMMTATLSCDHRVIDGAIGAEFLRELRGLLEHPTRLL 526

Query: 423 M 423
            
Sbjct: 527 F 527



 Score = 83.2 bits (204), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 6  ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
          I MPSLSPTMTEGK+ KW+K++GDK+S GD + E+ETDK+ +E E+ D+G + ++LV  G
Sbjct: 5  IQMPSLSPTMTEGKIVKWLKKQGDKVSSGDAVAEVETDKSNLEIEAYDDGYLLQVLVGEG 64

Query: 66 TENIAVNSPILNI 78
           E   V +PI  I
Sbjct: 65 -EMAKVGAPIAYI 76


>gi|158423368|ref|YP_001524660.1| dihydrolipoamide S-acetyltransferase [Azorhizobium caulinodans ORS
           571]
 gi|158330257|dbj|BAF87742.1| dihydrolipoamide S-acetyltransferase [Azorhizobium caulinodans ORS
           571]
          Length = 459

 Score =  292 bits (748), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 144/322 (44%), Positives = 213/322 (66%), Gaps = 14/322 (4%)

Query: 116 SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGL 175
           +  R  ASPLARRLA E GIDL++L+GSGP GRI+  D+E            +   +   
Sbjct: 138 TGGRVFASPLARRLAKEKGIDLAALAGSGPRGRIIARDVEGAKPGAAPAAAAAAPAAAAP 197

Query: 176 -------------VDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVS 222
                        V       +  LFA+ +YE +  D +RKTIA RL +S+Q  P FY+S
Sbjct: 198 APAPKATAAAAPAVSGPTADQVKALFAEGTYEEVQLDGMRKTIAKRLVESEQLTPTFYLS 257

Query: 223 IDCNIDNLLSLREQMNRTLQFHRE-EISNKISVNDIILKAFALAMIQVPEANVSWTTNAM 281
           +DC+ID+L+ LRE +N +    ++ +   ++SVND ++KA ALA+ +VP AN  W  + +
Sbjct: 258 VDCDIDDLMKLRETVNASAPKDKDGKPGFRVSVNDFVIKALALALQKVPAANAVWAEDRI 317

Query: 282 IRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTT 341
           +R KH D+ VAV+I GG+  PI+++A+QK++  IS E++ LA RA+ +KLKP+EYQGG+T
Sbjct: 318 LRLKHSDVGVAVAIDGGLFAPIVKKAEQKTLSAISNEMRDLATRARTKKLKPDEYQGGST 377

Query: 342 SISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDG 401
           S+SN+GM+G+  F A+IN PQS+ILA+GA E++ V +  EIK+AT   AT++ DHR +DG
Sbjct: 378 SVSNLGMMGVRDFVAIINAPQSSILAVGASEQRPVVRGGEIKIATQFTATITCDHRVMDG 437

Query: 402 AIASKLLAKFKEYIENPVWMLM 423
           A+ ++LLA FK +IENP+ ML+
Sbjct: 438 ALGAELLAAFKGFIENPMSMLV 459



 Score = 93.2 bits (230), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 56/70 (80%)

Query: 6  ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
          I MP+LSPTM +G LAKW+K+EGD +  GD++ EIETDKA ME E+VDEG++ +I+VP G
Sbjct: 5  ILMPALSPTMEKGNLAKWLKKEGDSVKSGDVIAEIETDKATMEVEAVDEGVLAKIVVPEG 64

Query: 66 TENIAVNSPI 75
          ++++ VN  I
Sbjct: 65 SQDVPVNQLI 74


>gi|156363571|ref|XP_001626116.1| predicted protein [Nematostella vectensis]
 gi|156212980|gb|EDO34016.1| predicted protein [Nematostella vectensis]
          Length = 416

 Score =  292 bits (748), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 170/435 (39%), Positives = 260/435 (59%), Gaps = 45/435 (10%)

Query: 15  MTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSP 74
           M  G L  W KQEGD+++ GD+L +IETDKA MEFE+ +EG I +IL+PAG++++ +   
Sbjct: 1   MEAGTLVSWEKQEGDELAEGDLLAQIETDKATMEFETPEEGFIAKILIPAGSKDVPIGKL 60

Query: 75  ILNILMDSTEIPPSPPLSKEN-----------------------IVEVREEHSHSSPVVV 111
           +  I+ +  ++      + ++                            +  + + P   
Sbjct: 61  LCIIVPNKEDVDKFKNFTVDDAEGAAESPPPPPPTKAAAPPTPPAASPPQPATPTPPAAA 120

Query: 112 REKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
               +  R +ASPLA+++A + G+ LS + GSGP GRI  +D++T  S           Q
Sbjct: 121 AAPFAGGRVMASPLAKKMAQDQGVSLSGIPGSGPGGRITAADVQTAASAAL------AAQ 174

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
              +    I   +        YE IP  N+R+ IA RL QSKQTIPH+Y+S+D  +D L+
Sbjct: 175 PTPVAAAPIPGTV--------YEDIPLSNMRQVIAKRLLQSKQTIPHYYLSVDVKMDQLI 226

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISV 291
            +R+Q+N      + + S K+S+ND I+K+ ALA  QVPEAN SW  + + R++++D+SV
Sbjct: 227 EIRKQLN-----EQGKGSYKLSINDFIVKSCALACRQVPEANSSWMGDFIRRYENVDVSV 281

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGI 351
           AVS   G++TPI+  AD+K +  IS ++  LA++A+  KL+P+E+QGGT +ISN+GM GI
Sbjct: 282 AVSTDNGLITPIVFDADKKGLSSISGDITSLAEKARAGKLQPQEFQGGTITISNLGMFGI 341

Query: 352 NSFCAVINPPQSTILAIGAGEKKVVFQNEEIK---VATIMNATLSADHRSVDGAIASKLL 408
            +F AVINPPQ+ ILA+G  EK+V+      K   V  +M+ TLS DHR VDGA+ ++ L
Sbjct: 342 KNFAAVINPPQACILAVGGTEKRVLADETSEKGYSVGNVMSVTLSCDHRVVDGAVGAQWL 401

Query: 409 AKFKEYIENPVWMLM 423
           A FK+Y+ENP+ ML+
Sbjct: 402 AVFKKYLENPMTMLL 416


>gi|298207674|ref|YP_003715853.1| Dihydrolipoamide acetyltransferase component (E2) of
           pyruvatedehydrogenase complex [Croceibacter atlanticus
           HTCC2559]
 gi|83850311|gb|EAP88179.1| Dihydrolipoamide acetyltransferase component (E2) of
           pyruvatedehydrogenase complex [Croceibacter atlanticus
           HTCC2559]
          Length = 557

 Score =  292 bits (748), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 168/434 (38%), Positives = 251/434 (57%), Gaps = 26/434 (5%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  ITMP LS TM EG +A W+KQEGD I  GDIL EIETDKA MEFES   G + +I V
Sbjct: 135 VEIITMPRLSDTMEEGTVATWLKQEGDTIEEGDILAEIETDKATMEFESFYSGTLLKIGV 194

Query: 63  PAGTENIAVNSPILNILMDSTEIP----PSPPLSKENIVEVREEHSHSSPV-------VV 111
             G E   V+  +  I  + T++      SP  SK      +EE    +           
Sbjct: 195 AEG-ETAKVDKLLAIIGPEGTDVSGISGDSPKASKAETKSSKEEKDAKADTDKEETSSKS 253

Query: 112 REKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
                  R   SPLA+++A E GIDLS ++GSG +GRIVK DIE    + T+ KD +  +
Sbjct: 254 STTSDGKRIFVSPLAKKMAEEKGIDLSEVNGSGDNGRIVKKDIENFKPSATSKKDTAQAK 313

Query: 172 SFGLVDESIDANILNLF---AKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNID 228
                 ++ +A  +  +    ++S+E   +  +RKTIA RL +SK + PH+Y++++ N++
Sbjct: 314 E----SQTNEAPTIQPYVPAGEESFEETKNSQMRKTIAKRLGESKFSAPHYYLTVEINME 369

Query: 229 NLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHID 288
           + +S R Q+N+           K+S ND+++KA A+A+ + P+ N  W  +      HI 
Sbjct: 370 HAMSSRSQINQMPDV-------KVSYNDMVIKAAAMALRKHPQVNSQWDGDKTKVANHIH 422

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           + VAV++  G++ P+++ ADQ S+  I   VK LA +A+ +K+ P+E  G T ++SN+GM
Sbjct: 423 MGVAVAVDEGLLVPVLKFADQMSLTQIGGNVKSLAGKARNKKITPDEMSGSTFTVSNLGM 482

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLL 408
            GI  F ++IN P S+IL+IGA  +K V +N EI V   M  T++ DHR+VDGA  ++ L
Sbjct: 483 FGITEFTSIINQPNSSILSIGAIVEKPVVKNGEIVVGHTMKVTMANDHRTVDGATGAQFL 542

Query: 409 AKFKEYIENPVWML 422
             FK Y+ENPV ML
Sbjct: 543 QTFKTYMENPVTML 556



 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/64 (60%), Positives = 45/64 (70%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   I MP LS TM EG +AKW+KQ+GDK+  GDIL EIETDKA MEFES  EG++  I 
Sbjct: 1  MAEVINMPRLSDTMEEGVVAKWLKQKGDKVEEGDILAEIETDKATMEFESFYEGVLLHIG 60

Query: 62 VPAG 65
          V  G
Sbjct: 61 VEEG 64


>gi|195471503|ref|XP_002088044.1| GE14551 [Drosophila yakuba]
 gi|194174145|gb|EDW87756.1| GE14551 [Drosophila yakuba]
          Length = 510

 Score =  291 bits (746), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 163/447 (36%), Positives = 242/447 (54%), Gaps = 48/447 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +  W K+EGDK++ GD+LCEIETDKA M FE+ +EG + +IL+  G
Sbjct: 83  VPLPALSPTMERGSIVSWEKKEGDKLNEGDLLCEIETDKATMGFETPEEGYLAKILIQGG 142

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKH---------- 115
           T+++ V   +  I+ D   +        +         + +                   
Sbjct: 143 TKDVPVGQLLCIIVPDQGSVAAFANFKDDAAGAPPAAPAAAPAPAAAAPPPPPPAAAPAP 202

Query: 116 ----------------SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
                              R  ASP+A+RLA    + L    GSG HG I   D+     
Sbjct: 203 AAAAPPPAPAAAPAAAGTGRVYASPMAKRLAEAQQLRLQG-KGSGVHGSIKSGDLAG--- 258

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
                      Q       +         A   YE IP  N+R  IA RL +SK  +PH+
Sbjct: 259 -----------QKAAAKPAAAAPAKAPKAAGARYEDIPVTNMRAVIAKRLLESKTQLPHY 307

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN 279
           YV++ C +D LL  R ++N+      E+   ++SVND I+KA A+A ++VPEAN +W   
Sbjct: 308 YVTVQCQVDKLLKFRAKVNKKY----EKQGARVSVNDFIIKAVAIASLKVPEANSAWMDT 363

Query: 280 AMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
            + ++  +D+SVAVS   G++TPI+  AD+K +L+IS +VK LA +A+  KL+P E+QGG
Sbjct: 364 VIRQYDDVDVSVAVSTDKGLITPIVFNADRKGVLEISKDVKALAAKARDNKLQPHEFQGG 423

Query: 340 TTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKV---ATIMNATLSADH 396
           T S+SN+GM G+N F AVINPPQS ILAIG   K++V   + +K      ++  TLSADH
Sbjct: 424 TISVSNLGMFGVNQFAAVINPPQSCILAIGTTTKQLVADPDSLKGFKEVNVLTVTLSADH 483

Query: 397 RSVDGAIASKLLAKFKEYIENPVWMLM 423
           R VDGA+A++ L  F++Y+E+P  M++
Sbjct: 484 RVVDGAVAARWLQHFRDYMEDPSNMVL 510


>gi|20129315|ref|NP_609118.1| CG5261, isoform B [Drosophila melanogaster]
 gi|7297250|gb|AAF52514.1| CG5261, isoform B [Drosophila melanogaster]
 gi|73853449|gb|AAZ86794.1| AT21758p [Drosophila melanogaster]
          Length = 512

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 162/449 (36%), Positives = 241/449 (53%), Gaps = 50/449 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +  W K+EGDK++ GD+LCEIETDKA M FE+ +EG + +IL+  G
Sbjct: 83  VPLPALSPTMERGSIVSWEKKEGDKLNEGDLLCEIETDKATMGFETPEEGFLAKILIQGG 142

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKH---------- 115
           T+++ V   +  I+ D   +        +         + +                   
Sbjct: 143 TKDVPVGQLLCIIVPDQGSVAAFANFKDDGAAAAPAAPAAAPAPAPAAAAAPPPPPPPAA 202

Query: 116 ------------------SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETL 157
                                R  ASP+A+RLA    + L    GSG HG I   D+   
Sbjct: 203 APAAAAPPPAPAAAPAAAGTGRVYASPMAKRLAEAQQLRLQG-KGSGVHGSIKSGDLAGQ 261

Query: 158 ISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIP 217
            +                             A   YE IP  N+R  IA RL +SK  +P
Sbjct: 262 KAAAKPAAAAPAKAP--------------RAAGARYEDIPVTNMRAVIAKRLLESKTQLP 307

Query: 218 HFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWT 277
           H+YV++ C +D LL  R ++N+      E+   ++SVND I+KA A+A ++VPEAN +W 
Sbjct: 308 HYYVTVQCQVDKLLKFRAKVNKKY----EKQGARVSVNDFIIKAVAIASLKVPEANSAWM 363

Query: 278 TNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQ 337
              + ++  +D+SVAVS   G++TPI+  AD+K +L+IS +VK LA +A+  KL+P E+Q
Sbjct: 364 DTVIRKYDDVDVSVAVSTDKGLITPIVFNADRKGVLEISKDVKALAAKARDNKLQPHEFQ 423

Query: 338 GGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKV---ATIMNATLSA 394
           GGT S+SN+GM G+N F AVINPPQS ILAIG   K++V   + +K      ++  TLSA
Sbjct: 424 GGTISVSNLGMFGVNQFAAVINPPQSCILAIGTTTKQLVADPDSLKGFKEVNMLTVTLSA 483

Query: 395 DHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           DHR VDGA+A++ L  F++Y+E+P  M++
Sbjct: 484 DHRVVDGAVAARWLQHFRDYMEDPSNMVL 512


>gi|2117706|pir||I55976 dihydrolipoamide S-acetyltransferase (EC 2.3.1.12), liver - rat
           (fragment)
 gi|206038|gb|AAA41813.1| primary biliary cirrhosis autoantigen [Rattus norvegicus]
 gi|2951762|dbj|BAA20956.1| 70 kd mitochondrial autoantigen [Rattus norvegicus]
          Length = 457

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 167/408 (40%), Positives = 245/408 (60%), Gaps = 34/408 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I +P+LSPTMT G + +W K+ G+K+S GD+L EIETDKA + FE  +EG + +ILVP G
Sbjct: 49  IVLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 108

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA--- 122
           T ++ + +P+  I+    +I          +  ++ +     P  V       +P+A   
Sbjct: 109 TRDVPLGTPLCIIVEKQEDIAAFADYRPTEVTSLKPQAPPPVPPPVAAVPPIPQPLAPTP 168

Query: 123 -------------SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYST 169
                        SPLA++LA E GIDL+ + G+GP GRI+K DI++ + TK      + 
Sbjct: 169 SAAPAGPKGRVFVSPLAKKLAAEKGIDLTQVKGTGPEGRIIKKDIDSFVPTKAAPAAAAA 228

Query: 170 IQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
                 V  +     ++         IP  NIR+ IA RL QSKQTIPH+Y+S+D N+  
Sbjct: 229 APPGPRVAPTPAGVFID---------IPISNIRRVIAQRLMQSKQTIPHYYLSVDVNMGE 279

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI-D 288
           +L +R+++N+ L     E   KISVND I+KA ALA ++VPEAN SW  + +IR  H+ D
Sbjct: 280 VLLVRKELNKML-----EGKGKISVNDFIIKASALACLKVPEANSSWM-DTVIRQNHVVD 333

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           +SVAVS P G++TPI+  A  K +  I+ +V  LA +A++ KL+P E+QGGT +ISN+GM
Sbjct: 334 VSVAVSTPAGLITPIVFNAHIKGLETIASDVVSLASKAREGKLQPHEFQGGTFTISNLGM 393

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSA 394
            GI +F A+INPPQ+ ILAIGA E K++  + E    VA++M+ T SA
Sbjct: 394 FGIKNFSAIINPPQACILAIGASEDKLIPADNEKGFDVASVMSVTHSA 441


>gi|295135749|ref|YP_003586425.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Zunongwangia profunda SM-A87]
 gi|294983764|gb|ADF54229.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Zunongwangia profunda SM-A87]
          Length = 539

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 169/430 (39%), Positives = 258/430 (60%), Gaps = 24/430 (5%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  + MP LS TM EG +A W+K+EGDK+S GDIL EIETDKA MEFES  EG + +I +
Sbjct: 123 VEIVKMPRLSDTMEEGTVASWLKKEGDKVSEGDILAEIETDKATMEFESFYEGTLLKIGI 182

Query: 63  PAGTENIAVNS----------PILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVR 112
           P G E   V+S           + N+  DST    +P   +++  +  ++   ++     
Sbjct: 183 PEG-ETAPVDSLLAIIGPEGTDVSNVTGDSTGKKAAPKKEEKSEAKEEKKEETTTTSSDS 241

Query: 113 EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQS 172
                 R  ASPLA+++A + GIDLS + GSG +GRIVK DIE+   ++      +  ++
Sbjct: 242 SSEG-GRIFASPLAKKMAEDKGIDLSKVEGSGENGRIVKKDIESYKPSEAPAPKETKKEA 300

Query: 173 FGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232
               + S+ A  +    ++S+E I +  +RKTIA RL +SK + PH+Y++I+ +++N ++
Sbjct: 301 ----ETSVAAPYVPA-GEESFEEIKNSQMRKTIAKRLGESKFSAPHYYLTIEVDMENAMA 355

Query: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVA 292
            R+Q+N            K+S ND+++KA A+A+ + P+ N  WT +AM   KHI + VA
Sbjct: 356 SRKQINEMPDV-------KVSFNDMVIKASAMALRKHPQVNSQWTGDAMKIAKHIHMGVA 408

Query: 293 VSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGIN 352
           V++  G+V P+++ ADQ S+  I   VK LA +A+ +KL+P+E +G T ++SN+GM GI 
Sbjct: 409 VAVEDGLVVPVLKFADQMSMTQIGGNVKDLAGKARNKKLQPKEMEGSTFTVSNLGMFGIT 468

Query: 353 SFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFK 412
            F ++IN P S IL++G   +K V +N EI V   M  TL+ DHR+VDGA  +  L   K
Sbjct: 469 EFTSIINQPNSAILSVGTIVEKPVVKNGEIVVGHTMKLTLACDHRTVDGATGAAFLKDLK 528

Query: 413 EYIENPVWML 422
            YIENPV ML
Sbjct: 529 TYIENPVTML 538



 Score = 78.2 bits (191), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   I MP LS TM EG +AKW+KQ+GDK++ GDIL EIETDKA MEFES  EG +  I 
Sbjct: 1  MAEVINMPRLSDTMEEGVVAKWLKQKGDKVAEGDILAEIETDKATMEFESFYEGTLLHIG 60

Query: 62 VPAG 65
          +  G
Sbjct: 61 IEEG 64


>gi|260946245|ref|XP_002617420.1| hypothetical protein CLUG_02864 [Clavispora lusitaniae ATCC 42720]
 gi|238849274|gb|EEQ38738.1| hypothetical protein CLUG_02864 [Clavispora lusitaniae ATCC 42720]
          Length = 467

 Score =  290 bits (741), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 175/446 (39%), Positives = 249/446 (55%), Gaps = 49/446 (10%)

Query: 4   HT-ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HT I MP+LSPTMT+G +A W K  GD+++PG+ + EIETDKA M+FE  +EG + +ILV
Sbjct: 45  HTVINMPALSPTMTQGGIAAWSKSVGDELTPGEAIAEIETDKASMDFEFQEEGYLAKILV 104

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPL-------------------SKENIVEVREEH 103
            AGT +I V  PI   + DS+++P                        ++E   E +   
Sbjct: 105 EAGTSDIPVGKPIAVYVEDSSDVPAFESFTAEDAAGAEAPAPAPKEEKTEEPKAEEKPAS 164

Query: 104 SHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
           S  S      K    R  ASPLA+ +A + GI L ++ GSGP GRI+  D+E       N
Sbjct: 165 SAPSKPSTPSKAPTGRIFASPLAKTIALDRGISLKNIKGSGPKGRIIAKDVE-------N 217

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
           +K      +                A  +YE IP   +RKTIA RL QS Q  P + V  
Sbjct: 218 IKPAEAAPA-----------ASAAPAAATYEDIPLTAMRKTIASRLLQSTQQSPSYIVQS 266

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTT--NAM 281
             N+  LL LR+ +N T      E   ++SVND+++KA ALA ++VPE N +W    N +
Sbjct: 267 QLNVSKLLKLRQSLNAT-----AEDRYRLSVNDLLVKAIALASLRVPEVNSAWMGEENVI 321

Query: 282 IRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTT 341
            ++  +D+SVAV+ P G++TPII+ A  K +  IS EVK L +RAK  KL PEEYQGGT 
Sbjct: 322 RQYNVVDVSVAVATPTGLITPIIKNAHTKGLATISAEVKDLGKRAKAGKLAPEEYQGGTI 381

Query: 342 SISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVV---FQNEEIKVATIMNATLSADHR 397
            ISN+GM   +N+F ++INPPQS I+AIG  +KK +      +    A ++  T + DHR
Sbjct: 382 CISNLGMNNAVNAFTSIINPPQSAIVAIGTVDKKAIPSSVNEQGFVFADVITVTGTFDHR 441

Query: 398 SVDGAIASKLLAKFKEYIENPVWMLM 423
           +VDGA   + + + K+ +ENP+  L+
Sbjct: 442 TVDGAKGGEWIRELKKIVENPLEFLI 467


>gi|303275974|ref|XP_003057281.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226461633|gb|EEH58926.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 498

 Score =  289 bits (740), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 165/442 (37%), Positives = 249/442 (56%), Gaps = 40/442 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTMT+G +A+W  +EGDK+S GD+L +IETDKA M  ES+++G + +IL   G
Sbjct: 73  ITMPALSPTMTQGNIAEWKVKEGDKVSAGDVLADIETDKATMALESMEDGYVAKILHGTG 132

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLS--------------------KENIVEVREEHSH 105
             ++ V + +  ++ D  ++      +                               S 
Sbjct: 133 ASDVEVGTLVAIMVEDEGDVGKFGGFTVSAAAAPAARTATPAAAPAAAAPAAAAAPAASA 192

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           +S  V   +H+  R  A+P AR +A E GI +  + GSGP GRI+ SD+   I+     +
Sbjct: 193 ASAPVSAPRHAGARVFATPKARVMAAEAGIAIDQIDGSGPGGRILMSDVSHAIANGVAPR 252

Query: 166 DYSTIQSFGLVDESIDANILNLFAK--DSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
             +                 + FA+    YE +    I+K  A RL +SK+T+PHFY+S+
Sbjct: 253 AAAGSAD----------GAADGFARFFPPYEDVSVTTIKKVTAARLTESKRTVPHFYLSV 302

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           D  +D ++S R ++N   +        KISVND ++KA A A+ QVP+ N SW  + +  
Sbjct: 303 DVRMDQIVSARAKLNAGKE------KGKISVNDFVVKAAASALKQVPDVNASWMGDKIRV 356

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
           +K+ DISVAV    G++ PI+R A    +  IS EV+ LA +AK+ KL P +  GGT +I
Sbjct: 357 YKNADISVAVQTDAGLMVPIVRNACGLGLSGISSEVRALAGKAKEGKLSPADMIGGTFTI 416

Query: 344 SNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNE--EIKVATIMNATLSADHRSVDG 401
           SN+GM GI  F A++NPPQ+ ILA+GA  K+VV + +    + A +M+ATLS DHR VDG
Sbjct: 417 SNLGMFGIKQFAAIVNPPQAAILAVGAARKEVVKKADGSGYEEALLMSATLSCDHRVVDG 476

Query: 402 AIASKLLAKFKEYIENPVWMLM 423
           A+ ++ L  FK ++E+PV ML+
Sbjct: 477 AVGAQWLGAFKAFMEDPVTMLL 498


>gi|325955111|ref|YP_004238771.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Weeksella virosa DSM 16922]
 gi|323437729|gb|ADX68193.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Weeksella virosa DSM 16922]
          Length = 534

 Score =  288 bits (738), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 168/440 (38%), Positives = 255/440 (57%), Gaps = 46/440 (10%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGI------ 56
           +H I MP LS TM EG +  W K  GDK++ GDIL +IETDKA+ EFES  +G+      
Sbjct: 122 VHVINMPRLSDTMEEGTVTSWHKNVGDKVAEGDILADIETDKAVQEFESEYDGVLLYQGV 181

Query: 57  -------IDEILVPAGTENIAVNSPIL---NILMDSTE---IPPSPPLSKENIVEVREEH 103
                  +D IL   G +   + S +L   + + +  E   I    P+  E  +EV++  
Sbjct: 182 KENEPVPVDTILAIIGEKGADI-SAVLEQGSAVANQEEVEIIDDEKPVVVE--LEVKKTG 238

Query: 104 SHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
            HS+        S+ R  ASPLAR++A + GIDL  + GSG +GRI++ D+E       +
Sbjct: 239 EHSTETT----PSEERIFASPLARKIAEDKGIDLVQVKGSGDNGRIIRKDVENFTPLAQH 294

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
                ++ S  +V             +D +  IP+ ++RK IA RL +SK T PH+Y++I
Sbjct: 295 TVGSESVASPNIV-----------AGEDKH--IPNSSMRKVIAKRLAESKFTAPHYYLNI 341

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           + ++DN +  R+Q+N          + KIS ND+++KA A+A+ + P  N SW  N +++
Sbjct: 342 ELDMDNAIEARKQINALP-------NTKISFNDMVVKAVAMALKKHPSVNASWADNEIVQ 394

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
           +  I+I VAV++  G++ P++R ADQKS   +S E+K  A RA+ RKLK +E +  T S+
Sbjct: 395 YGDINIGVAVAVEDGLLVPVVRNADQKSYTQLSAEIKDYATRARDRKLKADEMEKSTFSV 454

Query: 344 SNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAI 403
           SN+GM GI SF ++IN P S I++IGA  +K V +N +I V   M  +L+ DHR+VDGA 
Sbjct: 455 SNLGMFGIESFTSIINQPNSCIMSIGAIVEKPVVKNGQIVVGNTMMISLACDHRTVDGAT 514

Query: 404 ASKLLAKFKEYIENPVWMLM 423
            ++ L  FK Y+ENPV ML+
Sbjct: 515 GAQFLQTFKAYMENPVAMLV 534



 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 39/56 (69%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGII 57
          M   I MP LS TM EG + KW K  GD+++ GDIL EIETDKAI EFES  +G++
Sbjct: 1  MAEIINMPRLSDTMEEGTVVKWHKSVGDEVAEGDILAEIETDKAIQEFESEYDGVL 56


>gi|268559664|ref|XP_002637823.1| Hypothetical protein CBG04612 [Caenorhabditis briggsae]
 gi|187035401|emb|CAP25282.1| hypothetical protein CBG_04612 [Caenorhabditis briggsae AF16]
          Length = 507

 Score =  288 bits (737), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 173/448 (38%), Positives = 255/448 (56%), Gaps = 48/448 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +  W K+EGD++S GD+LCEIETDKA M FE+ +EG + +IL+  G
Sbjct: 78  VALPALSPTMELGTVVSWQKKEGDQLSEGDLLCEIETDKATMGFETPEEGYLAKILIQEG 137

Query: 66  TENIAVNSPILNILMDSTEIP-----------------------PSPPLSKENIVEVREE 102
           ++++ +   +  I+ +  ++                        P PP            
Sbjct: 138 SKDVPIGKLLCIIVENEADVAAFKDFKDDGAAAGGDSSAKKESAPEPPKQSSPPAASSPP 197

Query: 103 HS-HSSPVVVREKH----SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETL 157
              + +P + +       S  R  ASP A++LA E G+DLS +SGSGP GRI+ SD+   
Sbjct: 198 TPMYQAPSIPKSAPIPPPSSGRVSASPFAKKLAAEQGLDLSGVSGSGPGGRILASDL--- 254

Query: 158 ISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIP 217
                     S   + G    +  A+     +   Y  +P  N+RKTIA RL +SK TIP
Sbjct: 255 ----------SQAPAKGATSTTSQAS-----SGQDYTDVPLSNMRKTIAKRLTESKSTIP 299

Query: 218 HFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWT 277
           H+Y++ +  +D LL +RE++N  L       + KIS+ND I+KA ALA  +VPEAN  W 
Sbjct: 300 HYYLTSEIQLDTLLQVREKLNGLLAKGTSGHATKISINDFIIKASALACRRVPEANSYWM 359

Query: 278 TNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQ 337
            + +  + H+D+SVAVS   G++TPI+  A  K +  I+ EV +LAQRA++ KL+P E+Q
Sbjct: 360 DSFIRENHHVDVSVAVSTAAGLITPIVFNAHAKGLATIASEVTELAQRAREGKLQPHEFQ 419

Query: 338 GGTTSISNMGMLG-INSFCAVINPPQSTILAIGAGEKKVV-FQNEEIKVATIMNATLSAD 395
           GGT ++SN+GM G ++ F A+INPPQS ILAIG    K++  + E  K    M  TLS D
Sbjct: 420 GGTFTVSNLGMFGSVSDFTAIINPPQSCILAIGGASDKLIPDEAEGYKKIKTMKVTLSCD 479

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR+VDGA+ +  L  FKE++E P  ML+
Sbjct: 480 HRTVDGAVGAVWLRHFKEFLEKPHTMLL 507


>gi|182414660|ref|YP_001819726.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Opitutus terrae PB90-1]
 gi|177841874|gb|ACB76126.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Opitutus terrae PB90-1]
          Length = 451

 Score =  288 bits (737), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 172/460 (37%), Positives = 248/460 (53%), Gaps = 47/460 (10%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M + I MP LS TMT G L KW+K EGD ++ GD+L E+ETDKA ME E   +G + +I 
Sbjct: 1   MANIIDMPKLSDTMTVGTLVKWLKNEGDTVATGDMLAEVETDKATMELECFFDGTLLKIF 60

Query: 62  VPAGTENIAVNSPILNILM-------------------------DSTEIPPSPPLSKENI 96
            PAG++ +A+ +P+  I                           D+T   P    + +N 
Sbjct: 61  APAGSQ-VAIGAPLCAIGKPGEKVEAPAAPAAPAAAPQPEKKADDTTTTSPGASTTSKNE 119

Query: 97  V-------------EVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGS 143
           V              V    + ++P       S  R   SPLAR+LA E GID + + GS
Sbjct: 120 VQAQPAAKPAPAAGRVEPSPAPTAPAT-SPSPSGGRVRISPLARKLAAEKGIDPAQVQGS 178

Query: 144 GPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRK 203
           GP GRIV++DI   ++ + +    +     G       A  +          +   N+R 
Sbjct: 179 GPGGRIVRADI---LAAEKSGSAKAGAAPRGGGAAFTGAAPMRTGPIQEERAVAVSNMRG 235

Query: 204 TIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFA 263
            IA RL +SK  +PHFYV I+ + + LL+LREQ+NR L+        K+SVND ILKA A
Sbjct: 236 AIARRLLESKTQLPHFYVDIEIDAEPLLALREQLNRALEAE----GVKLSVNDFILKASA 291

Query: 264 LAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLA 323
            A+ +VP+ N SW  + +       +  AV++  G++TP+IR A  KSI  IS E K L 
Sbjct: 292 EALRRVPQVNSSWEGSQIRYFAAAHVGFAVAMDDGLITPVIRDAHLKSIFAISAEAKALG 351

Query: 324 QRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIK 383
           +RAK++KLKPEE+ GGT  +SN+GM+GI  F A+INPP + ILA+G   KK V +N+++ 
Sbjct: 352 KRAKEKKLKPEEFTGGTFCVSNLGMMGIPRFTAIINPPNAAILAVGTTVKKPVVKNDQLV 411

Query: 384 VATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           V   +  TLS DHR VDGA+ ++ L   K+ +E P  +L+
Sbjct: 412 VGQTITLTLSCDHRVVDGAVGAQYLGALKQVLEAPALLLV 451


>gi|259149290|emb|CAY82532.1| Lat1p [Saccharomyces cerevisiae EC1118]
          Length = 482

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 172/461 (37%), Positives = 258/461 (55%), Gaps = 53/461 (11%)

Query: 4   HTI-TMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HTI  MP+LSPTMT+G LA W K+EGD++SPG+++ EIETDKA M+FE  ++G + +ILV
Sbjct: 34  HTIIGMPALSPTMTQGNLAAWTKKEGDQLSPGEVIAEIETDKAQMDFEFQEDGYLAKILV 93

Query: 63  PAGTENIAVNSPILNILMDSTEIP---------------------PSPPLSKENIVEVRE 101
           P GT++I VN PI   + D  ++P                     P+ P +++      E
Sbjct: 94  PEGTKDIPVNKPIAVYVEDKADVPAFKDFKLEDSGSDSKTSTKAQPAEPQAEKKQEAPAE 153

Query: 102 EHSHSSPVVVREKHS--KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
           E   S+P   +   +  + R  ASPLA+ +A E GI L  + G+GP GRI K+DIE+ + 
Sbjct: 154 ETKTSAPEAKKSDVAAPQGRIFASPLAKTIALEKGISLKDVHGTGPRGRITKADIESYLE 213

Query: 160 TKTNVKDY----STIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQT 215
             + +       +          +   +  +  +  SYE +P   +R  I  RL QS Q 
Sbjct: 214 KSSKLSSQTSGAAAATPAAATSNTTAGSAPSPSSTASYEDVPISTMRSIIGERLLQSTQG 273

Query: 216 IPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVS 275
           IP + VS   ++  LL LR+ +N T          K+S+ND+++KA  +A  +VP+AN  
Sbjct: 274 IPSYIVSSKISVSKLLKLRQSLNATANDKY-----KLSINDLLVKAITVAAKRVPDANAY 328

Query: 276 WTTNAMI--RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKP 333
           W  N  +  + K++D+SVAV+ P G++TPI++  + K +  IS E+K+L +RA+  KL P
Sbjct: 329 WLPNENVIRKFKNVDVSVAVATPTGLLTPIVKNCEAKGLSQISNEIKELVKRARINKLAP 388

Query: 334 EEYQGGTTSISNMGM-LGINSFCAVINPPQSTILAI----------GAGEKKVVFQNEEI 382
           EE+QGGT  ISNMGM   +N F ++INPPQSTILAI           A E    F N+  
Sbjct: 389 EEFQGGTICISNMGMNNAVNMFTSIINPPQSTILAIATVERVAVEDAAAENGFSFDNQ-- 446

Query: 383 KVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
                +  T + DHR++DGA  ++ + + K  IENP+ ML+
Sbjct: 447 -----VTITGTFDHRTIDGAKGAEFMKELKTVIENPLEMLL 482


>gi|332375672|gb|AEE62977.1| unknown [Dendroctonus ponderosae]
          Length = 501

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 166/438 (37%), Positives = 253/438 (57%), Gaps = 32/438 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           +T+P+LSPTM  G +  W K+EGDK++ GD+L EIETDKA M FE+ +EG + +IL+PAG
Sbjct: 76  VTLPALSPTMELGTIISWEKKEGDKLNEGDLLAEIETDKATMGFETPEEGYLAKILIPAG 135

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKH---------- 115
           ++++ +   +  I+ +  ++        + +    +  +   P                 
Sbjct: 136 SKDVPIGKLVCIIVENEADLTAFKDFKDDEVAAPPKAAAPPPPSAAPSAPTPTAAAPAGA 195

Query: 116 -----SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
                + +R  ASP+A+RLA +  I L    G+G  G I  SD+             +  
Sbjct: 196 PANVGATDRVYASPMAKRLAEQRNIRLQG-KGTGLFGAITSSDLGAQAPAAGAPSAPAPG 254

Query: 171 QSFGLVDESIDANILNLF--AKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNID 228
                        +L+    A   Y  IP  NIRKTIA RL QSKQ IPH+Y++ + N+D
Sbjct: 255 AP-------SGPAVLHAAPSAPGPYVDIPVSNIRKTIAKRLLQSKQLIPHYYLTQEINVD 307

Query: 229 NLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHID 288
            LL +R + N+ L    E+   K+SVND I+KA A+A  +VPEAN  W  + + ++K++D
Sbjct: 308 ALLKVRAKYNKKL----EKSGVKLSVNDFIIKATAVASQKVPEANSHWFDSTIRQYKNVD 363

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           +SVAVS   G++TPI+ +A+ K ++ IS  VK+LA +A+  KL+P+E+QGGT S+SN+GM
Sbjct: 364 VSVAVSTDKGLITPIVWEANNKGVVQISRTVKELAAKARDGKLQPQEFQGGTISVSNLGM 423

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVV---FQNEEIKVATIMNATLSADHRSVDGAIAS 405
            GI+ F A+INPPQS ILAIG    ++V    + +  + A  +  TLS DHR VDGA+ +
Sbjct: 424 FGISHFSAIINPPQSCILAIGTSVTRLVPDESKEKGFREAQYLTVTLSCDHRVVDGAVGA 483

Query: 406 KLLAKFKEYIENPVWMLM 423
           + L  FKE +E+PV M++
Sbjct: 484 RWLQAFKEGLEDPVSMIL 501


>gi|289739657|gb|ADD18576.1| dihydrolipoamide S-acetyltransferase [Glossina morsitans morsitans]
          Length = 510

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 171/461 (37%), Positives = 258/461 (55%), Gaps = 68/461 (14%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +  W K+EGDK++ GD+L EIETDKA M FE+ +EG + +I+VPAG
Sbjct: 75  VPLPALSPTMETGSIVSWEKKEGDKVNEGDLLAEIETDKATMGFETPEEGYLAKIVVPAG 134

Query: 66  TENIAVNSPILNILMDSTEIPP-------SPPLSKENIVEV------------------- 99
           T+++ +   +  ++ D   +         SPP+++                         
Sbjct: 135 TKDVPIGKLVCILVQDQASVAAFKNFVDDSPPIARAAKPAAVPPPSPMPPPPVVEPSVPP 194

Query: 100 -----------REEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGR 148
                      +     + P+   E+    R  ASP+A++LA    + L   SGSG +G 
Sbjct: 195 AVVEPTAPPSPKAAPRAAKPITAVEQRGP-RVYASPMAKKLAEAQQLRLEG-SGSGIYGS 252

Query: 149 IVKSDI---ETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTI 205
           I   D+   +   +    VK+    Q  G +D                  IP  N+R  I
Sbjct: 253 IKSGDLADKKPAEAKPAKVKELVVPQG-GYID------------------IPVTNVRGVI 293

Query: 206 ACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALA 265
           A RL +SK TIPH+YV+++C +D LL LR ++N+  +    +   K+SVND I+KA A+A
Sbjct: 294 AKRLLESKTTIPHYYVTMECQVDALLKLRAKINKKYE----KEKVKVSVNDFIIKATAIA 349

Query: 266 MIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQR 325
             +VPEAN  W  + + +  ++D+S+AVS   G++TPI+  AD+K +++IS EVK+LA +
Sbjct: 350 CRKVPEANSYWMGSVIRQFDNVDVSIAVSTDFGLITPIVFAADRKGVVEISKEVKELADK 409

Query: 326 AKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE---I 382
           A++ KLKP E+QGGT  +SNMGM G+  F AVINPPQS ILA+G   KK+V   +     
Sbjct: 410 ARKNKLKPHEFQGGTVCVSNMGMYGVTQFAAVINPPQSCILAVGTTNKKLVANADSEKGF 469

Query: 383 KVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           K  + M  TLSADHR VDGAIA+K L  F++++E+P  M++
Sbjct: 470 KEVSTMYVTLSADHRIVDGAIAAKWLQYFRDFMEDPSTMIV 510


>gi|327404742|ref|YP_004345580.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Fluviicola taffensis DSM 16823]
 gi|327320250|gb|AEA44742.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Fluviicola taffensis DSM 16823]
          Length = 425

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 174/456 (38%), Positives = 256/456 (56%), Gaps = 65/456 (14%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP LS TMTEG +A+W K+ GD +  G++L EIETDKA +EFES  +G++  I 
Sbjct: 1   MAEIINMPKLSDTMTEGVVAEWHKKVGDTVKSGELLAEIETDKATLEFESFFDGVLLHIG 60

Query: 62  VPAGTENIAVNSPI---------LNILMDSTEIPPSPPLSKENIVEVREEHS-------- 104
           +  G +   VNS +         ++ L+ S     +P    E IVE + +          
Sbjct: 61  IEKG-KPAPVNSLLAIIGEKGEDISALLASAGTTDAP---AEKIVEKKTDAEPAKKEEVK 116

Query: 105 ---------HSSPV---VVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKS 152
                     S+P     V   +S  R +ASPLA++LA E G+DL  +SG+G  GRI K 
Sbjct: 117 TEEKAPAAVTSAPKTTPAVSNTNSNGRILASPLAKKLAEEKGVDLGFISGTGEGGRITKR 176

Query: 153 DIETLISTKTNVK-----DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIAC 207
           D++  +      +       + I+SF  VDE                  P   +RKTIA 
Sbjct: 177 DVDHYVPYDAPARPAGSGSAAMIESF--VDE------------------PISQMRKTIAR 216

Query: 208 RLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMI 267
           RL +SK T PHFY++I  ++DN ++ R+ MN      +E +  K+S ND+++KA A+A+ 
Sbjct: 217 RLAESKFTAPHFYLTISLDMDNAIAARKSMNS-----QEGV--KVSFNDMVIKAVAMALR 269

Query: 268 QVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAK 327
           + P  N SW  + + R+ HI I VAV++  G++ P++R AD K +  I  EVK LA +AK
Sbjct: 270 KHPAINSSWLGDVIRRNSHIHIGVAVAVEDGLLVPVVRFADSKGLTQIGDEVKVLATKAK 329

Query: 328 QRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATI 387
           ++KL+P E++G T +ISN+GM GI  F A++NPP S I+AIG   ++ V +N ++    I
Sbjct: 330 EKKLQPAEWEGNTFTISNLGMFGIEQFTAIVNPPDSCIMAIGGISQEPVVKNGQVVPGNI 389

Query: 388 MNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           M  TLS DHR+VDGA  +  L  FK+Y+ENPV ML+
Sbjct: 390 MKVTLSCDHRTVDGATGASFLQTFKQYMENPVMMLV 425


>gi|305664622|ref|YP_003860909.1| dihydrolipoyllysine-residue acetyltransferase component of
           pyruvatedehydrogenase complex [Maribacter sp. HTCC2170]
 gi|88708639|gb|EAR00875.1| dihydrolipoyllysine-residue acetyltransferase component of
           pyruvatedehydrogenase complex [Maribacter sp. HTCC2170]
          Length = 547

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 164/438 (37%), Positives = 247/438 (56%), Gaps = 34/438 (7%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGI------ 56
           +  + MP LS TM EG +A W+K+ GD +  GDIL EIETDKA MEFES   G       
Sbjct: 125 VEVVKMPRLSDTMEEGTVATWLKKVGDTVEEGDILAEIETDKATMEFESFYSGTLLYIGI 184

Query: 57  -------IDEILV---PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHS 106
                  +D +L    PAGT+  AV S       +S E            VE  EE    
Sbjct: 185 QEGESSPVDAVLAVIGPAGTDVDAVLSAAPGTGGESEETTK---------VEKTEEKKAE 235

Query: 107 SP--VVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNV 164
           +P   +    +   R  ASPLA+R+A E GI+LS + G+G HGRIVK D+E  + ++  V
Sbjct: 236 TPQETMAPSSNDGQRIFASPLAKRIATEKGINLSDVKGTGDHGRIVKKDVEGFVPSQKPV 295

Query: 165 KDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
           +  +   + G    ++ A ++    ++S E + +  +RKTIA RL +SK T PH+Y++I+
Sbjct: 296 QPIAVQDNAGASTSTVVAPLVLPVGEESSEEVKNSQMRKTIAKRLSESKFTAPHYYLTIE 355

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
            ++DN  + R Q+N       +    K+S ND+++KA A+A+ + P+ N +W  N    +
Sbjct: 356 VDMDNAKASRTQIN-------DLPDTKVSFNDMVVKACAMALKKHPQVNTTWNGNTTRYN 408

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
            H++I VAV++  G+V P+++  D  S+  I   VK LA RA+ +KL P E  G T ++S
Sbjct: 409 HHVNIGVAVAVEDGLVVPVVKSTDLLSLTQIGSAVKDLAGRARVKKLTPAEMDGSTFTVS 468

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIA 404
           N+GM GI  F ++IN P S IL++GA  +K V +N +I V   M  +L+ DHR+VDGA  
Sbjct: 469 NLGMFGILEFTSIINQPNSAILSVGAIIEKPVVKNGQIVVGNTMKLSLACDHRTVDGATG 528

Query: 405 SKLLAKFKEYIENPVWML 422
           ++ L   + ++ENPV ML
Sbjct: 529 AQFLQTLRAFLENPVTML 546



 Score = 78.2 bits (191), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 53/83 (63%), Gaps = 2/83 (2%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   I MP LS TM EG +AKW+KQ GDK+  GDIL EIETDKA MEFES  EG +  I 
Sbjct: 1  MAEVINMPRLSDTMEEGTVAKWLKQVGDKVEEGDILAEIETDKATMEFESFHEGTLLHIG 60

Query: 62 VPAGTENIAVNSPILNILMDSTE 84
          +  G +   V+S +L I+ D  E
Sbjct: 61 IAEG-DGAPVDS-LLAIIGDEGE 81


>gi|45190966|ref|NP_985220.1| AER364Wp [Ashbya gossypii ATCC 10895]
 gi|44984034|gb|AAS53044.1| AER364Wp [Ashbya gossypii ATCC 10895]
          Length = 453

 Score =  286 bits (731), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 172/452 (38%), Positives = 256/452 (56%), Gaps = 61/452 (13%)

Query: 4   HTI-TMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HTI  MP+LSPTMT+G LA W K+EGDK+SPG++L E+ETDKA M+FE  +EG + +ILV
Sbjct: 31  HTIIGMPALSPTMTQGNLAVWTKKEGDKLSPGEVLAEVETDKAQMDFEFQEEGFLAKILV 90

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLS-KENIVEVREEHSHSSPVV----------- 110
           P G +++ VN PI   + +  ++        +E+  E ++  +                 
Sbjct: 91  PEGAKDVPVNKPIAVYVEEEGDVAAFKDFKVEESAAESKDAPAKEEAAPAKAAPAAAAPA 150

Query: 111 ------VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNV 164
                      S  R +ASPLA+ +A E GI L  ++G+GP+GRI K D+E  ++ K   
Sbjct: 151 KAAKKSTGSAASGGRIMASPLAKTIALEKGISLKEVTGTGPNGRITKEDVEKYLA-KAPK 209

Query: 165 KDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
           K  S                    A  +YE +P  N+R+ I  RL QS Q+IP + +S D
Sbjct: 210 KTESAAAP----------------AAATYEDVPISNMRRVIGSRLLQSCQSIPSYPISSD 253

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN-AMIR 283
            ++  LL LR+ +N   +        K+S+NDI++KA A A  +VPEAN  W  +  +IR
Sbjct: 254 ISVAKLLKLRQSLNAAGKDQY-----KLSINDILIKAIAGAAKRVPEANAYWLEDQGVIR 308

Query: 284 -HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTS 342
             K++D+SVAV+ P G++TPI++ A+ K +  IS E+K+L +RAK+ KL P E+QGGT  
Sbjct: 309 LFKNVDVSVAVATPTGLITPIVKNAESKGLRSISAEIKELGKRAKENKLAPHEFQGGTIC 368

Query: 343 ISNMGM-LGINSFCAVINPPQSTILAIG----------AGEKKVVFQNEEIKVATIMNAT 391
           ISN+GM   ++SF ++INPPQSTIL+IG            E    F++        MN T
Sbjct: 369 ISNLGMNNAVSSFGSIINPPQSTILSIGTLRRVPVEDAGAEYGFTFEDR-------MNIT 421

Query: 392 LSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
              DHR++DGA A+  + + K  IENP+ +++
Sbjct: 422 GVFDHRTIDGARAADFMRELKNIIENPLELML 453


>gi|284035462|ref|YP_003385392.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Spirosoma linguale DSM 74]
 gi|283814755|gb|ADB36593.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Spirosoma linguale DSM 74]
          Length = 586

 Score =  286 bits (731), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 171/459 (37%), Positives = 249/459 (54%), Gaps = 54/459 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP +S TMTEG +  W K+EGD +  GD+L E+ETDKA M+ E+ +EG +  I V  G
Sbjct: 141 IRMPKMSDTMTEGTIVAWHKKEGDTVKSGDVLAEVETDKATMDLEAYEEGTLLYIGVKEG 200

Query: 66  TENIAVNSPI---------LNILMD--------------------STEIPPSPPLSKENI 96
           + ++AV+  I           +L+D                    + +  P   L     
Sbjct: 201 S-SVAVDEVIAVVGEKGANFKVLLDGGSGAPAAGQQAATGESGSATAQQNPQADLPANAD 259

Query: 97  VEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIET 156
            ++         V      S  R  ASPLA+R+A E GI+L+ + G+GP GRIVKSD+E+
Sbjct: 260 SDLSYAGGEGDAV-----GSNGRVKASPLAKRIAEEKGINLAQVQGTGPEGRIVKSDVES 314

Query: 157 LISTKTNVKDYSTIQSFGLVDESIDANILNLFAK------------DSYEVIPHDNIRKT 204
            +  K       T  +   V +          A               YE IP   +RKT
Sbjct: 315 FVPGKAAPAAQPTAPAAQPVAQPAAPAPAAAPAPAPAPTPAATSVGGDYEDIPVSQMRKT 374

Query: 205 IACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFAL 264
           IA RL +S  T PHFY++++ N+D  + LR  +N            K+S ND ++KA AL
Sbjct: 375 IARRLSESLFTAPHFYLTMEINMDKAMDLRGTVNGLSPV-------KVSFNDFVIKAAAL 427

Query: 265 AMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQ 324
           A+ Q P  N SW  + + ++K+++I VAV++  G++ P++R ADQK++  IS EVK LA 
Sbjct: 428 ALKQHPNVNSSWLGDKIRKYKYVNIGVAVAVDEGLLVPVVRNADQKTLSTISGEVKDLAG 487

Query: 325 RAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKV 384
           +AK +KL+P++++G T SISN+GM GI  F A+INPP S ILA+GA ++ V F+ E  K 
Sbjct: 488 KAKDKKLQPKDWEGSTFSISNLGMFGIEEFTAIINPPDSCILAVGAIKQTVKFEGEIAKP 547

Query: 385 ATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
             +M  TLS DHR VDGA  S  L  FK+ +E+P+ ML+
Sbjct: 548 TNVMKVTLSCDHRVVDGATGSAFLQTFKQLLEDPMRMLV 586



 Score = 70.1 bits (170), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 43/64 (67%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   I MP +S TMTEG +A+W K+ GDK+  GD+L E+ETDKA M+ E+ DEG +  I 
Sbjct: 1  MAELIRMPKMSDTMTEGVIAEWHKKVGDKVKSGDVLAEVETDKATMDLEAYDEGTLLYIG 60

Query: 62 VPAG 65
          V  G
Sbjct: 61 VEKG 64


>gi|195052453|ref|XP_001993301.1| GH13735 [Drosophila grimshawi]
 gi|193900360|gb|EDV99226.1| GH13735 [Drosophila grimshawi]
          Length = 504

 Score =  285 bits (730), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 160/446 (35%), Positives = 240/446 (53%), Gaps = 50/446 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM  G +  W K+EGDK++ GD+LCEIETDKA M FE+ +EG + +ILVP G
Sbjct: 81  VPLPALSPTMDRGSIVSWEKKEGDKLNEGDLLCEIETDKATMGFETPEEGYLAKILVPGG 140

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKEN-------------------------IVEVR 100
           + ++ V   +  I+ D   I        ++                              
Sbjct: 141 SRDVPVGKLVCIIVPDEGSIAAFADFKDDSPAGAPAPAAAAAAPPPPPPVAVPVAAPVAA 200

Query: 101 EEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST 160
                 +           R  ASP+A++LA    + L    GSG HG +   D+    + 
Sbjct: 201 APEPPPAAAPGTATAPGGRVYASPMAKKLAETQKMRLQG-KGSGVHGSLKSGDLAASQAA 259

Query: 161 KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
                            E   A+         ++ IP   +R  IA RL +SKQ +PH+Y
Sbjct: 260 -----------------EQPLAHPPAAAPGARFKDIPLTTMRSVIAKRLLESKQNLPHYY 302

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           V++ C ID L+  R  +N+  ++ +E    ++S+ND I+KA  +A  +VPEAN SW    
Sbjct: 303 VTVQCQIDKLMEFRAHVNK--KYEKE--GARVSINDFIIKAIGIASRKVPEANSSWMNTF 358

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           +  +  +D+SVAVS   G++TPI+  AD+K +L+IS  VK+LA +A+  KL+P+E+QGGT
Sbjct: 359 IREYDDVDVSVAVSTDKGLITPIVFGADRKGVLEISRNVKELAGKARANKLQPQEFQGGT 418

Query: 341 TSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE---IKVATIMNATLSADHR 397
            S+SN+GM G+N FCAVINPPQS ILAIG   K +V   +     K   ++  TLSADHR
Sbjct: 419 ISVSNLGMFGVNQFCAVINPPQSCILAIGTTTKSLVLAPDSPQGFKEVNMLTVTLSADHR 478

Query: 398 SVDGAIASKLLAKFKEYIENPVWMLM 423
            VDGA+A+  L  F++++E+P  M++
Sbjct: 479 VVDGAVAAVWLKHFRDFMEDPQTMIL 504


>gi|126662322|ref|ZP_01733321.1| dihydrolipoyllysine-residue acetyltransferase (dihydrolipoamide
           S-acetyltransferase) [Flavobacteria bacterium BAL38]
 gi|126625701|gb|EAZ96390.1| dihydrolipoyllysine-residue acetyltransferase (dihydrolipoamide
           S-acetyltransferase) [Flavobacteria bacterium BAL38]
          Length = 538

 Score =  285 bits (730), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 168/442 (38%), Positives = 256/442 (57%), Gaps = 44/442 (9%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGI------ 56
           +  +TMP LS TMT G +A W+K+ GD ++ GDIL EIETDKA MEFES + G       
Sbjct: 118 VKVVTMPRLSDTMTTGTVATWLKKVGDAVNEGDILAEIETDKATMEFESFNAGTLLYIGV 177

Query: 57  -------IDEILV---PAGTE--NIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHS 104
                  +D IL    PAGT+   IA N     ++   T    S   ++E +V   E  +
Sbjct: 178 QEGDSAPVDTILAILGPAGTDVSGIAANYKAGAVVDSET----SETKAEEKVVSQTETTN 233

Query: 105 HSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETL----IST 160
           +     +   ++  R  ASPLA+++A + GI+LS + GSG +GRIVKSD+E      ++T
Sbjct: 234 NQ----IESTNNTGRIFASPLAKKIAQDKGINLSQVKGSGENGRIVKSDVENFSPSSVAT 289

Query: 161 KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
                + +T  +   V   + A    +F     E I +  +RKTIA RL +SK T PH+Y
Sbjct: 290 PAQAIEQAT-NTVAAVKPFVPAG--EIF----QEEIKNSQMRKTIARRLSESKFTAPHYY 342

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           ++I+ ++DN ++ R  +N            K+S ND+++KA A+A+ + P+ N  W  +A
Sbjct: 343 LTIELDMDNAIASRNMINGLPD-------TKVSFNDMVIKASAMALKKHPQVNSQWREDA 395

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           M+ + H++I VAV++  G++ P+++  DQ S+  I   VK LA +AK +K++P E +G T
Sbjct: 396 MVINHHVNIGVAVAVEDGLMVPVLKFTDQMSLTQIGASVKDLAGKAKSKKIQPSEMEGST 455

Query: 341 TSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVD 400
            +ISN+GM GI SF ++IN P S IL++GA  +K V +  +I V   M  TL+ DHR+VD
Sbjct: 456 FTISNLGMFGIQSFTSIINQPNSAILSVGAIIEKPVVKKGQIVVGNTMVVTLACDHRTVD 515

Query: 401 GAIASKLLAKFKEYIENPVWML 422
           GA  ++ L  FK ++ENPV ML
Sbjct: 516 GATGAQFLQTFKSFMENPVTML 537



 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 66/115 (57%), Gaps = 9/115 (7%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   ITMP LS TMTEG +A W+K+ GD I  GDIL EIETDKA MEFE+  +G++  I 
Sbjct: 1   MAQIITMPRLSDTMTEGVVASWLKKVGDTIKTGDILAEIETDKATMEFEAFYDGVLLHIG 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHS 116
           +  G ++  V+S +  I     +I  S  LS  N  E +EE       VV+E  S
Sbjct: 61  IQEG-QSAPVDSLLAIIGAAGEDI--SALLSGGNATETKEEK------VVQETKS 106


>gi|6324258|ref|NP_014328.1| Lat1p [Saccharomyces cerevisiae S288c]
 gi|129060|sp|P12695|ODP2_YEAST RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component of pyruvate dehydrogenase complex,
           mitochondrial; AltName: Full=Dihydrolipoamide
           acetyltransferase component of pyruvate dehydrogenase
           complex; AltName: Full=Pyruvate dehydrogenase complex
           component E2; Short=PDC-E2; Short=PDCE2; Flags:
           Precursor
 gi|170972|gb|AAA34385.1| dihydrolipoamide acetyltransferase precursor (EC 2.3.1.12)
           [Saccharomyces cerevisiae]
 gi|791115|emb|CAA60189.1| dihydrolipoamide S-acetyltransferase [Saccharomyces cerevisiae]
 gi|1301955|emb|CAA95945.1| LAT1 [Saccharomyces cerevisiae]
 gi|51013821|gb|AAT93204.1| YNL071W [Saccharomyces cerevisiae]
 gi|207341691|gb|EDZ69677.1| YNL071Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|285814580|tpg|DAA10474.1| TPA: Lat1p [Saccharomyces cerevisiae S288c]
          Length = 482

 Score =  285 bits (730), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 173/461 (37%), Positives = 257/461 (55%), Gaps = 53/461 (11%)

Query: 4   HTI-TMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HTI  MP+LSPTMT+G LA W K+EGD++SPG+++ EIETDKA M+FE  ++G + +ILV
Sbjct: 34  HTIIGMPALSPTMTQGNLAAWTKKEGDQLSPGEVIAEIETDKAQMDFEFQEDGYLAKILV 93

Query: 63  PAGTENIAVNSPILNILMDSTEIP---------------------PSPPLSKENIVEVRE 101
           P GT++I VN PI   + D  ++P                     P+ P +++      E
Sbjct: 94  PEGTKDIPVNKPIAVYVEDKADVPAFKDFKLEDSGSDSKTSTKAQPAEPQAEKKQEAPAE 153

Query: 102 EHSHSSPVVVREKHS--KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI- 158
           E   S+P   +   +  + R  ASPLA+ +A E GI L  + G+GP GRI K+DIE+ + 
Sbjct: 154 ETKTSAPEAKKSDVAAPQGRIFASPLAKTIALEKGISLKDVHGTGPRGRITKADIESYLE 213

Query: 159 ---STKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQT 215
                 +     +          +   +  +  +  SYE +P   +R  I  RL QS Q 
Sbjct: 214 KSSKQSSQTSGAAAATPAAATSSTTAGSAPSPSSTASYEDVPISTMRSIIGERLLQSTQG 273

Query: 216 IPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVS 275
           IP + VS   +I  LL LR+ +N T          K+S+ND+++KA  +A  +VP+AN  
Sbjct: 274 IPSYIVSSKISISKLLKLRQSLNATANDKY-----KLSINDLLVKAITVAAKRVPDANAY 328

Query: 276 WTTNAMI--RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKP 333
           W  N  +  + K++D+SVAV+ P G++TPI++  + K +  IS E+K+L +RA+  KL P
Sbjct: 329 WLPNENVIRKFKNVDVSVAVATPTGLLTPIVKNCEAKGLSQISNEIKELVKRARINKLAP 388

Query: 334 EEYQGGTTSISNMGM-LGINSFCAVINPPQSTILAI----------GAGEKKVVFQNEEI 382
           EE+QGGT  ISNMGM   +N F ++INPPQSTILAI           A E    F N+  
Sbjct: 389 EEFQGGTICISNMGMNNAVNMFTSIINPPQSTILAIATVERVAVEDAAAENGFSFDNQ-- 446

Query: 383 KVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
                +  T + DHR++DGA  ++ + + K  IENP+ ML+
Sbjct: 447 -----VTITGTFDHRTIDGAKGAEFMKELKTVIENPLEMLL 482


>gi|260827451|ref|XP_002608678.1| hypothetical protein BRAFLDRAFT_58105 [Branchiostoma floridae]
 gi|229294030|gb|EEN64688.1| hypothetical protein BRAFLDRAFT_58105 [Branchiostoma floridae]
          Length = 425

 Score =  285 bits (730), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 168/443 (37%), Positives = 252/443 (56%), Gaps = 52/443 (11%)

Query: 15  MTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSP 74
           M  G +  W KQ GD+++ GD+L EIETDKA M FE+ +EG +  I + AG ++I +   
Sbjct: 1   MEMGTIVSWEKQVGDQLNEGDLLAEIETDKATMGFETPEEGYLARIFIEAGEKDIPIGK- 59

Query: 75  ILNILMDSTE--------IPPSPPLSKENIVEVREEHSHSSPVVVREKHSKN-------- 118
           +L I++++ +        IPP+   S E  +      S S+P                  
Sbjct: 60  LLCIIVENEDDIAKFKDWIPPADAESAEKPLPKPVSESPSTPPPAAAAPPPPPPPPMAAM 119

Query: 119 ---------------RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
                          R  ASPLA++LA + GIDLS +SG+GP GRI   DIE        
Sbjct: 120 PPPPTPAAPPPTPGARVFASPLAKKLAADKGIDLSLVSGTGPGGRIRSQDIEAFTPAAAP 179

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
               +                       ++  IP  N+RK IA RL QSK TIPH+Y+S+
Sbjct: 180 APAVAPAAP-------------AAAPVGTFVDIPLTNVRKVIASRLLQSKTTIPHYYLSV 226

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           D N+DN+++LR+++N  ++  +E++  K+SVND I+KA AL+ ++VPE N SW  + + +
Sbjct: 227 DINMDNVIALRKELNAIVE--KEDV--KLSVNDFIIKAAALSCLKVPECNSSWMDSVIRQ 282

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
           +  +D++VAVS   G++TPI+  A  K +  I+ +V  LA RA++ KL+ +E+QGGT ++
Sbjct: 283 YNKVDVNVAVSTDSGLITPIVFNAHTKGLAAINSDVISLAARAREGKLQLQEFQGGTFTV 342

Query: 344 SNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE---IKVATIMNATLSADHRSVD 400
           SN+GM GI +F AVINPPQ+ ILA+G   K VV   +    + VAT+M+ TLS DHR VD
Sbjct: 343 SNLGMFGIKNFSAVINPPQACILAVGGAVKTVVPDADAENGLSVATMMSVTLSCDHRVVD 402

Query: 401 GAIASKLLAKFKEYIENPVWMLM 423
           GA+ ++ L +FK Y+E P  ML+
Sbjct: 403 GAVGAQWLQEFKLYLEKPETMLL 425


>gi|302774749|ref|XP_002970791.1| hypothetical protein SELMODRAFT_94277 [Selaginella moellendorffii]
 gi|302806743|ref|XP_002985103.1| hypothetical protein SELMODRAFT_121442 [Selaginella moellendorffii]
 gi|300147313|gb|EFJ13978.1| hypothetical protein SELMODRAFT_121442 [Selaginella moellendorffii]
 gi|300161502|gb|EFJ28117.1| hypothetical protein SELMODRAFT_94277 [Selaginella moellendorffii]
          Length = 446

 Score =  285 bits (729), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 174/435 (40%), Positives = 262/435 (60%), Gaps = 31/435 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MPSLSPTMT+G + KW K+EGDK++ GD+LCEIETDKA ++ E +++G + +I+   G
Sbjct: 26  LGMPSLSPTMTQGNIVKWKKKEGDKVTAGDVLCEIETDKATVDMECMEDGYLAKIVFSDG 85

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK-------- 117
            ++I V   I   + +  +I        +      +     SP   +   S         
Sbjct: 86  AKDIKVGQIIAITVEEQGDIDKFKDYKADAPAAPPKPAPKESPPPPKPTESPKPAPSPKP 145

Query: 118 ------NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
                 +R IASP AR+ A ++ I LS ++G+GP GRIV++D+  ++           +Q
Sbjct: 146 APAASGDRIIASPNARKYAQDNQISLSGVAGTGPGGRIVRADLLIVVFIGGQ-----QVQ 200

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
                +   D+  L+      Y  +P+  IR+ IA RL QSKQTIPH+Y+++D  +D LL
Sbjct: 201 EPRRAETPGDSTSLD------YTDLPNTQIRRVIAQRLLQSKQTIPHYYLTVDVRVDKLL 254

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISV 291
           +LR Q+N  L+   +E   K+SVND +LKA ALA+ +VPE N SWT   + +  +I+ISV
Sbjct: 255 ALRTQLNAKLE---KEKRKKLSVNDFVLKAAALALKKVPECNSSWTDEFIRQFHNINISV 311

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM-LG 350
           AV    G++ P+++ AD+K +  IS +V+ LA++A++  LKP +Y GGT ++SN+G   G
Sbjct: 312 AVQTERGLMVPVVKDADKKGLGAISDDVRTLAEKARENTLKPSDYDGGTFTVSNLGGPFG 371

Query: 351 INSFCAVINPPQSTILAIGAGEKKVV--FQNEEIKVATIMNATLSADHRSVDGAIASKLL 408
           I  FCA+INPPQS ILA+G  +K+V+    + E   AT M+ATLS DHR VDGAI +  L
Sbjct: 372 IKQFCAIINPPQSCILAVGTTDKRVIPGENDGEYTAATFMSATLSCDHRVVDGAIGAHWL 431

Query: 409 AKFKEYIENPVWMLM 423
             FK YIE+P+ +L+
Sbjct: 432 GAFKGYIEDPMTLLL 446


>gi|323346905|gb|EGA81184.1| Lat1p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 482

 Score =  285 bits (729), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 172/461 (37%), Positives = 257/461 (55%), Gaps = 53/461 (11%)

Query: 4   HTI-TMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HTI  MP+LSPTMT+G LA W K+EGD++SPG+++ EIETDKA M+FE  ++G + +ILV
Sbjct: 34  HTIIGMPALSPTMTQGNLAAWTKKEGDQLSPGEVIAEIETDKAQMDFEFQEDGYLAKILV 93

Query: 63  PAGTENIAVNSPILNILMDSTEIP---------------------PSPPLSKENIVEVRE 101
           P GT++I VN PI   + D  ++P                     P+ P +++      E
Sbjct: 94  PEGTKDIPVNKPIAVYVEDKADVPAFKDFKLEDSGSDSKTSTKAQPAEPQAEKKQEAPAE 153

Query: 102 EHSHSSPVVVREKHS--KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI- 158
           E   S+P   +   +  + R  ASPLA+ +A E GI L  + G+GP GRI K+DIE+ + 
Sbjct: 154 ETKTSAPEAKKSDVAAPQGRIFASPLAKTIALEKGISLKDVHGTGPRGRITKADIESYLE 213

Query: 159 ---STKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQT 215
                 +     +          +   +  +  +  SYE +P   +R  I  RL QS Q 
Sbjct: 214 KSSKXSSQTSGAAAATPAAATSXTTAGSAPSPSSTASYEDVPISTMRSIIGERLLQSTQG 273

Query: 216 IPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVS 275
           IP + VS   ++  LL LR+ +N T          K+S+ND+++KA  +A  +VP+AN  
Sbjct: 274 IPSYIVSSKISVSKLLKLRQSLNATANDKY-----KLSINDLLVKAITVAAKRVPDANAY 328

Query: 276 WTTNAMI--RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKP 333
           W  N  +  + K++D+SVAV+ P G++TPI++  + K +  IS E+K+L +RA+  KL P
Sbjct: 329 WLPNENVIRKFKNVDVSVAVATPTGLLTPIVKNCEAKGLSQISNEIKELVKRARINKLAP 388

Query: 334 EEYQGGTTSISNMGM-LGINSFCAVINPPQSTILAI----------GAGEKKVVFQNEEI 382
           EE+QGGT  ISNMGM   +N F ++INPPQSTILAI           A E    F N+  
Sbjct: 389 EEFQGGTICISNMGMNNAVNMFTSIINPPQSTILAIATVERVAVEDAAAENGFSFDNQ-- 446

Query: 383 KVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
                +  T + DHR++DGA  ++ + + K  IENP+ ML+
Sbjct: 447 -----VTITGTFDHRTIDGAKGAEFMKELKTVIENPLEMLL 482


>gi|255718285|ref|XP_002555423.1| KLTH0G08998p [Lachancea thermotolerans]
 gi|238936807|emb|CAR24986.1| KLTH0G08998p [Lachancea thermotolerans]
          Length = 471

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 169/456 (37%), Positives = 260/456 (57%), Gaps = 53/456 (11%)

Query: 4   HT-ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HT I MP+LSPTMT+G +A W KQ GDK+ PG+ + EIETDKA M+FE  ++G + +IL 
Sbjct: 33  HTVIGMPALSPTMTQGNIAVWNKQVGDKLEPGEAIAEIETDKAQMDFEFQEDGFLAKILE 92

Query: 63  PAGTENIAVNSPILNILMDSTEIPP---------SPPLSKENIVEVREEHSHSS------ 107
           PAG +++ V  PI   + +  ++           +P  S++ + + +    + S      
Sbjct: 93  PAGAKDLPVGKPIAVYVEEEGDVAAFKDFKVEETAPAKSEKPVADAKPAEDNKSAKDDKP 152

Query: 108 ---PVVVRE----KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST 160
              P   ++    K + +R  ASPLA+ +A +HG+ L S++G+GPHGRI KSD+E  +S 
Sbjct: 153 AKKPSASKQAASGKPAGDRIFASPLAKNIALQHGVALKSVTGTGPHGRITKSDVEEFLS- 211

Query: 161 KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
               K  +          +  A          YE IP  N+RK I  RL +S    P + 
Sbjct: 212 ----KSPAASAGGSAAAGTAAAAAAPAGPGAQYEDIPISNMRKIIGDRLLESTSGTPAYI 267

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           VS   ++  LL LR+ +N + +        K+SVND+++KA  +A  +VP+AN  W  N 
Sbjct: 268 VSSQISVSKLLKLRQSLNASGKDQY-----KLSVNDMLIKAVTVAAQRVPDANAYWLANE 322

Query: 281 MI--RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQG 338
            +  + K++D+SVAV+ P G++TPI++ A  K ++ IS E+K+L +RAK  KLKPEE+QG
Sbjct: 323 GVIRKFKNVDVSVAVATPNGLLTPIVKNAHAKGLVSISSEIKELGKRAKINKLKPEEFQG 382

Query: 339 GTTSISNMGM-LGINSFCAVINPPQSTILAIG----------AGEKKVVFQNEEIKVATI 387
           GT  ISN+GM   ++ F ++INPPQSTILAIG            E   +F+++       
Sbjct: 383 GTICISNLGMNNAVSMFTSIINPPQSTILAIGTVQRVPVEDAGAEYGFIFEDK------- 435

Query: 388 MNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           +N T + DHR++DGA A   + + K+ +ENP+ ML+
Sbjct: 436 INITGTFDHRTIDGARAGDFMRELKKVVENPLEMLL 471


>gi|296412220|ref|XP_002835823.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295629618|emb|CAZ79980.1| unnamed protein product [Tuber melanosporum]
          Length = 414

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 179/445 (40%), Positives = 251/445 (56%), Gaps = 60/445 (13%)

Query: 8   MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTE 67
           MP+LSPTMT G +  W    GD I+PGD L EIETDKA M+FE  ++G++ +IL P+G+ 
Sbjct: 1   MPALSPTMTSGNIGSWQMSVGDTIAPGDSLVEIETDKAQMDFEYQEDGVLAKILKPSGST 60

Query: 68  NIAVNSPILNILMDSTEI-----------------PPSPPLSKENIVEV--REEHSHSSP 108
           ++AV +PI  I+ D T+I                 PP P     +  E+   EE + S  
Sbjct: 61  DVAVGNPIAVIVEDGTDISAFGDFTVESAEGGAGAPPPPEGESLDSPELPKSEEPASSGG 120

Query: 109 VVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYS 168
            +        R IASPLA+++A E GI L  + G+G  GRI K D+E   S  T +   S
Sbjct: 121 RLETVLERDGRIIASPLAKKIALEKGIALKGIKGTGEGGRITKYDVENYES--TGISSAS 178

Query: 169 TIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNID 228
            + +    D                  IP  ++RKTIA RLQ SK T PH+YVS   ++ 
Sbjct: 179 GMPAVVSTD------------------IPLTSMRKTIASRLQASKNTNPHYYVSASLSVS 220

Query: 229 NLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN-AMIRH-KH 286
            LL LR+ +N + +        K+SVND ++KA A A+++VP  N S+  +  +IR    
Sbjct: 221 KLLKLRQALNTSAKGEY-----KLSVNDFLIKAVANALLKVPTVNSSYREDEGVIRQFST 275

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
            DISVAV+ P G++TPI++ AD + ++ IS EVK L+ RA+  KLKPEEYQGGT +ISNM
Sbjct: 276 ADISVAVATPVGLMTPIVKNADARGLVSISNEVKSLSGRARDGKLKPEEYQGGTFTISNM 335

Query: 347 GM-LGINSFCAVINPPQSTILAIGA-------GEKKVVFQNEEIKVATIMNATLSADHRS 398
           GM   +  F A+INPPQ+ ILA+G        G+   V  +E+I V      T S DHR 
Sbjct: 336 GMNPAVERFTAIINPPQAGILAVGTIKKVAVEGKDGGVEWDEQIVV------TGSFDHRV 389

Query: 399 VDGAIASKLLAKFKEYIENPVWMLM 423
           VDGA+  + L + K+ IE+P+ ML+
Sbjct: 390 VDGAVGGEFLRELKKLIESPLEMLL 414


>gi|151944463|gb|EDN62741.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           component (E2) [Saccharomyces cerevisiae YJM789]
          Length = 482

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 172/461 (37%), Positives = 257/461 (55%), Gaps = 53/461 (11%)

Query: 4   HTI-TMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HTI  MP+LSPTMT+G LA W K+EGD++SPG+++ EIETDKA M+FE  ++G + +ILV
Sbjct: 34  HTIIGMPALSPTMTQGNLAAWTKKEGDQLSPGEVIAEIETDKAQMDFEFQEDGYLAKILV 93

Query: 63  PAGTENIAVNSPILNILMDSTEIP---------------------PSPPLSKENIVEVRE 101
           P GT++I VN PI   + D  ++P                     P+ P +++      E
Sbjct: 94  PEGTKDIPVNKPIAVYVEDKADVPAFKDFKLEDSGSDAKTSTKAQPAEPQAEKKQEAPAE 153

Query: 102 EHSHSSPVVVREKHS--KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI- 158
           E   S+P   +   +  + R  ASPLA+ +A E GI L  + G+GP GRI K+DIE+ + 
Sbjct: 154 ETKTSAPEAKKSDVAAPQGRIFASPLAKTIALEKGISLKDVHGTGPRGRITKADIESYLE 213

Query: 159 ---STKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQT 215
                 +     +          +   +  +  +  SYE +P   +R  I  RL QS Q 
Sbjct: 214 KSSKQSSQTSGAAAATPAAATSSTTAGSAPSPSSTASYEDVPISTMRSIIGERLLQSTQG 273

Query: 216 IPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVS 275
           IP + VS   ++  LL LR+ +N T          K+S+ND+++KA  +A  +VP+AN  
Sbjct: 274 IPSYIVSSKISVSKLLKLRQSLNATANDKY-----KLSINDLLVKAITVAAKRVPDANAY 328

Query: 276 WTTNAMI--RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKP 333
           W  N  +  + K++D+SVAV+ P G++TPI++  + K +  IS E+K+L +RA+  KL P
Sbjct: 329 WLPNENVIRKFKNVDVSVAVATPTGLLTPIVKNCEAKGLSQISNEIKELVKRARINKLAP 388

Query: 334 EEYQGGTTSISNMGM-LGINSFCAVINPPQSTILAI----------GAGEKKVVFQNEEI 382
           EE+QGGT  ISNMGM   +N F ++INPPQSTILAI           A E    F N+  
Sbjct: 389 EEFQGGTICISNMGMNNAVNMFTSIINPPQSTILAIATVERVAVEDAAAENGFSFDNQ-- 446

Query: 383 KVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
                +  T + DHR++DGA  ++ + + K  IENP+ ML+
Sbjct: 447 -----VTITGTFDHRTIDGAKGAEFMKELKTVIENPLEMLL 482


>gi|190409060|gb|EDV12325.1| hypothetical protein SCRG_03207 [Saccharomyces cerevisiae RM11-1a]
 gi|256274454|gb|EEU09356.1| Lat1p [Saccharomyces cerevisiae JAY291]
 gi|323335819|gb|EGA77098.1| Lat1p [Saccharomyces cerevisiae Vin13]
 gi|323352576|gb|EGA85075.1| Lat1p [Saccharomyces cerevisiae VL3]
          Length = 482

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 172/461 (37%), Positives = 257/461 (55%), Gaps = 53/461 (11%)

Query: 4   HTI-TMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HTI  MP+LSPTMT+G LA W K+EGD++SPG+++ EIETDKA M+FE  ++G + +ILV
Sbjct: 34  HTIIGMPALSPTMTQGNLAAWTKKEGDQLSPGEVIAEIETDKAQMDFEFQEDGYLAKILV 93

Query: 63  PAGTENIAVNSPILNILMDSTEIP---------------------PSPPLSKENIVEVRE 101
           P GT++I VN PI   + D  ++P                     P+ P +++      E
Sbjct: 94  PEGTKDIPVNKPIAVYVEDKADVPAFKDFKLEDSGSDSKTSTKAQPAEPQAEKKQEAPAE 153

Query: 102 EHSHSSPVVVREKHS--KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI- 158
           E   S+P   +   +  + R  ASPLA+ +A E GI L  + G+GP GRI K+DIE+ + 
Sbjct: 154 ETKTSAPEAKKSDVAAPQGRIFASPLAKTIALEKGISLKDVHGTGPRGRITKADIESYLE 213

Query: 159 ---STKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQT 215
                 +     +          +   +  +  +  SYE +P   +R  I  RL QS Q 
Sbjct: 214 KSSKQSSQTSGAAAATPAAATSSTTAGSAPSPSSTASYEDVPISTMRSIIGERLLQSTQG 273

Query: 216 IPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVS 275
           IP + VS   ++  LL LR+ +N T          K+S+ND+++KA  +A  +VP+AN  
Sbjct: 274 IPSYIVSSKISVSKLLKLRQSLNATANDKY-----KLSINDLLVKAITVAAKRVPDANAY 328

Query: 276 WTTNAMI--RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKP 333
           W  N  +  + K++D+SVAV+ P G++TPI++  + K +  IS E+K+L +RA+  KL P
Sbjct: 329 WLPNENVIRKFKNVDVSVAVATPTGLLTPIVKNCEAKGLSQISNEIKELVKRARINKLAP 388

Query: 334 EEYQGGTTSISNMGM-LGINSFCAVINPPQSTILAI----------GAGEKKVVFQNEEI 382
           EE+QGGT  ISNMGM   +N F ++INPPQSTILAI           A E    F N+  
Sbjct: 389 EEFQGGTICISNMGMNNAVNMFTSIINPPQSTILAIATVERVAVEDAAAENGFSFDNQ-- 446

Query: 383 KVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
                +  T + DHR++DGA  ++ + + K  IENP+ ML+
Sbjct: 447 -----VTITGTFDHRTIDGAKGAEFMKELKTVIENPLEMLL 482


>gi|86143916|ref|ZP_01062284.1| Dihydrolipoamide acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [Leeuwenhoekiella blandensis
           MED217]
 gi|85829623|gb|EAQ48086.1| Dihydrolipoamide acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [Leeuwenhoekiella blandensis
           MED217]
          Length = 559

 Score =  284 bits (727), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 163/445 (36%), Positives = 246/445 (55%), Gaps = 48/445 (10%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGI------ 56
           +  +TMP LS TM EG +A W+K+EGD +  GDIL EIETDKA MEFES  +G       
Sbjct: 137 VEVVTMPRLSDTMEEGTVASWLKKEGDSVDEGDILAEIETDKATMEFESFYKGTLLHIGI 196

Query: 57  -------IDEILVPAGTENIAVNSPILNI------------LMDSTEIPPSPPLSKENIV 97
                  +D +L   G E   V+  I N                  +  P    +K+   
Sbjct: 197 QEGETAKVDSLLAIIGEEGTDVSGVISNFKSGGAKKEAPKKEEKPKKEAPKKEEAKKEAP 256

Query: 98  EVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETL 157
           +        S        S  R  ASPLA++LA E GIDL+ + GSG +GR+V+ DIE  
Sbjct: 257 KKEAPKKEESKPAKNTSSSDGRIFASPLAKKLAEEKGIDLAKVPGSGENGRVVRKDIENY 316

Query: 158 ISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIP 217
               +     + +Q F    E            +SYE + +  +RK IA  L +SK T P
Sbjct: 317 TPAASG----AGVQQFVATGE------------ESYEDVNNSQMRKAIAKSLGKSKFTAP 360

Query: 218 HFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWT 277
           H+Y++++ +++N+++ R Q N+           K+S ND+I+KA ++A+ Q P+ N  W 
Sbjct: 361 HYYLNVEFDMENMIAFRSQFNQLPD-------TKVSYNDMIIKAVSIALKQHPQVNSQWF 413

Query: 278 TNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQ 337
            + M  + H+ I VAV++P G+V P++  A++KS+  I+ EVK+LA +A+ +KLKPEE Q
Sbjct: 414 DDKMRLNNHVHIGVAVAVPDGLVVPVVEFANEKSLQQINAEVKELAGKARNKKLKPEEMQ 473

Query: 338 GGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHR 397
           G T +ISN+GM GI +F ++IN P S IL++G+  +K V ++ +I V   M  +++ DHR
Sbjct: 474 GSTFTISNLGMFGITNFTSIINQPNSAILSVGSIIEKPVVKDGKIVVGNTMTLSMACDHR 533

Query: 398 SVDGAIASKLLAKFKEYIENPVWML 422
           ++DGA  ++ L   K YIENPV ML
Sbjct: 534 TIDGATGAQFLQTLKTYIENPVLML 558



 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 46/69 (66%), Gaps = 1/69 (1%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   I MP LS TM EG +A W+K++GDK+  GDIL EIETDKA MEFES  EG +  I 
Sbjct: 1  MAEVIKMPRLSDTMEEGTVASWLKKKGDKVEEGDILAEIETDKATMEFESFYEGTLLHIG 60

Query: 62 VPAG-TENI 69
          +  G T N+
Sbjct: 61 IEEGETANV 69


>gi|163754146|ref|ZP_02161269.1| dihydrolipoyllysine-residue acetyltransferase (dihydrolipoamide
           S-acetyltransferase) [Kordia algicida OT-1]
 gi|161326360|gb|EDP97686.1| dihydrolipoyllysine-residue acetyltransferase (dihydrolipoamide
           S-acetyltransferase) [Kordia algicida OT-1]
          Length = 559

 Score =  284 bits (727), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 164/435 (37%), Positives = 241/435 (55%), Gaps = 26/435 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGI--------- 56
           +TMP LS TM EG +A W+KQ GDK+  GDIL EIETDKA MEFES +EG          
Sbjct: 132 VTMPRLSDTMEEGTVASWLKQVGDKVEEGDILAEIETDKATMEFESFNEGTLLYIGVQEG 191

Query: 57  ----IDEILVPAGTENIAVNSPIL-----NILMDSTEIPPSPPLSKENIVEVREEHSHSS 107
               +D IL   G E   V++ +      N   ++T              E +E  +   
Sbjct: 192 ETAPVDSILAVIGKEGTDVDAVLKANDSGNASAETTTEEAPKEEKAAKKEETKETETKEE 251

Query: 108 PVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDY 167
           P       S  R IASPLA+++A + GIDLS + G+G HGRI+K D+E            
Sbjct: 252 PKASGNASSNGRIIASPLAKKIAADKGIDLSEVKGTGDHGRIIKRDVENFTPAAKEASAA 311

Query: 168 STIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNI 227
               S      S  A  +    ++S E   +  +RKTIA RL +SK + PH+Y++++ ++
Sbjct: 312 KETSSKSAEATSAPAPFVPA-GEESSEEAKNSQMRKTIARRLGESKFSAPHYYLTVELDM 370

Query: 228 DNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI 287
           DN ++ R+ +N            K+S ND+I+KA A+A+ + P+ N +W   +   HKHI
Sbjct: 371 DNAIASRKTINAIPDI-------KVSFNDMIVKACAMALRKHPQVNTTWNDASTTYHKHI 423

Query: 288 DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMG 347
            + VAV++  G++ P+++ ADQ S+  I   V+ LA +A+ +K+ P E +G T +ISN+G
Sbjct: 424 HVGVAVAVDDGLLVPVLKFADQMSLTTIGANVRDLAGKARNKKISPAEMEGSTFTISNLG 483

Query: 348 MLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKL 407
           M GI  F ++IN P S IL++G   +K V +N EI V   M  TL+ DHR+VDGA  ++ 
Sbjct: 484 MFGILEFTSIINQPNSAILSVGTIVQKPVVKNGEIVVGNTMKVTLACDHRTVDGATGAQF 543

Query: 408 LAKFKEYIENPVWML 422
           L   K+Y+ENPV ML
Sbjct: 544 LQTVKQYVENPVTML 558



 Score = 73.6 bits (179), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/83 (51%), Positives = 52/83 (62%), Gaps = 2/83 (2%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   I MP LS TM EG +A W+K+ GDK+  GDIL EIETDKA MEFES  EG +  I 
Sbjct: 1  MAEIINMPRLSDTMEEGVVASWLKKVGDKVEEGDILAEIETDKATMEFESFHEGTLLYIG 60

Query: 62 VPAGTENIAVNSPILNILMDSTE 84
          V  G E   V++ +L I+ D  E
Sbjct: 61 VQEG-ETAPVDT-LLAIIGDEGE 81


>gi|330794208|ref|XP_003285172.1| hypothetical protein DICPUDRAFT_149003 [Dictyostelium purpureum]
 gi|325084893|gb|EGC38311.1| hypothetical protein DICPUDRAFT_149003 [Dictyostelium purpureum]
          Length = 631

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 163/442 (36%), Positives = 245/442 (55%), Gaps = 44/442 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVD-EGIIDEILVPA 64
           + MP+LSP+M  G +A W K+ GD+I  GD++ ++ETDKA M+F   +  G + +ILVP 
Sbjct: 210 VGMPALSPSMETGGIASWAKKVGDQIKAGDVVAQVETDKATMDFVYEEGNGYLAKILVPE 269

Query: 65  GTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASP 124
           GT  + +N P+  I     +       + E+        SH  P  V    S     AS 
Sbjct: 270 GTTGVQINQPVFVIASKKEDCDKFADFTAES------NESHEEPAAVESSESSESSTAST 323

Query: 125 LAR------RLAGEH--------------GIDLSSLSGSGPHGRIVKSDIETLISTKTNV 164
                    R AGE               G D+S ++G+GP+ R++KSD+      +   
Sbjct: 324 TTTSTTTATRAAGERVFASPAARAAAASKGFDVSQITGTGPNNRVIKSDVLEFTPQQKQA 383

Query: 165 KDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
           +  +T  +      +  +         ++   PH NIR+  A RL +SKQTIPH+Y++++
Sbjct: 384 EAPATAAAKKPTATAAPST-------GTFTDFPHSNIRRVTAARLTESKQTIPHYYLTME 436

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
           C +D +L +R+++N            K+SVND I+KA A A+   P  N +WT + + R 
Sbjct: 437 CRVDKILKMRQELNAGNTV-------KLSVNDFIIKAAAAALRDNPVVNSTWTDSYIRRF 489

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
            +IDI+VAV+   G+ TPI+R AD K +  IS  VK LA++A Q KL P E++ GT +IS
Sbjct: 490 HNIDINVAVNTDQGLFTPIVRGADMKGLNAISTTVKSLAEKAHQNKLTPSEFESGTFTIS 549

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVV---FQNEEIKVATIMNATLSADHRSVDG 401
           N+GM GI SF AVINPPQ+ ILA+G  E +VV       + + ATI++ TLS DHR VDG
Sbjct: 550 NLGMFGIKSFSAVINPPQAAILAVGTTETRVVPGTTPGTQYENATILSVTLSCDHRVVDG 609

Query: 402 AIASKLLAKFKEYIENPVWMLM 423
           A+ ++ L  FK+Y+ENP+ +L+
Sbjct: 610 ALGAEWLKSFKDYMENPLKLLL 631



 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 54/81 (66%), Gaps = 1/81 (1%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEF-ESVDEGIIDEILVPA 64
           ITMP+LSP+MTEG +A W K+EGD+I  GD++ EIETDKA M+F      G + +IL P 
Sbjct: 83  ITMPALSPSMTEGNIASWKKKEGDQIKAGDVIAEIETDKATMDFIYEEGNGYLAKILAPE 142

Query: 65  GTENIAVNSPILNILMDSTEI 85
           G + I +N PI  I+    +I
Sbjct: 143 GAKGIEINQPIAIIVSKKEDI 163


>gi|148909218|gb|ABR17709.1| unknown [Picea sitchensis]
          Length = 529

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 168/431 (38%), Positives = 248/431 (57%), Gaps = 32/431 (7%)

Query: 3   IHTI-TMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           +H I  MP+LSPTM +G ++ W K EGDKI  GD++C+IETDKA ++FES++EG + +IL
Sbjct: 91  VHIILQMPALSPTMDKGNISSWKKNEGDKIEAGDVICDIETDKATLDFESMEEGYLAKIL 150

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           VPAG+++I V  P+   + +  +IP    +  +     + E    +    + +    +P 
Sbjct: 151 VPAGSKDIPVGQPLAITVENPDDIPKFTNILADEFSSKQAEKDTKAQGAAQGQEQMPQPQ 210

Query: 122 A---SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDE 178
                P  RRL  E  +D+SSL  SGPHG ++K D+   I++       S         E
Sbjct: 211 TYRFGPSVRRLLAEFELDISSLKVSGPHGTLLKGDVLAAIASGAGSGKSSETAKLHKPSE 270

Query: 179 ------SIDANI--------LNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
                 ++ A I        L L +   YE + +  IRK IA RL +SK   PH Y+S D
Sbjct: 271 PSKNEKTLSAPIAPVSLQSPLPLQSSGLYEDLQNSQIRKIIAKRLWESKHGTPHLYLSAD 330

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWT--TNAMI 282
             +D +L+ R+++       +E+   KISVNDI++K  ALA+  VPEAN  W+      +
Sbjct: 331 VMLDPVLAFRKEL-------QEKHGLKISVNDIVIKVVALALKAVPEANAYWSDEKGEAV 383

Query: 283 RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTS 342
               ID+S+AV+   G++TPI++ ADQKS+  IS EVK+LA +A+  KL P E+QGGT S
Sbjct: 384 LCDSIDVSIAVATEKGLMTPILKNADQKSLSAISTEVKELANKARVGKLSPSEFQGGTFS 443

Query: 343 ISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNE---EIKVATI--MNATLSADHR 397
           ISN+GM  ++ FCA+INPPQ+ ILA+G G K V ++ +   + K  ++  MN +LSADHR
Sbjct: 444 ISNLGMFPVDRFCAIINPPQACILAVGRGNKVVKWEEDSSGQGKACSVTQMNLSLSADHR 503

Query: 398 SVDGAIASKLL 408
             D  I  K L
Sbjct: 504 VFDYDIGGKFL 514


>gi|115717767|ref|XP_782594.2| PREDICTED: similar to pyruvate dehydrogenase complex, component X
           [Strongylocentrotus purpuratus]
          Length = 443

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 167/435 (38%), Positives = 252/435 (57%), Gaps = 31/435 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTMTEG +  W+K EGD I+ GD +CEIETDKA +  ++ D+GI+ +ILVP G
Sbjct: 18  LIMPALSPTMTEGTIVSWLKAEGDPIAAGDGICEIETDKATVIMDADDDGIMAKILVPEG 77

Query: 66  TENIAVNSPILNILMDSTE------IPP-SPPLSKENIVEVREEHSHSSPVVVREKHS-- 116
           ++NI + + ++ +++   E      +P  + P S  +  +  EE    S      +H+  
Sbjct: 78  SKNIPITA-LIGLMVPEGEDYKDVDMPTQAAPTSTGDSPKQSEEGVSESAQFSDMRHAVP 136

Query: 117 KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST---KTNVKDYSTIQSF 173
           K     SP  R L  +H ID   ++ +GPHGR++K D+   I +       +  +     
Sbjct: 137 KAGEGLSPAVRALIDQHNIDPVLVTPTGPHGRLLKGDVLKFIESGGAAAAPQPAAAAPPA 196

Query: 174 GLVDESIDANILNLFAKDSYEV-------IPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
                     +    A  SY+        +    +RK IA RL +SK TIPH+Y  +DC 
Sbjct: 197 PAPPTVQPPPVAERVAPPSYKQTEGMFSEVDLTGMRKVIAKRLTESKTTIPHYYSMVDCE 256

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           +  ++ LR+Q+ +         + K+SVND I+KA A+A+ QVPE NV+W   +      
Sbjct: 257 LTEIVRLRKQLKKD--------NIKVSVNDFIIKAAAMALKQVPEVNVTWNGQSATPLSS 308

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
           IDISVAV+  GG++TPI++ AD K +++IS  V+ LA RA+  KLK +E+QGG+ SISN+
Sbjct: 309 IDISVAVATDGGLITPIVKGADAKGLMEISANVRDLATRARANKLKLDEFQGGSFSISNL 368

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASK 406
           GM GI+ F AVINPPQS I+AIG  +  +    ++ K  T M  T+S+D R VDGA+AS+
Sbjct: 369 GMFGISEFSAVINPPQSCIMAIGGSQLAI---GKDRKPLTYMTVTMSSDARVVDGALASR 425

Query: 407 LLAKFKEYIENPVWM 421
            L  FK+ IE+P+ +
Sbjct: 426 FLKTFKQNIESPIRL 440


>gi|115945652|ref|XP_001177721.1| PREDICTED: similar to pyruvate dehydrogenase complex, component X
           [Strongylocentrotus purpuratus]
          Length = 482

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 167/435 (38%), Positives = 252/435 (57%), Gaps = 31/435 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTMTEG +  W+K EGD I+ GD +CEIETDKA +  ++ D+GI+ +ILVP G
Sbjct: 57  LIMPALSPTMTEGTIVSWLKAEGDPIAAGDGICEIETDKATVIMDADDDGIMAKILVPEG 116

Query: 66  TENIAVNSPILNILMDSTE------IPP-SPPLSKENIVEVREEHSHSSPVVVREKHS-- 116
           ++NI + + ++ +++   E      +P  + P S  +  +  EE    S      +H+  
Sbjct: 117 SKNIPITA-LIGLMVPEGEDYKDVDMPTQAAPTSTGDSPKQSEEGVSESAQFSDMRHAVP 175

Query: 117 KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST---KTNVKDYSTIQSF 173
           K     SP  R L  +H ID   ++ +GPHGR++K D+   I +       +  +     
Sbjct: 176 KAGEGLSPAVRALIDQHNIDPVLVTPTGPHGRLLKGDVLKFIESGGAAAAPQPAAAAPPA 235

Query: 174 GLVDESIDANILNLFAKDSYEV-------IPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
                     +    A  SY+        +    +RK IA RL +SK TIPH+Y  +DC 
Sbjct: 236 PAPPTVQPPPVAERVAPPSYKQTEGMFSEVDLTGMRKVIAKRLTESKTTIPHYYSMVDCE 295

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           +  ++ LR+Q+ +         + K+SVND I+KA A+A+ QVPE NV+W   +      
Sbjct: 296 LTEIVRLRKQLKKD--------NIKVSVNDFIIKAAAMALKQVPEVNVTWNGQSATPLSS 347

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
           IDISVAV+  GG++TPI++ AD K +++IS  V+ LA RA+  KLK +E+QGG+ SISN+
Sbjct: 348 IDISVAVATDGGLITPIVKGADAKGLMEISANVRDLATRARANKLKLDEFQGGSFSISNL 407

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASK 406
           GM GI+ F AVINPPQS I+AIG  +  +    ++ K  T M  T+S+D R VDGA+AS+
Sbjct: 408 GMFGISEFSAVINPPQSCIMAIGGSQLAI---GKDRKPLTYMTVTMSSDARVVDGALASR 464

Query: 407 LLAKFKEYIENPVWM 421
            L  FK+ IE+P+ +
Sbjct: 465 FLKTFKQNIESPIRL 479


>gi|196228099|ref|ZP_03126966.1| catalytic domain of component of various dehydrogenase complexes
           [Chthoniobacter flavus Ellin428]
 gi|196227502|gb|EDY22005.1| catalytic domain of component of various dehydrogenase complexes
           [Chthoniobacter flavus Ellin428]
          Length = 423

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 169/443 (38%), Positives = 252/443 (56%), Gaps = 40/443 (9%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I+ I MP LS TMTEG + KW K EGDK+  GD++ EIETDKA ME E+ D+GI+ + 
Sbjct: 1   MAIY-IEMPKLSDTMTEGTVVKWRKNEGDKVETGDVIAEIETDKATMEMEAFDDGILHKH 59

Query: 61  LVPAGTENIAVNSPI---LNILMDSTEIPPS----------PPLSKENIVEVREEHSHSS 107
           L+ AG +     +P+   + +L+   E PP+          P  +KE           S+
Sbjct: 60  LIAAGGK-----APVGGKIGLLLQKGEKPPAEGAPVPESPKPKAAKEETAAPEAASRASA 114

Query: 108 PVVVREK------HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTK 161
                         +  R  ASPLA+++A E G++LS L+G+GP GR+V  D+E   +  
Sbjct: 115 SKATSAPAPTPAAKTGERVKASPLAKKIAKEKGVELSGLAGTGPGGRVVAKDVEGAPAGG 174

Query: 162 TNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYV 221
            +    S               +  + A    + I    +R+ IA RL  SK TIPHFY+
Sbjct: 175 ASAGKASAATP-----------VAAMPAGAGDQKIALSGMRRVIAERLLTSKTTIPHFYL 223

Query: 222 SIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAM 281
           +I+ +   L+  R + N   +        K +VND +LKA   A  +VP  N S+  +++
Sbjct: 224 NIEVDAGPLMKFRAEANAASETAG---GPKFTVNDFVLKAVIAAAQKVPAVNASFAGDSI 280

Query: 282 IRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTT 341
           I++ +I +SVAV++  G+VTP+IR+A +KS+ +IS  VK LA RA+ +KLKP+EY GGT 
Sbjct: 281 IQYANIQLSVAVAVEEGLVTPVIREAQKKSLREISEAVKDLATRARSKKLKPDEYAGGTI 340

Query: 342 SISNMGMLGINSFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVD 400
           ++SN+G  GI SF A+INPPQS I+++GA  KK VV   +EI     M   LSADHR VD
Sbjct: 341 TVSNLGSYGIESFSAIINPPQSLIISVGAIVKKPVVNAKDEIVAGQRMAIGLSADHRVVD 400

Query: 401 GAIASKLLAKFKEYIENPVWMLM 423
           GA+ ++ LA+ ++ +E+P  +L+
Sbjct: 401 GAVGAQYLAELRKLVESPYLLLL 423


>gi|308501272|ref|XP_003112821.1| hypothetical protein CRE_30652 [Caenorhabditis remanei]
 gi|308267389|gb|EFP11342.1| hypothetical protein CRE_30652 [Caenorhabditis remanei]
          Length = 508

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 178/450 (39%), Positives = 256/450 (56%), Gaps = 54/450 (12%)

Query: 9   PSLSP----TMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
           PS +P    TM  G +  W K+EGD++S GD+LCEIETDKA M FE+ +EG + +IL+  
Sbjct: 78  PSCTPCSFTTMELGTVVSWQKKEGDQLSEGDLLCEIETDKATMGFETPEEGYLAKILIQE 137

Query: 65  GTENIAVNSPILNILMD----------------------STEIPPSPPLSKENIVEVREE 102
           G+++I +   +L I+++                      S E  P  P   ++       
Sbjct: 138 GSKDIPIGK-LLFIIVESEADVAAFKDFTDDGSSAGGAPSAEKAPEQPKKAQSSPPAAAS 196

Query: 103 HS---HSSPVVVRE----KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE 155
                + +P + +       S  R  ASP A++LA E G+DLS +SGSGP GRI+ SD+ 
Sbjct: 197 PPTPMYQAPSIPQSAPIPSASSGRVSASPFAKKLAAEQGLDLSGVSGSGPGGRILASDL- 255

Query: 156 TLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQT 215
                       S   + G    +  A+     +   Y  +P  N+RKTIA RL +SK T
Sbjct: 256 ------------SQAPAKGATSTTSQAS-----SGQDYTDVPLSNMRKTIAKRLTESKST 298

Query: 216 IPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVS 275
           IPH+Y++ +  +D LL +RE++N  L       + KIS+ND I+KA ALA  +VPEAN  
Sbjct: 299 IPHYYLTSEIQLDTLLQVREKLNGLLAKGTSGQATKISINDFIIKASALACQRVPEANSY 358

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           W  + +  + H+DISVAVS P G++TPII  A  K +  I+ E+ +LAQRA++ KL+P E
Sbjct: 359 WMDSFIRENHHVDISVAVSTPAGLITPIIFNAHAKGLATIASEIVELAQRAREGKLQPHE 418

Query: 336 YQGGTTSISNMGMLG-INSFCAVINPPQSTILAIGAGEKKVV-FQNEEIKVATIMNATLS 393
           +QGGT ++SN+GM G ++ F A+INPPQS ILAIG    K+V  + E  K    M  TLS
Sbjct: 419 FQGGTFTVSNLGMFGSVSDFTAIINPPQSCILAIGGASDKLVPDEAEGYKKVKTMKVTLS 478

Query: 394 ADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            DHR+VDGA+ +  L  FKE++E P  ML+
Sbjct: 479 CDHRTVDGAVGAVWLRHFKEFLEKPHTMLL 508


>gi|190344385|gb|EDK36052.2| hypothetical protein PGUG_00150 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 474

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 171/453 (37%), Positives = 254/453 (56%), Gaps = 52/453 (11%)

Query: 4   HT-ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HT I MP+LSPTMT+G +A W K+EGD+++PG+ + EIETDKA M+FE  ++G + +IL+
Sbjct: 41  HTVINMPALSPTMTQGNIASWSKKEGDQLAPGEAIAEIETDKATMDFEFQEDGYLAKILM 100

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENI-------VEVREEHSHSSPVVVRE-- 113
             G+ +I V  PI   + +S ++      + E+         E +EE    S    ++  
Sbjct: 101 GDGSHDIPVGKPIAVYVEESNDVAAFENFTAEDAGEGEAKPAETKEEPKQESKEESKDTS 160

Query: 114 KHSKNRP-----------------IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIET 156
           K SK  P                 IASPLA+ +A E GI L ++ GSGP+GRIV  D+E 
Sbjct: 161 KESKAAPAKSESKSSSTPKPSGRIIASPLAKTIALEKGISLKNVKGSGPNGRIVAKDLE- 219

Query: 157 LISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTI 216
                 N+K+ +          +            SY   P  N+RKTIA RL QS Q  
Sbjct: 220 ------NIKESAAAAPAAAAAAAAPVGA-------SYTDTPLTNMRKTIASRLLQSTQQS 266

Query: 217 PHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSW 276
           P + VS + ++  LL LR+ +N +      E   ++SVND+++KA A A ++VPE N +W
Sbjct: 267 PSYIVSSEMSVSKLLKLRQSLNAS-----AEDRYRLSVNDLLIKAIAKASLRVPEVNSAW 321

Query: 277 -TTNAMIR-HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPE 334
                +IR + ++D+SVAV+ P G++TPI++ AD K +  IS E+K L +RAK  KL PE
Sbjct: 322 LGEQGVIRTYNYVDVSVAVATPTGLITPIVKNADTKGLATISAEIKDLGKRAKANKLAPE 381

Query: 335 EYQGGTTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVV---FQNEEIKVATIMNA 390
           E+QGGT ++SN+GM   + SF ++INPP   I A+G   KK V      +      +MN 
Sbjct: 382 EFQGGTVTLSNLGMNHAVTSFTSIINPPSCAIFAVGTVTKKAVPSDVNEQGFIFDDVMNI 441

Query: 391 TLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           T + DHR VDGA+  + +   K+ +ENP+ ML+
Sbjct: 442 TGTFDHRLVDGALGGEFMKALKKIVENPLEMLV 474


>gi|146421657|ref|XP_001486773.1| hypothetical protein PGUG_00150 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 474

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 171/453 (37%), Positives = 254/453 (56%), Gaps = 52/453 (11%)

Query: 4   HT-ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HT I MP+LSPTMT+G +A W K+EGD+++PG+ + EIETDKA M+FE  ++G + +IL+
Sbjct: 41  HTVINMPALSPTMTQGNIASWSKKEGDQLAPGEAIAEIETDKATMDFEFQEDGYLAKILM 100

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENI-------VEVREEHSHSSPVVVRE-- 113
             G+ +I V  PI   + +S ++      + E+         E +EE    S    ++  
Sbjct: 101 GDGSHDIPVGKPIAVYVEESNDVAAFENFTAEDAGEGEAKPAETKEEPKQESKEESKDTS 160

Query: 114 KHSKNRP-----------------IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIET 156
           K SK  P                 IASPLA+ +A E GI L ++ GSGP+GRIV  D+E 
Sbjct: 161 KESKAAPAKSESKSSSTPKPSGRIIASPLAKTIALEKGISLKNVKGSGPNGRIVAKDLE- 219

Query: 157 LISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTI 216
                 N+K+ +          +            SY   P  N+RKTIA RL QS Q  
Sbjct: 220 ------NIKESAAAAPAAAAAAAAPVGA-------SYTDTPLTNMRKTIASRLLQSTQQS 266

Query: 217 PHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSW 276
           P + VS + ++  LL LR+ +N +      E   ++SVND+++KA A A ++VPE N +W
Sbjct: 267 PSYIVSSEMSVSKLLKLRQSLNAS-----AEDRYRLSVNDLLIKAIAKASLRVPEVNSAW 321

Query: 277 -TTNAMIR-HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPE 334
                +IR + ++D+SVAV+ P G++TPI++ AD K +  IS E+K L +RAK  KL PE
Sbjct: 322 LGEQGVIRTYNYVDVSVAVATPTGLITPIVKNADTKGLATISAEIKDLGKRAKANKLAPE 381

Query: 335 EYQGGTTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVV---FQNEEIKVATIMNA 390
           E+QGGT ++SN+GM   + SF ++INPP   I A+G   KK V      +      +MN 
Sbjct: 382 EFQGGTVTLSNLGMNHAVTSFTSIINPPSCAIFAVGTVTKKAVPSDVNEQGFIFDDVMNI 441

Query: 391 TLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           T + DHR VDGA+  + +   K+ +ENP+ ML+
Sbjct: 442 TGTFDHRLVDGALGGEFMKALKKIVENPLEMLV 474


>gi|198418630|ref|XP_002119257.1| PREDICTED: similar to MGC86218 protein [Ciona intestinalis]
          Length = 468

 Score =  283 bits (723), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 165/453 (36%), Positives = 259/453 (57%), Gaps = 56/453 (12%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM EG + KW+  EGD +  GD +CE+ETDKA++  E+ ++G + +IL+P G
Sbjct: 32  IQMPALSPTMEEGTITKWLISEGDAVEIGDAMCEVETDKAVVTMEANEDGTLAKILIPDG 91

Query: 66  TENIAVNSPILNI------LMDSTEIPPSPPLS--------KENIVEVREEHSHSSPVVV 111
           T  + +NSPI  +      L+++++  P PP+S        +E + E  + H+ ++P   
Sbjct: 92  TRGVKINSPIAILAEEGEDLLEASKFDP-PPISFHPPTSSVEEVVTETSQIHATNTP--- 147

Query: 112 REKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTK---------- 161
                 N  I SP  R++  +  I+++++ G+GP G  +K D+   I+ K          
Sbjct: 148 ------NDKI-SPAVRQMLNQFNIEVTNIHGTGPKGIRLKGDVIKYIAQKGLNPVHQHVS 200

Query: 162 TNVKDYST--IQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
           T  K  +T   ++  +  +S+         +  YE +   ++RK IA RL +SKQTIPH 
Sbjct: 201 TPTKQVTTPPTKATEVKKDSVATKPPVQVHEGDYEDLDLSSVRKVIAKRLTESKQTIPHA 260

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN 279
           Y +IDC+I+ +L LR Q+ +           K+S+ND I+K  A  + +VPE NV W  +
Sbjct: 261 YSTIDCSINKVLDLRRQLAKD--------GVKVSLNDFIIKCVASTLRRVPEVNVVWRGH 312

Query: 280 AMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
                  IDIS+AV+  GG++TPII  AD+K +  IS E+++LA +A+  KL+P EYQGG
Sbjct: 313 ETKHSDTIDISIAVATDGGLITPIITGADRKGLSAISEEIRELASKARSGKLQPHEYQGG 372

Query: 340 TTSISNMGMLGINSFCAVINPPQSTILAIGAG-----------EKKVVFQNEEIKVATIM 388
           + +ISN+GM G+  F AVINPPQS I+A+G             +  V+    E    ++M
Sbjct: 373 SFTISNLGMFGVKEFTAVINPPQSCIMAVGGTRVRPASSPVDLDDDVISDVTESATDSVM 432

Query: 389 NATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
             T+S+D R VD  +ASK L+ FK+ +ENP++M
Sbjct: 433 TVTMSSDARVVDDELASKFLSTFKQNMENPLYM 465


>gi|50310549|ref|XP_455294.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49644430|emb|CAG98002.1| KLLA0F04741p [Kluyveromyces lactis]
          Length = 473

 Score =  282 bits (722), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 168/452 (37%), Positives = 249/452 (55%), Gaps = 47/452 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTM +G L +W K  GD++ PGD+L E+ETDKA M+FE  +EG + +ILVPAG
Sbjct: 35  IGMPALSPTMVQGGLTEWSKNVGDRLEPGDVLAEVETDKAQMDFEFQEEGYLAKILVPAG 94

Query: 66  TENIAVNSPILNILMDSTEIPP------------------------SPPLSKENIVEVRE 101
           T++I VN P+   + + +++P                          P   +        
Sbjct: 95  TKDIPVNKPLAVYVEEESDVPAFANFTAADAESATAAKEAAKNGAKQPAKEESKEESKEG 154

Query: 102 EHSHSSP----VVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETL 157
               S P           S  R  ASPLA+ +A EHG+ L  + G+GP GRI K D+E  
Sbjct: 155 AKPASKPAAKKSSGSSASSGTRIFASPLAKSIALEHGVSLKEVEGTGPRGRITKDDVEAF 214

Query: 158 ISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIP 217
           +++  + +  +   +         A      A  +YE +P  N+R+ I  RL QS Q IP
Sbjct: 215 LASAPSRESSAAKAA--------PALAAPTPASATYEDVPISNMRQIIGDRLLQSTQNIP 266

Query: 218 HFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWT 277
            + VS   ++  LL LR+ +N T +        K+S+NDI++KA A+A  + P+AN  W 
Sbjct: 267 SYIVSSQISVSKLLKLRQSLNATAKDQY-----KLSINDILIKAIAVAAQRCPDANAYWM 321

Query: 278 TNAMI--RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
               +  + K++D+SVAV+ P G++TPI++ A+ K ++ IS E+K L +RAK  KLKPEE
Sbjct: 322 PEQGVIRKFKNVDVSVAVATPTGLLTPIVKNAESKGLVSISKEIKDLGKRAKDNKLKPEE 381

Query: 336 YQGGTTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATI---MNAT 391
           +QGGT  ISN+GM   ++ F ++INPPQSTILAIG   K  V         T    MN T
Sbjct: 382 FQGGTICISNLGMNPAVSMFTSIINPPQSTILAIGTVNKVPVEDAGSEFGFTFDQKMNIT 441

Query: 392 LSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            + DHR++DGA   + + + K+ IENP+ +L+
Sbjct: 442 GTFDHRTIDGAKGGEFMKELKKVIENPLELLL 473


>gi|117927796|ref|YP_872347.1| dehydrogenase catalytic domain-containing protein [Acidothermus
           cellulolyticus 11B]
 gi|117648259|gb|ABK52361.1| catalytic domain of components of various dehydrogenase complexes
           [Acidothermus cellulolyticus 11B]
          Length = 449

 Score =  282 bits (721), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 170/458 (37%), Positives = 247/458 (53%), Gaps = 54/458 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP LS TM EG + +W K+ GD++  GD+L EIETDKA+ME E+ D G++++ILV  G
Sbjct: 4   VFMPRLSDTMQEGTITQWTKKVGDQVEKGDVLAEIETDKAVMELEAYDSGVLEKILVEPG 63

Query: 66  TENIAVNSPILNI---------LMDSTE--IPPSP----PLSKENIVEVRE--------- 101
            + + + +PI  I           DST    P  P    P        VRE         
Sbjct: 64  -KPVPIGTPIAIIGSGEGLQEPTGDSTAHAAPAEPKADQPAGAAPPTAVRETAAAAASAT 122

Query: 102 -----------------EHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSG 144
                            E   ++P V        R  ASPLAR +A E G+DL ++ GSG
Sbjct: 123 TGRETAAAAAPATEPASETRPAAPPVSPLPVDGGRVKASPLARAIAREAGLDLRTVRGSG 182

Query: 145 PHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKT 204
           P GR+V++D+E  ++        S   +        D            E IP + IRK 
Sbjct: 183 PGGRVVRADVEAAVAAMRTAPAASPTAAPAAAASQPD-----------VEEIPLNTIRKI 231

Query: 205 IACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFAL 264
            A RL +S Q  PHFY++   N + L+ +R ++N  L     + + KIS+ND+I+K  A 
Sbjct: 232 TARRLTESMQQAPHFYLTRTLNAEPLIDVRARLNAALSSADPDTA-KISLNDLIVKVAAA 290

Query: 265 AMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQ 324
           A+ + PE NVS+    +++HKHI I VAV+IP G++ P+IR AD   I +IS   + LA 
Sbjct: 291 ALRKHPEVNVSYAGEKLLQHKHIHIGVAVAIPDGLIVPVIRDADTLGIREISQRTRDLAT 350

Query: 325 RAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKV 384
           RA+Q KLKP++  G T +ISN+GM G++ F AVINPP++ ILA+GA  +  V ++ ++ V
Sbjct: 351 RARQGKLKPDDIGGSTFTISNLGMFGVDQFTAVINPPEAAILAVGAVREVPVVRDGQLAV 410

Query: 385 ATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
             +M  TLS DHR++DGA A+  LA     +ENP+  L
Sbjct: 411 GKVMTITLSIDHRALDGATAAGFLADLVTLLENPLAAL 448


>gi|269837959|ref|YP_003320187.1| catalytic domain of components of various dehydrogenase complexes
           [Sphaerobacter thermophilus DSM 20745]
 gi|269787222|gb|ACZ39365.1| catalytic domain of components of various dehydrogenase complexes
           [Sphaerobacter thermophilus DSM 20745]
          Length = 443

 Score =  281 bits (720), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 169/448 (37%), Positives = 250/448 (55%), Gaps = 36/448 (8%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M  T+ MP +   M  G L +W+KQEG+++  G+ + EIETDK  +E ES + G++ + L
Sbjct: 1   MAKTVVMPQMGYDMDAGTLLRWLKQEGERVERGEPIAEIETDKVNLEIESFESGVVRKHL 60

Query: 62  V------PAGTENIAVNSPILNILMDSTEIP------------PSPPLSKENIVEVREEH 103
           V      P G     V  P  +  +D  E P            P+ P   + + E  +  
Sbjct: 61  VSEGATVPVGQAIAIVGDP--DEPIDVPETPAQTEATVPEAGTPAAPSPTDGVREAPQPE 118

Query: 104 SHSSPVV-VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS--- 159
           S   PV  V E+    R  ASPL RRLA EHGIDLS+++GSGP GRIVK DI  LI    
Sbjct: 119 SQPQPVAQVVERAPGERVRASPLVRRLAAEHGIDLSTVAGSGPGGRIVKEDIMPLIGRPA 178

Query: 160 ------TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSK 213
                       + +   +      +  A +         E+     +R+TIA R+ +S 
Sbjct: 179 APAAAPEPAAPAEPAAAPAAPAAPVAAPAAVAAPPGAPPSELRDLSRMRQTIARRMTESF 238

Query: 214 QTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEAN 273
           Q  PHFYV+   ++   L+LREQ+N  +     E   K+SVND+I++A ALA+ + P  N
Sbjct: 239 QA-PHFYVTTTVDMGAALALREQINEQV-----EAEQKVSVNDLIVRATALALRKFPMLN 292

Query: 274 VSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKP 333
            S+  + +  ++ IDI++AV++ GG++TP I   D+KS+ +I+   K L QRA++  L+P
Sbjct: 293 ASFAGDQVRVYERIDIAIAVAVEGGLITPFIPDTDRKSLGEIATITKDLIQRAREGGLRP 352

Query: 334 EEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLS 393
           EEYQGGT +ISN+GM  + SF AVINPPQ+ ILA+G+  K+ V+Q+       +M  T+S
Sbjct: 353 EEYQGGTFTISNLGMYDVESFIAVINPPQAGILAVGSIRKEPVYQDGVFVPVDLMRITIS 412

Query: 394 ADHRSVDGAIASKLLAKFKEYIENPVWM 421
           ADHR  DGA A++ LA+ K Y+E P+ +
Sbjct: 413 ADHRVTDGAEAARFLAEVKRYLEKPMLL 440


>gi|50405855|ref|XP_456568.1| DEHA2A05654p [Debaryomyces hansenii CBS767]
 gi|49652232|emb|CAG84524.1| DEHA2A05654p [Debaryomyces hansenii]
          Length = 467

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 168/449 (37%), Positives = 251/449 (55%), Gaps = 52/449 (11%)

Query: 4   HT-ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HT I MP+LSPTMT+G +  W K  GD++  G+ + EIETDKA M+FE  ++G + +IL+
Sbjct: 42  HTVINMPALSPTMTQGNIGSWSKSVGDELHAGEAIAEIETDKASMDFEFQEDGYLAKILL 101

Query: 63  PAGTENIAVNSPILNILMDSTEI----------------------PPSPPLSKENIVEVR 100
             GT+++ V  PI   + +S ++                      P     ++E+  E  
Sbjct: 102 GDGTKDVPVGKPIAVYVEESEDVQAFESFTAEDAGDASTEAKAPEPEKESKAEESKPEAS 161

Query: 101 EEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST 160
           E+ S S     + K    R  ASPLA+ +A + GI L ++ GSGP+GRIV  D+E   + 
Sbjct: 162 EKKSKSESAPAQSKPVAGRIFASPLAKTIALDKGIALKNIKGSGPNGRIVAKDVENFKAP 221

Query: 161 KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
                   +  +                   +YE +P  N+RKTIA RL QS Q  P + 
Sbjct: 222 AAAAAAAPSATA------------------AAYEDVPISNMRKTIATRLTQSTQESPSYI 263

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN- 279
           V    ++  LL LR+ +N            K+S+ND+++KA ALA ++VPEAN +W  + 
Sbjct: 264 VQSQISVSKLLKLRQSLNAAADGRY-----KLSINDLLIKAIALANLRVPEANSAWLLDQ 318

Query: 280 AMIR-HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQG 338
            +IR + ++D+SVAV+ P G++TPII+ A  K +  IS E+K+L ++AK  KL PEEYQG
Sbjct: 319 GVIRTYSNVDVSVAVATPTGLITPIIKNAHTKGLSAISNEIKELGKKAKAGKLAPEEYQG 378

Query: 339 GTTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQN---EEIKVATIMNATLSA 394
           GT +ISN+GM   +NSF ++INPPQS I+AIG  +KK V  N   +      +M  T + 
Sbjct: 379 GTITISNLGMNHAVNSFTSIINPPQSAIVAIGTVDKKAVPSNVNEQGFVFDDVMTITGTF 438

Query: 395 DHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           DHR+VDGA+  + +   K  +ENP+ ML+
Sbjct: 439 DHRTVDGALGGEWIKALKTIVENPLEMLV 467


>gi|148227113|ref|NP_001087423.1| pyruvate dehydrogenase complex, component X [Xenopus laevis]
 gi|51258828|gb|AAH79764.1| MGC86218 protein [Xenopus laevis]
          Length = 478

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 171/443 (38%), Positives = 251/443 (56%), Gaps = 44/443 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ++MP+LSPTM EG + KW+K+EG+ +S GD LCEIETDKA++  ES D+G++ +ILV  G
Sbjct: 46  VSMPALSPTMEEGNIVKWLKKEGESVSAGDALCEIETDKAVVTMESNDDGVLAKILVEEG 105

Query: 66  TENIAVNSPILNILMDSTEIP----PSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           ++N+ + S I  ++ +  +      PS  +S    V    + ++ +PV  R         
Sbjct: 106 SKNVRLGSLIALLVEEGQDWKQVHVPSVKVSP-TTVAAATKIANVAPVAKRGLR------ 158

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTK-------------TNVKDYS 168
            SP AR +   HG+D  S++ SGP G I K D    ++ K               ++  S
Sbjct: 159 MSPAARHIIDTHGLDTGSITPSGPRGIITKEDALKCLAQKEVPGEKPKPAAPTPTLQKIS 218

Query: 169 T---IQSFGLVDESIDANILNLFAK----DSYEVIPHDNIRKTIACRLQQSKQTIPHFYV 221
           T     S   V   +    +++  K      +  IP  NIRK IA RL +SK +IPH Y 
Sbjct: 219 TSPPAASPAPVSGRLTFPPMSIPGKPHTEGMFSEIPASNIRKVIAKRLTESKSSIPHAYA 278

Query: 222 SIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAM 281
           + DCN+  +L LR+++ +         + K+SVND I+KA A A+ Q+P  NV+W     
Sbjct: 279 TTDCNLGAVLQLRKELAKD--------NIKVSVNDFIIKATAAALKQMPNVNVTWNGEGA 330

Query: 282 IRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTT 341
              + IDIS+AV+   G++TPII+QA  K I +I+   K LAQ+A+  KL PEEYQGG+ 
Sbjct: 331 TTLESIDISIAVATDRGLITPIIKQAASKGIQEIAATAKVLAQKARDGKLLPEEYQGGSF 390

Query: 342 SISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQ-----NEEIKVATIMNATLSADH 396
           SISN+GM GI  F AVINPPQS ILA+G    ++ F      N ++    +MN TLS+D 
Sbjct: 391 SISNLGMFGITGFSAVINPPQSCILAVGRSRVELGFSEGEEGNPQLCQKQVMNVTLSSDG 450

Query: 397 RSVDGAIASKLLAKFKEYIENPV 419
           R VD  +A+K L  F++ +ENP+
Sbjct: 451 RLVDDELATKFLECFRKNLENPL 473


>gi|15835136|ref|NP_296895.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Chlamydia
           muridarum Nigg]
 gi|270285308|ref|ZP_06194702.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Chlamydia
           muridarum Nigg]
 gi|270289325|ref|ZP_06195627.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Chlamydia
           muridarum Weiss]
 gi|301336705|ref|ZP_07224907.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Chlamydia
           muridarum MopnTet14]
 gi|7190558|gb|AAF39360.1| pyruvate dehydrogenase, E2 component, dihydrolipoamide
           acetyltransferase, putative [Chlamydia muridarum Nigg]
          Length = 428

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 178/454 (39%), Positives = 260/454 (57%), Gaps = 59/454 (12%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M+  + MP LSPTM  G L KW KQ GD++  GD+L EI TDKA++E  + ++G + +IL
Sbjct: 1   MVSLLKMPKLSPTMETGTLVKWHKQAGDEVHFGDVLLEISTDKAVLEHTASEDGWLLQIL 60

Query: 62  VPAGTENIAVNSPIL------NILMDSTEIPPS-------------PPLSKEN------- 95
           V  GT+ I + +PI       N   D  ++ P              P  S +N       
Sbjct: 61  VKEGTK-IPIGTPIAVFSTEQNAEYDLKQLLPLEEASGANEPTEILPQTSPQNDSHYSGP 119

Query: 96  ---IVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKS 152
              IV  R E   ++P+ V  K+S ++  ASPLA++LA E  +DLS ++GSGP GRIVK 
Sbjct: 120 SMAIVGFRPEPPLTTPLSV--KYSGDKVAASPLAKKLAKEQNLDLSGVAGSGPGGRIVKK 177

Query: 153 DIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQS 212
           D+E     +        I  FG   E+ D N        SY       IR++I+ RLQ +
Sbjct: 178 DLEKAPPLR--------IAGFGY-PEAPDVN------PGSYVEESLSPIRESISKRLQAA 222

Query: 213 KQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISN-KISVNDIILKAFALAMIQVPE 271
           K  IPHFYV        LL+L +++         ++ N K+S+ND I++A ALA+ + PE
Sbjct: 223 KTFIPHFYVRQRIYASPLLALLKEL---------QVQNIKLSINDCIVRACALALKEFPE 273

Query: 272 ANVSWTT--NAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQR 329
            N  + +  N +IR   IDIS+AV+IP G++TPIIR AD+K++  IS E+K LA RA+Q 
Sbjct: 274 INSGFNSVDNTIIRFSTIDISIAVAIPDGVITPIIRCADRKNVGTISAEIKGLAARARQF 333

Query: 330 KLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMN 389
            LK EEY+GG+  ISN+GM GI+ F A++NPPQ+ ILA+G+ E++ V  N E+ V +   
Sbjct: 334 SLKEEEYKGGSFCISNLGMTGISDFTAILNPPQAAILAVGSVEEQPVVLNGELAVGSTCM 393

Query: 390 ATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            TLS DHR +DG  A+  + + ++ +E P  +L+
Sbjct: 394 LTLSVDHRVIDGYPAAMFMKRLQKLLEAPSVLLL 427


>gi|289618564|emb|CBI54895.1| unnamed protein product [Sordaria macrospora]
          Length = 460

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 164/458 (35%), Positives = 255/458 (55%), Gaps = 69/458 (15%)

Query: 4   HTIT-MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HT+  MP+LSPTMT G +  W K+ GD I PG++L EIETDKA M+FE  +EG++ +IL 
Sbjct: 34  HTVVKMPALSPTMTAGNIGAWQKKPGDSIEPGEVLVEIETDKAQMDFEFQEEGVLAKILR 93

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHS------ 116
            +G +++AV +PI  ++ + T++      S      +++    +SP V +++        
Sbjct: 94  ESGEKDVAVGNPIAILVEEGTDV------SAFKDFTLKDAGGETSPAVPKDEPKNESTAS 147

Query: 117 -----------------KNR--------PIASPLARRLAGEHGIDLSSLSGSGPHGRIVK 151
                            K R        P A P A+RLA E G++LS++ GSGP G+I +
Sbjct: 148 APTPAPTPAPEPENTGFKGRIQTALEREPNAVPAAKRLALEKGVNLSTVKGSGPGGKITE 207

Query: 152 SDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQ 211
            D++  +S        +   +                    Y  +P   +RKTIA RL++
Sbjct: 208 EDVKKAVSGAPAAGAAAAPAA--------------------YTDVPISGMRKTIAARLKE 247

Query: 212 SKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPE 271
           S    PHFYVS + ++  LL LR+ +N + +        K+SVND ++KA  +A  +VP 
Sbjct: 248 SVSENPHFYVSTNLSVSKLLKLRQALNSSAEGRY-----KLSVNDFLIKAIGVASKRVPT 302

Query: 272 ANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKL 331
            N SW    + + + +D+SVAV+ P G++TPI++  + K +  IS  VK+LA++A+  KL
Sbjct: 303 VNSSWREGVIRQFETVDVSVAVATPNGLITPIVKGVEGKGLESISAAVKELAKKARDNKL 362

Query: 332 KPEEYQGGTTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVV-FQNEEIKVATIMN 389
           KPEEYQGG+ SISNMGM   + SF A+INPPQ+ ILA+GA +K  V  +NE+       +
Sbjct: 363 KPEEYQGGSISISNMGMNPAVQSFTAIINPPQAAILAVGATQKVAVPVENEDGTTGVAWD 422

Query: 390 ----ATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
                T S DH+ VDGA+ ++ + + K+ IENP+ +L+
Sbjct: 423 EQIIVTASFDHKVVDGAVGAEWIRELKKVIENPLELLL 460


>gi|171909517|ref|ZP_02924987.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Verrucomicrobium spinosum DSM 4136]
          Length = 434

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 167/454 (36%), Positives = 257/454 (56%), Gaps = 52/454 (11%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP LS TMTEG LAKW  +EGD +  G ++ ++ETDKA ME ++ +EG + +++
Sbjct: 1   MPKLIKMPKLSDTMTEGTLAKWHIKEGDSVEMGKVIADVETDKATMEMQAFEEGKVFKLV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIP------------PSPPLSKENIVEVREE---HSHS 106
             AG + + +   ++ +L +  E P            P+P   +E+  +  +     + +
Sbjct: 61  SQAGNK-VPLGGTMVVLLAEGEEAPADLDALIAGSDAPAPAKKEESSGKSEKPAGGKAFA 119

Query: 107 SPVVVREKHSKNRPI----------ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIET 156
             +       K RP           ASPLAR++A E G+DL+ + GSGP GRIV++D+E+
Sbjct: 120 GNLPPTAPGQKRRPAVATANGVRVKASPLARKVAEEKGVDLTKIQGSGPGGRIVRADVES 179

Query: 157 L-----ISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQ 211
                  ++ T  K   TI+     D+               + IP   +R  IA RL  
Sbjct: 180 APQGGASASATPAKAVQTIRPVAGPDD---------------QRIPLTGMRNIIAERLLA 224

Query: 212 SKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEIS-NKISVNDIILKAFALAMIQVP 270
           SK  IPHFY+ ++ +   L++ R  +N       E+ S NK +VND ILKA   A   VP
Sbjct: 225 SKTQIPHFYLQMEVDAGPLMTFRAHINA----QSEKTSGNKYTVNDFILKAVVRAAATVP 280

Query: 271 EANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRK 330
             N S+  +A+++ KH+++SVA++IP G+VTP+I+ A+ K++L+IS  VK LA +AK +K
Sbjct: 281 AVNASFDGDAIVQFKHVNLSVAIAIPEGLVTPVIKAAETKTLLEISAAVKDLAGKAKNKK 340

Query: 331 LKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGA-GEKKVVFQNEEIKVATIMN 389
           L P+E+ GGT ++SN+G  GI+ F A+INPPQ+ I++IG+     VV +  +I V   M 
Sbjct: 341 LSPDEFAGGTITVSNLGAYGIDQFAAIINPPQAAIVSIGSIRSAPVVDEKGQIVVGQRMW 400

Query: 390 ATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
             LS DHR VDGA+A+  LA+ ++ IENP  ML+
Sbjct: 401 VGLSGDHRVVDGAVAATFLAEMRKLIENPALMLV 434


>gi|255039359|ref|YP_003089980.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Dyadobacter fermentans DSM 18053]
 gi|254952115|gb|ACT96815.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Dyadobacter fermentans DSM 18053]
          Length = 564

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 166/431 (38%), Positives = 251/431 (58%), Gaps = 23/431 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP +S TM EG L  W K+ GDK+  GDIL E+ETDKA ME E+ ++G +  + +  G
Sbjct: 144 VRMPKMSDTMEEGTLVSWQKKVGDKVKSGDILAEVETDKATMELEAYEDGTLLFVGIKEG 203

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHS------------HSSPVVVRE 113
            E + V++ I  I  +   +     L++EN     E  +            + S   V  
Sbjct: 204 -EAVPVDAIIAVIGEEGANV--EALLARENGEAPAEAEAAPAQAATSAPTVNGSDKAVSV 260

Query: 114 KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSF 173
             S +R  ASPLA+RLA E GI+LS +SGSG +GRIVK D++            +     
Sbjct: 261 ADSGDRVKASPLAKRLADEKGINLSEVSGSGDNGRIVKRDVDEFKPAAQASAPAAAPAQT 320

Query: 174 GLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSL 233
               ++  A      A   +   P   +RKTIA RL +S  T PHFYV+++ N+D  ++L
Sbjct: 321 APAAKAEAAPAAAAPASGDFTDTPISQMRKTIARRLSESLFTAPHFYVTMEINMDKAMAL 380

Query: 234 REQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAV 293
           R Q+N       E  + KIS ND+++KA A+A+ + P  N +W  + + ++ +++I VAV
Sbjct: 381 RPQLN-------EVATAKISFNDMVIKACAVALKKHPAVNSAWLGDKIRKYNYVNIGVAV 433

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
           ++  G++ P+IR+AD+K++  IS EVK LA +AK +KL+P++++G T S+SN+GM G++ 
Sbjct: 434 AVDEGLLVPVIREADKKTLSAISGEVKDLAGKAKDKKLQPKDWEGNTFSVSNLGMFGVDE 493

Query: 354 FCAVINPPQSTILAIGAGEKKVVFQNEEIKVAT-IMNATLSADHRSVDGAIASKLLAKFK 412
           F A+INPP S ILAIGA +K   F+ +     T IM  TLSADHR VDGA A++ L   K
Sbjct: 494 FTAIINPPDSCILAIGAIKKVAAFKEDGTVYPTNIMKVTLSADHRVVDGATAAQFLLTVK 553

Query: 413 EYIENPVWMLM 423
           + +E P+ ML+
Sbjct: 554 KLLEEPMSMLV 564



 Score = 61.2 bits (147), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 41/64 (64%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   I MP +S TM EG +A+W K+ GDKI  G+++ E+ETDKA M+ ES  +G +  I 
Sbjct: 1  MAEVIRMPKMSDTMEEGVIAEWHKKVGDKIKSGEVIAEVETDKATMDLESYWDGTLLYIG 60

Query: 62 VPAG 65
          V  G
Sbjct: 61 VKKG 64


>gi|115377714|ref|ZP_01464906.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Stigmatella aurantiaca DW4/3-1]
 gi|310820665|ref|YP_003953023.1| pyruvate dehydrogenase complex , e2 component [Stigmatella
           aurantiaca DW4/3-1]
 gi|115365264|gb|EAU64307.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Stigmatella aurantiaca DW4/3-1]
 gi|309393737|gb|ADO71196.1| Pyruvate dehydrogenase complex , E2 component [Stigmatella
           aurantiaca DW4/3-1]
          Length = 533

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 157/429 (36%), Positives = 255/429 (59%), Gaps = 29/429 (6%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM EGK+ KW+K+ GDKIS G+ + E+ETDK+ +E E+ D+G + +ILV A 
Sbjct: 123 VLMPALSPTMKEGKVVKWLKKVGDKISSGEAIAEVETDKSNLEVEAYDDGTLAKILVDA- 181

Query: 66  TENIAVNSPILNILMDSTEIP-----------PSPPLSKENIVEVREEHSHSSPVVVREK 114
            +   V +PI  I     ++            P+ P +         + S +     R+ 
Sbjct: 182 DQTAQVGAPIAYIAGKGGKVSVAAPAPAAPSAPAAPKAAAPSPAAAPQKSEAPAAAPRQA 241

Query: 115 HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFG 174
             + R  ASPLAR++A   G+DL+++ GSGP GR+VK DIE  ++        +   +  
Sbjct: 242 SGEGRVRASPLARKMASSQGLDLAAVHGSGPLGRVVKRDIEAALAQGPAAAKKAPEAA-- 299

Query: 175 LVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLR 234
                  A      ++ + + +P   +RK IA R+ + K  +PHFY+++D  +D  + +R
Sbjct: 300 -------ARPAAPGSRPAPKTLPISTMRKVIAQRMSEVKPGVPHFYLTVDVEMDAAMKIR 352

Query: 235 EQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVS 294
           E+         + + +K+SVNDI++KA A+A+ + P+ NVS   N +++    D+ +AV+
Sbjct: 353 EEA--------KALESKVSVNDIVVKAVAVALRRSPKMNVSLQGNTILQFATADVGIAVA 404

Query: 295 IPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSF 354
           I  G++TPII+ ADQK +  IS E ++LA+RA+++ LKP+EY GG+ ++SN+GM GI+ F
Sbjct: 405 IEDGLITPIIKDADQKGLQAISTEARELAERARKKALKPDEYTGGSITVSNLGMYGIDQF 464

Query: 355 CAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEY 414
            AVINPPQ+ I+A+GA   K V ++ +I V  I+  TLS DHR +DGA  ++ L + K  
Sbjct: 465 VAVINPPQAAIIAVGAVADKAVVRDGQITVRKILTVTLSGDHRVIDGATGAEYLRELKNL 524

Query: 415 IENPVWMLM 423
           +E+P+ +L 
Sbjct: 525 LEHPMRLLF 533



 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 54/77 (70%), Gaps = 1/77 (1%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   I MP+LSPTM EGKL KW+K+ GDK+S GD + E+ETDK+ +E E+ D+G++ +I+
Sbjct: 1  MAKPIQMPALSPTMKEGKLVKWLKKVGDKVSSGDAIAEVETDKSNLEVEAYDDGVLLQIV 60

Query: 62 VPAGTENIAVNSPILNI 78
          V  G +   V +PI  +
Sbjct: 61 VAEG-DLAQVGAPIAYV 76


>gi|298291776|ref|YP_003693715.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Starkeya novella DSM 506]
 gi|296928287|gb|ADH89096.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Starkeya novella DSM 506]
          Length = 458

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 134/316 (42%), Positives = 206/316 (65%), Gaps = 11/316 (3%)

Query: 119 RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDE 178
           R  ASPLARRLA E G+DL+++ GSGPHGRIV +D+             +          
Sbjct: 143 RVFASPLARRLAKEKGVDLAAVKGSGPHGRIVAADVGAAPVGAAAPAPAAAAAPAARAPA 202

Query: 179 SIDA---------NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
           +  A          +   +   +YE +P D +R+ IA R+ +++QT+P FY+++DC++D 
Sbjct: 203 AAPAPVAPGALLEQVKAYYEAGTYEEVPLDAMRRVIAQRMTEARQTVPTFYLTVDCDVDA 262

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDI 289
           LL LRE++N++      + + K+SVND ++KA+ALA  QVP+AN+ W  +  ++ KH DI
Sbjct: 263 LLKLREELNKSAPEKDGKPAYKLSVNDFVIKAYALAFQQVPDANMVWGGDRYLKLKHSDI 322

Query: 290 SVAVSIPGG--IVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMG 347
            VAV+I GG  ++TPIIR+A+ K++  IS E +  A RA+ +KL+P EYQGG+++ISN+G
Sbjct: 323 GVAVAIDGGKGLLTPIIRKAETKTLSAISNETRDFAARARNKKLQPHEYQGGSSAISNLG 382

Query: 348 MLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKL 407
           M GI  F A+INPP +TILA+G  E++ V +  ++ VAT+M  T+S DHR +DGA+ ++L
Sbjct: 383 MFGIKDFTAIINPPHATILAVGTSEQRAVVKGGQLAVATVMTVTISCDHRVMDGAMGAQL 442

Query: 408 LAKFKEYIENPVWMLM 423
           +  FK+ IE P+ ML+
Sbjct: 443 IGAFKQIIEKPMSMLV 458


>gi|332291219|ref|YP_004429828.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169305|gb|AEE18560.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Krokinobacter diaphorus 4H-3-7-5]
          Length = 562

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 168/447 (37%), Positives = 243/447 (54%), Gaps = 55/447 (12%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFES----------VDEG 55
           +TMP LS TM EG +A W+K  GDK+  GDIL EIETDKA MEFES          +DEG
Sbjct: 140 VTMPRLSDTMEEGTVATWLKAVGDKVEEGDILAEIETDKATMEFESFQSGTLLHIGIDEG 199

Query: 56  I---IDEILVPAGTENIAVNSPILN-----------------ILMDSTEIPPSPPLSKEN 95
               +D +L   G E   V+S + +                    D     P     KEN
Sbjct: 200 ETANVDALLAIIGPEGTDVSSVVKSGGANKKEAPKKEEKKEAPKADKKADAPKAAPKKEN 259

Query: 96  IVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIE 155
                     S P       +  R   SPLA+++A E GI+LS + GSG +GRIVKSD+E
Sbjct: 260 --NTNSASGSSKPAT---NTTGGRIFVSPLAKKIADEKGINLSQVKGSGENGRIVKSDVE 314

Query: 156 TLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQT 215
               + +     + +Q F    E            +S+E I +  +RK IA  L +SK T
Sbjct: 315 NFTPSASQ-SSGAGVQQFVATGE------------ESFEEIENSQMRKAIARGLGKSKFT 361

Query: 216 IPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVS 275
            PH+Y++++ N++N++S R+Q N            K+S ND+I+KA ++A+ Q P+ N  
Sbjct: 362 APHYYLNVEFNMENMMSFRKQFNALPD-------TKVSFNDMIIKATSIALKQHPQVNSQ 414

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           W  + M  + H+ I VAV++P G+V P++  A++KS+  I+ EVK LA +A+ +KL   E
Sbjct: 415 WFDDKMRLNHHVHIGVAVAVPDGLVVPVVEFANEKSLQQINAEVKVLAGKARDKKLTLPE 474

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSAD 395
            +G T +ISN+GM GI  F ++IN P S IL++GA  +K V ++ ++ V   M  TL+ D
Sbjct: 475 MEGSTFTISNLGMFGITDFTSIINQPNSAILSVGAIVEKPVVKDGKLAVGHTMKLTLACD 534

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWML 422
           HR+VDGA  ++ L   K YIENPV ML
Sbjct: 535 HRTVDGATGAQFLQTLKTYIENPVLML 561



 Score = 77.0 bits (188), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 44/64 (68%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   I MP LS TM EG +A W+K+ GDK+  GDIL EIETDKA MEFES +EG++  I 
Sbjct: 1  MAEVINMPRLSDTMEEGTVATWLKKVGDKVEEGDILAEIETDKATMEFESFNEGVLLHIG 60

Query: 62 VPAG 65
          +  G
Sbjct: 61 IEEG 64


>gi|46447365|ref|YP_008730.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Candidatus
           Protochlamydia amoebophila UWE25]
 gi|46401006|emb|CAF24455.1| probable pyruvate dehydrogenase, E2 component, dihydrolipoamide
           acetyltransferase [Candidatus Protochlamydia amoebophila
           UWE25]
          Length = 433

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 170/470 (36%), Positives = 259/470 (55%), Gaps = 85/470 (18%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M  T+TMP LSPTM EG L KW K+ GD I  GD+L E+ TDKA +E+ ++D+G + +IL
Sbjct: 1   MPFTLTMPKLSPTMEEGTLIKWHKKIGDSIQTGDLLIEVATDKATVEYNAIDDGWLRQIL 60

Query: 62  VPAGTENIAVNSPI-----------------------LNILMDSTEIPPSPPLSKENIVE 98
           +  G ++ AVN  I                       L +  DS E+P      + N  E
Sbjct: 61  IQEG-KDAAVNQAIAILTVDQNESLEGYQADGVKEKALQLSSDSIEMP------ELNYKE 113

Query: 99  VREEHSHSS----PVVVRE------------KHSKNRPIASPLARRLAGEHGIDLSSLSG 142
            +E  S ++    PV V E            +    + +ASPLA++LA E G+DL+++ G
Sbjct: 114 KKEPKSKTTAFQQPVFVPEFPLENYTFEFPIERGDKKLLASPLAKKLAKEKGLDLTTVKG 173

Query: 143 SGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKD-------SYEV 195
           +GP  RI+  D+                      D++  A ++N   ++       SYE 
Sbjct: 174 TGPQQRIISRDL----------------------DKAQAAGVVNFGHRETPQLPPGSYEE 211

Query: 196 IPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVN 255
           +    +RK I  RLQ+SK  IPHFYV++  +   L  +REQ+             K+S+N
Sbjct: 212 LSLTPMRKVIGQRLQESKSFIPHFYVTLTIDASPLTQIREQLKNN--------QVKVSIN 263

Query: 256 DIILKAFALAMIQVPEANVSWTT--NAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSIL 313
           D I++A ALA+ Q P  N  + +   ++I+ K IDI+VAVS+  G++TPIIR AD K++ 
Sbjct: 264 DFIVRACALALRQNPGLNCGFNSANQSIIQFKTIDIAVAVSLEEGLITPIIRHADFKNLG 323

Query: 314 DISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEK 373
           ++S+E++ LAQ+A++ KL+P+EY+GG+ +ISN+GM G++ F A++NPPQ+ ILA+     
Sbjct: 324 ELSVEMRVLAQKAREGKLEPQEYKGGSFTISNLGMFGVSEFQAILNPPQAAILAVSGILD 383

Query: 374 KVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
             V QN  +     MN TLS DHR +DG  A+K L   K+ +ENP  +L+
Sbjct: 384 VPVIQNNMVIPGKTMNLTLSVDHRVIDGVAAAKFLQSLKQLLENPAGLLL 433


>gi|310798916|gb|EFQ33809.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Glomerella graminicola M1.001]
          Length = 458

 Score =  280 bits (715), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 171/452 (37%), Positives = 249/452 (55%), Gaps = 59/452 (13%)

Query: 4   HT-ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HT I MP+LSPTMT G +  W K+ GD I+PGD+L EIETDKA M+FE  +EG+I ++L 
Sbjct: 34  HTVIKMPALSPTMTAGNIGAWQKKAGDSIAPGDVLVEIETDKAQMDFEFQEEGVIAKLLK 93

Query: 63  PAGTENIAVNSPILNILMDSTEIPP-------------SPPLSKENIVEVREEHSHSSPV 109
            +G +++ V +PI  ++ D  +I               + P  KE   +  +  S  +P 
Sbjct: 94  ESGEKDVPVGNPIAVLVEDGADISAFENFSAADAGGEAAKPAPKEQPKDEAKPASAPTPE 153

Query: 110 VVREKHSKNRPI------------ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETL 157
                   N+P             A+  A RLA E G+++ ++ GSG  G+I + D++  
Sbjct: 154 PENSSDDFNKPAGKLENALDREPNATIGAVRLAKEKGVNIRTVKGSGQGGKITEDDVKKA 213

Query: 158 ISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIP 217
            S                                SYE IP   +RKTIA RLQ+S Q  P
Sbjct: 214 ASAPAAAAGPGA----------------------SYEDIPISGMRKTIASRLQESTQNNP 251

Query: 218 HFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWT 277
           HFYVS   ++  LL LR+ +N +      E   K+SVND ++KA  +A  +VP+AN SW 
Sbjct: 252 HFYVSSSISVSKLLKLRQALNAS-----SEGKYKLSVNDFLIKAIGVASKKVPQANSSWR 306

Query: 278 TNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQ 337
            + + +H  +D+SVAVS P G++TPI+   + + +  IS EVK+LA+ A+  KLKPE+YQ
Sbjct: 307 GDVIRQHNTVDVSVAVSTPTGLITPIVTGVEARGLEAISTEVKKLAKLARDGKLKPEQYQ 366

Query: 338 GGTTSISNMGML-GINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATI-----MNAT 391
           GG+ SISNMGM   +++F AVINPPQSTILAIG  +K  V    E     +     +  T
Sbjct: 367 GGSISISNMGMNDAVDNFTAVINPPQSTILAIGTTKKVAVPAQSEDGTTGVAWDDQITIT 426

Query: 392 LSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            S DH+ VDGA+ ++ L + K+ +ENP+ +L+
Sbjct: 427 GSFDHKVVDGAVGAEFLKQLKKVLENPLELLL 458


>gi|320592363|gb|EFX04802.1| pyruvate dehydrogenase dihydrolipoamide acetyltransferase
           [Grosmannia clavigera kw1407]
          Length = 467

 Score =  280 bits (715), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 171/457 (37%), Positives = 251/457 (54%), Gaps = 61/457 (13%)

Query: 4   HT-ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HT I MP+LSPTMT G +  W K+ GD I PGD+L EIETDKA M+FE  +EG++ +IL+
Sbjct: 35  HTLINMPALSPTMTVGNIGVWQKKPGDVIVPGDVLVEIETDKAQMDFEYQEEGVLAQILL 94

Query: 63  PAGTENIAVNSPILNILMDSTEI------------------------------PPSPPLS 92
           P+G +++ VN+PI   + ++ ++                              P S P +
Sbjct: 95  PSGQKDVPVNNPIAVFVENTADVAAFANFTLADAGGAAAPAAAAAPAKDSAAAPTSTPTA 154

Query: 93  KENIVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKS 152
                    E S SS V ++    +   I +P A+RLA E G+  ++L G+GP G+I + 
Sbjct: 155 AP-----EPEESSSSIVRLQTALDREPNIGAP-AKRLAIELGVKATTLKGTGPGGKITEE 208

Query: 153 DIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQS 212
           D+    +  +     S+  +                   +YE IP  N+RKTIA RL++S
Sbjct: 209 DVRKAAAASSAASAASSGGA-------------AAAEGAAYEDIPISNMRKTIASRLKES 255

Query: 213 KQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEA 272
               PH++VS   ++  LL LR  +N T          K+SVND ++KA A+A  +VP+A
Sbjct: 256 VAENPHYFVSATLSVSKLLKLRTALNSTANGKY-----KLSVNDFLIKAIAVASRKVPQA 310

Query: 273 NVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLK 332
           N SW    + +   +D+SVAVS P G++TPI+R  + K +  IS  VK+LA RA+  KLK
Sbjct: 311 NSSWRDGFIRQFNTVDVSVAVSTPNGLITPIVRSVEGKGLAAISAAVKELAGRARDGKLK 370

Query: 333 PEEYQGGTTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATI---- 387
           PEEYQGG+ SISNMGM   +  F AVINPPQ+ ILA+G  +K  V    E     I    
Sbjct: 371 PEEYQGGSISISNMGMNTAVERFTAVINPPQAAILAVGTTQKVAVPAENEDGTTGIAWDD 430

Query: 388 -MNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            +N T S DH+ VDGA+ ++ + + K+ +ENP+ +L+
Sbjct: 431 QINVTASFDHKVVDGAVGAEWIRELKQVVENPLELLL 467


>gi|168027475|ref|XP_001766255.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162682469|gb|EDQ68887.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 553

 Score =  279 bits (714), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 166/441 (37%), Positives = 254/441 (57%), Gaps = 35/441 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTMT+G +  W K+EGD+I+ GD+LC+IETDKA ++FES+++G + +I++P+G
Sbjct: 125 LAMPALSPTMTQGNVGTWRKKEGDQIAAGDVLCDIETDKATLDFESLEDGYLAKIIIPSG 184

Query: 66  TENIAVNSPILNILMDSTE--------IPPSPPLSKENIVEVREEHSHSSPVVVREKHSK 117
           ++++ V    L I+ +S E           S   +  ++ +  E     +P  +     K
Sbjct: 185 SKDVQVGME-LCIIAESGEDLDKFASYSDASASAATTSVSKPTETAYEPTPAPMTSSTVK 243

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
                 P  ++L  E G+++S + G+GP G I+K D+  L + K  +K  +  ++   V 
Sbjct: 244 GN--IGPAVKKLLAESGLNVSQIQGTGPGGMIIKGDV--LAAIKGGMKPLAGDKAGDKVK 299

Query: 178 -----------ESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
                      +S  +         ++E IP+  IRK IA RL +SK  IPH YV  D  
Sbjct: 300 GAAAQTDAAAPKSAPSKAPTPDTSLTFEDIPNTPIRKIIAKRLLESKNIIPHAYVQSDTT 359

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR--H 284
           +D  L  R+ +  T   +       +SVND ++KA ALA+ +VP+AN  W      R  +
Sbjct: 360 LDATLRFRKYLKDTHGIN-------VSVNDFVIKAAALALKEVPDANAFWDDKVGDRVNN 412

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
             IDIS+AV+   G++TPI++ ADQKS+  IS EVK L ++A+  KLKP E+QGGT SIS
Sbjct: 413 NSIDISIAVATDKGLITPILKNADQKSLSTISAEVKTLVEKARNGKLKPHEFQGGTFSIS 472

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE--IKVATIMNATLSADHRSVDGA 402
           N+GM  ++ FCA+INPPQ+ ILA+G G +KVV+  +    K  T M  T+S DHR   G 
Sbjct: 473 NLGMFQVDHFCAIINPPQACILAVGRGVQKVVWDEDSNGPKTVTQMLVTISVDHRVYGGD 532

Query: 403 IASKLLAKFKEYIENPVWMLM 423
            AS+ LA F++ + NP  ML+
Sbjct: 533 TASQFLAAFRKNLANPQRMLL 553



 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 61/77 (79%), Gaps = 1/77 (1%)

Query: 8  MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTE 67
          MP+LSPTMT+G +  W KQEGD+++ GD+LC+IETDKA ++FE++++GI+ +IL+P+G+ 
Sbjct: 1  MPALSPTMTQGNVGNWKKQEGDRVAAGDVLCDIETDKATLDFETLEDGILVKILMPSGSR 60

Query: 68 NIAVNSPILNILMDSTE 84
          ++ V    L ++ +S E
Sbjct: 61 DVPVGK-ALCVIAESEE 76


>gi|149370876|ref|ZP_01890471.1| dihydrolipoyllysine-residue acetyltransferase (dihydrolipoamide
           S-acetyltransferase) [unidentified eubacterium SCB49]
 gi|149355662|gb|EDM44220.1| dihydrolipoyllysine-residue acetyltransferase (dihydrolipoamide
           S-acetyltransferase) [unidentified eubacterium SCB49]
          Length = 523

 Score =  279 bits (713), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 161/436 (36%), Positives = 247/436 (56%), Gaps = 45/436 (10%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  ITMP LS TM EG +A W+K+EGD I  GDIL EIETDKA MEFES   G + +I +
Sbjct: 118 VQVITMPRLSDTMEEGTVATWLKKEGDLIEEGDILAEIETDKATMEFESFYNGTLLKIGI 177

Query: 63  PAGTENIAVNSPILNILMDSTEI-------PPSPPLSKENIVEVREEHSHSSPVVVREK- 114
             G E   V++ +  +  + T++       P + P  KE   + ++  +   PVV +   
Sbjct: 178 QEG-ETAKVDALLAIVGPEGTDVSGITVSKPKTAP-KKEAPKQAKQTQAKK-PVVAKTAP 234

Query: 115 -------HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDY 167
                   S+ R  ASPLA+++A + GI L+ + GSG +GRI+K+DIE    +       
Sbjct: 235 KKTNTGATSEKRIFASPLAKKMAEDLGIRLNVVQGSGENGRIIKTDIENYQPSGATAYTP 294

Query: 168 STIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNI 227
           + ++SF                    E I +  +RKTIA RL +SK T PH+Y++++ ++
Sbjct: 295 AGVESF--------------------EEIKNSQMRKTIAKRLGESKFTAPHYYLTVELDM 334

Query: 228 DNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI 287
           DN ++ R  +N            KIS ND+++KA A+A+ + P+ N  WT +A    KHI
Sbjct: 335 DNAIASRTAINSQPDV-------KISFNDMVVKACAMALRKHPQVNSQWTGDATRIAKHI 387

Query: 288 DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMG 347
            + VAV++  G++ P+++ ADQ +   I   V++LA +A+ +K+ P E +G T ++SN+G
Sbjct: 388 HVGVAVAVDEGLLVPVLKFADQMTFSQIGANVRELAGKARNKKITPAEMEGSTFTVSNLG 447

Query: 348 MLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKL 407
           M GI  F ++IN P S IL++GA  +K V +N  I V   M  TL+ DHR+VDGA  ++ 
Sbjct: 448 MFGIKEFTSIINAPNSAILSVGAIVQKPVVKNGAIVVGNTMTVTLACDHRTVDGATGAQF 507

Query: 408 LAKFKEYIENPVWMLM 423
           L   + YIENPV M +
Sbjct: 508 LQTLRNYIENPVTMFV 523



 Score = 63.5 bits (153), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (62%), Gaps = 2/70 (2%)

Query: 15 MTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSP 74
          M EG +A W+K+ GDK+  GDIL EIETDKA MEFES  EG +  I V  G  + AV   
Sbjct: 1  MEEGTVATWLKKVGDKVEEGDILAEIETDKATMEFESFYEGTLLHIGVQEG--DTAVVDT 58

Query: 75 ILNILMDSTE 84
          +L I+ +  E
Sbjct: 59 LLAIIGEEGE 68


>gi|302891617|ref|XP_003044690.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256725615|gb|EEU38977.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 458

 Score =  279 bits (713), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 170/450 (37%), Positives = 254/450 (56%), Gaps = 58/450 (12%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
             + MP+LSPTM  G +  W K+ GD I+PGD+L EIETDKA M+FE  +EG+I +IL  
Sbjct: 37  QVVKMPALSPTMQHGNIGSWQKKPGDSIAPGDVLVEIETDKAQMDFEFQEEGVIAKILKE 96

Query: 64  AGTENIAVNSPILNILMDSTEIPPSPPLSKENI-------------VEVREEHSH---SS 107
           +G +++ V SPI  ++ + T+I      S E+               E + E S    S+
Sbjct: 97  SGEKDVPVGSPIAVLVEEGTDISAFEKFSIEDAGGAAAPAAPKEEKTESKSEPSSTPAST 156

Query: 108 PVVVREKHSKNR--------PIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
           P   +   S+ R        P  S  A+RLA E+GI + SL G+G  G+I + D++  +S
Sbjct: 157 PEPEQYTSSEGRLQTALDREPNMSAAAKRLARENGISIDSLKGTGQGGKITEEDVKKALS 216

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
           +       +T                       +E  P  ++RKTIA RL +S QT PHF
Sbjct: 217 SPVAAAPGAT-----------------------FEDTPISSMRKTIANRLVESTQTNPHF 253

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN 279
           YV+   ++  LL LR+ +N +      +   K+SVND ++KA A+A  +VP+ N SW   
Sbjct: 254 YVTSSVSVSKLLKLRQALNSSA-----DGKYKLSVNDFLIKAMAIASRKVPQVNSSWREG 308

Query: 280 AMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
            + +   +D+SVAVS P G++TPI+   + + +  IS +VK+LA++A+  KLKPEEYQGG
Sbjct: 309 NIRQFNSVDVSVAVSTPTGLITPIVTGVEGRGLEAISSKVKELAKKARDGKLKPEEYQGG 368

Query: 340 TTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVV-FQNEE----IKVATIMNATLS 393
           T SISNMGM   ++ F AVINPPQ+ ILA+G   K  V  QNE+    ++    ++ T S
Sbjct: 369 TISISNMGMNPAVDHFTAVINPPQAAILAVGTTRKVAVPAQNEDGSAGVEFDDQISLTAS 428

Query: 394 ADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            DH+ VDGAI ++ L + K+ +ENP+ +L+
Sbjct: 429 FDHKVVDGAIGAEWLRELKKVLENPLELLL 458


>gi|322693928|gb|EFY85772.1| dihydrolipoamide acetyltransferase component [Metarhizium acridum
           CQMa 102]
          Length = 458

 Score =  278 bits (712), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 172/450 (38%), Positives = 255/450 (56%), Gaps = 58/450 (12%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
             + MP+LSPTM  G +  W K+ GD I+PGD+L EIETDKA M+FE  +EG+I +IL  
Sbjct: 37  QVVKMPALSPTMQAGNIGSWQKKAGDSIAPGDVLVEIETDKAQMDFEFQEEGVIAKILKE 96

Query: 64  AGTENIAVNSPILNILMDSTEIPPSPPLSKENI-------VEVREEHSHSSPV------- 109
           +G +++AV SPI  ++ + T+I      + E+           +EE S S P        
Sbjct: 97  SGEKDVAVGSPIAILVEEGTDISAFEKFTLEDAGGNAQPAQPKQEEKSESQPAPSSAPAT 156

Query: 110 -VVREKHSK---------NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
               E++S            P  +P A+RLA E+GI L  + G+G  G+I + D++  IS
Sbjct: 157 SAEPEQYSSEGKLETALDREPNVAPAAKRLARENGISLDGVKGTGKGGKITEEDVKKAIS 216

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
           +       +T                       +E IP  N+RKTIA RLQ+S Q  PHF
Sbjct: 217 SPAVASPAAT-----------------------FEDIPLSNMRKTIASRLQESVQKNPHF 253

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN 279
           +V+   ++  LL LR+ +N +      E   K+SVND ++KA A A  +VP  N SW   
Sbjct: 254 FVTSSLSVTKLLKLRQALNSS-----SEGKYKLSVNDFLIKAIAAASKKVPAVNSSWREG 308

Query: 280 AMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
           ++ +   +D+SVAVS P G++TPI+   D + +  IS +VK+LA++A+  KLKPEEYQGG
Sbjct: 309 SIRQFNTVDVSVAVSTPTGLITPIVTGVDARGLESISGKVKELAKKARDNKLKPEEYQGG 368

Query: 340 TTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVV-FQNEE----IKVATIMNATLS 393
           T SISNMGM   ++ F AVINPPQ+ ILA+G  +K  V  +NE+    ++    +  T S
Sbjct: 369 TISISNMGMNAAVDHFTAVINPPQAAILAVGTTKKVAVPVENEDGTTGVEWDDQITVTAS 428

Query: 394 ADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            DH+ VDGA+ ++ + +FK+ IENP+ +L+
Sbjct: 429 FDHKVVDGAVGAEWIREFKKVIENPLELLL 458


>gi|325286974|ref|YP_004262764.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Cellulophaga lytica DSM 7489]
 gi|324322428|gb|ADY29893.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Cellulophaga lytica DSM 7489]
          Length = 541

 Score =  278 bits (712), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 164/433 (37%), Positives = 246/433 (56%), Gaps = 28/433 (6%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGI------ 56
           +  + MP LS TM EG +A W+KQ GDK+  GDIL EIETDKA MEFES   G       
Sbjct: 123 VEVVKMPRLSDTMEEGTVAAWLKQVGDKVEEGDILAEIETDKATMEFESFYSGTLLYVGI 182

Query: 57  -------IDEILVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPV 109
                  +DE+L   G E   V++ +      +T   P+     E   E  ++   S+PV
Sbjct: 183 KEGESSPVDEVLAIIGPEGTDVDAVLKAGSGSATASAPA-----EAPKEETKKEEKSAPV 237

Query: 110 VVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYST 169
                  K R  ASPLA+++A + GI+LS ++GSG +GRI+K D+E    +       ++
Sbjct: 238 ENVATDGK-RIFASPLAKKIAADKGINLSDVTGSGDNGRIIKKDVENYKPSAAANSTTAS 296

Query: 170 IQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
             S  +   +    I     ++ +E + + ++RK IA  L QSK T PHFY++I+ ++DN
Sbjct: 297 SSS--VTSATPQPAIYAPVGEEGFEDVKNSSMRKVIAKVLGQSKFTAPHFYLTIEVDMDN 354

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDI 289
             + R Q+N            K+S ND++LKA A+A+ + P+ N +W  +    +KHI +
Sbjct: 355 AKASRAQINSLPD-------TKVSFNDMVLKACAMALRKHPQVNTTWKDDVTRYNKHIHM 407

Query: 290 SVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGML 349
            VAV++  G+V P+++ ADQ S+  I   VK LA +A+ +K+ P E +G T ++SN+GM 
Sbjct: 408 GVAVAVDEGLVVPVLKFADQMSLTTIGASVKDLAGKARSKKIAPSEMEGSTFTVSNLGMF 467

Query: 350 GINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLA 409
           GI  F ++IN P S IL++GA  +K V +N EI V   M  TL+ DHR+VDGA+ ++ L 
Sbjct: 468 GIQEFTSIINQPNSAILSVGAIVEKPVVKNGEIVVGNTMKLTLACDHRTVDGAVGAQFLQ 527

Query: 410 KFKEYIENPVWML 422
             + YIENPV ML
Sbjct: 528 TLRSYIENPVTML 540



 Score = 73.2 bits (178), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 35/64 (54%), Positives = 43/64 (67%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   + MP LS TM EG +A W+K  GDK+  GDIL EIETDKA MEFES +EG++  I 
Sbjct: 1  MAVIVNMPRLSDTMEEGTVAAWLKNVGDKVEEGDILAEIETDKATMEFESFNEGVLLHIG 60

Query: 62 VPAG 65
          +  G
Sbjct: 61 IQEG 64


>gi|315051260|ref|XP_003175004.1| pyruvate dehydrogenase X component [Arthroderma gypseum CBS 118893]
 gi|311340319|gb|EFQ99521.1| pyruvate dehydrogenase X component [Arthroderma gypseum CBS 118893]
          Length = 490

 Score =  278 bits (712), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 176/463 (38%), Positives = 255/463 (55%), Gaps = 71/463 (15%)

Query: 4   HTI-TMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HTI +MP+LSPTMT G +  W K+ GD +SPGD+L EIETDKA M+FE  +EG++ ++L 
Sbjct: 56  HTIISMPALSPTMTSGNIGAWNKKAGDTLSPGDVLVEIETDKAQMDFEFQEEGVLAKVLK 115

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENI-----------------VEVREEHSH 105
            AG +++AV +PI  ++ +  +I P    S E+                   E  E  S 
Sbjct: 116 DAGEKDVAVGNPIAVMVEEGEDITPFESFSLEDAGGDKTPAADKSPKEAPKPEESETKSA 175

Query: 106 SSPVVVR---EKHSKN------------RPIASPLARRLAGEHGIDLSSLSGSGPHGRIV 150
            SP       E H  +             P ASP A+ LA E G+ ++ + GSGP GR+ 
Sbjct: 176 PSPTFEENKPEAHEADTTGERLQPSLDREPFASPAAKALALEKGVAINDVKGSGPGGRVT 235

Query: 151 KSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQ 210
           K D+E     K  V   +   +                   +YE +P  ++RK IA RL 
Sbjct: 236 KEDVE-----KHQVAAPAAGAA-----------------GPAYEDVPASSMRKVIASRLA 273

Query: 211 QSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVP 270
           QS +  PH++VS   ++  LL LR+ +N +      E   K+SVND ++KA A+A+ +VP
Sbjct: 274 QSIRENPHYFVSSTLSVTRLLKLRQALNESA-----EGRYKLSVNDFLIKACAVALKRVP 328

Query: 271 EANVSW---TTNAMIR-HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRA 326
             N  W       MIR HK +DISVAV+ P G++TPI++  +   + +IS +VK L +RA
Sbjct: 329 TVNSRWIEQNGQVMIREHKTVDISVAVATPSGLITPIVKGVEGLGLSNISSQVKDLGKRA 388

Query: 327 KQRKLKPEEYQGGTTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQNE----- 380
           K+ KLKPEEY GGT +ISNMGM   I  F AVINPPQS ILA+G   +KV  ++E     
Sbjct: 389 KENKLKPEEYNGGTFTISNMGMNPAIERFTAVINPPQSAILAVGT-TRKVAVRSELEEGT 447

Query: 381 EIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           EI+    +  T S DH+ +DGA+ ++ + + K  +ENP+ +L+
Sbjct: 448 EIEWDDQIVVTGSFDHKVIDGAVGAEFMRELKRVVENPLELLL 490


>gi|156846458|ref|XP_001646116.1| hypothetical protein Kpol_1039p7 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156116789|gb|EDO18258.1| hypothetical protein Kpol_1039p7 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 484

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 163/459 (35%), Positives = 257/459 (55%), Gaps = 44/459 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP+LSPTMT G LA W K+EG+++S GD++ E+ETDKA M+FE  D+G + +ILV  G
Sbjct: 29  INMPALSPTMTHGNLASWTKKEGEQLSVGDVIAEVETDKATMDFEFQDDGYLAKILVNQG 88

Query: 66  TENIAVNSPI---------------LNILMDSTEIPPSP--------PLSKENIVEVREE 102
            +++ VN PI                 +  + +E  P+P        P + E +VE ++ 
Sbjct: 89  AKDVPVNKPIAIYVEDEADVQAFKDFKLPANESETAPTPADSTPAATPSASETVVE-QQV 147

Query: 103 HSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKT 162
              ++P       +  R +ASPLA+ +A E+GI L +++G+GP GRIVK DIE  + +  
Sbjct: 148 AKQTTPSRQSAPATGTRILASPLAKAMALENGIALKNVTGTGPSGRIVKKDIEEYLKSGQ 207

Query: 163 NVKDYSTIQSFGL-----------VDESIDANILNLF-AKDSYEVIPHDNIRKTIACRLQ 210
                 +  +                 S+++ I  +  A + Y      N+R  I  RL 
Sbjct: 208 GATSSVSAATTASTAAPAVAGGVSASASVNSTIAQMIAASNPYTDTEISNMRNIIGSRLL 267

Query: 211 QSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVP 270
           +S QTIP + VS D ++  LL LR+ +N        +   K+S+NDI++KA +LA+ +VP
Sbjct: 268 ESTQTIPSYIVSSDISVTKLLRLRQSLNNDPANKNNDY--KLSINDILVKAISLAVKRVP 325

Query: 271 EANVSW--TTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQ 328
           E N  W    N + + +++D+SVAV+ P G++TPI++  + K ++ IS EVK L +RA+ 
Sbjct: 326 EVNTCWLEKENVIRQFENVDVSVAVATPTGLITPIVKNVNSKGLVSISNEVKDLVKRARI 385

Query: 329 RKLKPEEYQGGTTSISNMGM-LGINSFCAVINPPQSTILAIGAGEK---KVVFQNEEIKV 384
            KL PEE+QGGT  ISN+GM   ++ F ++INPPQS ILA+G  ++   + V        
Sbjct: 386 NKLNPEEFQGGTICISNLGMNNAVSMFTSIINPPQSAILAVGTTKRIPVEDVTSKNGFTF 445

Query: 385 ATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
             ++  T + DHR++DGA   + +   K  IENP+ +L+
Sbjct: 446 NDVITITGTFDHRTIDGAKGGEFMHALKTIIENPLQLLL 484


>gi|323356669|ref|YP_004223065.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide
           acyltransferase (E2) component [Microbacterium testaceum
           StLB037]
 gi|323273040|dbj|BAJ73185.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide
           acyltransferase (E2) component [Microbacterium testaceum
           StLB037]
          Length = 396

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 169/423 (39%), Positives = 236/423 (55%), Gaps = 37/423 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP LS TMTEG +A W K+ GD ++PGD+L EIETDKA+ME E+ D G + EILVP G
Sbjct: 4   ILMPRLSDTMTEGAIAVWRKKPGDPVAPGDVLLEIETDKALMEQEAYDAGTLVEILVPEG 63

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVR---EKHSKNRPIA 122
            EN+A+ +PI   L D  E  P+P  S E           +           H +    A
Sbjct: 64  -ENVAIGTPIAR-LDDGKE--PAPLASSERADLPAPAAPRAPEPDATPPAPPHGR----A 115

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
           +PL RRLA E GIDLSSL+GSGP GRIV++D++            S + S G   ES  A
Sbjct: 116 TPLVRRLAKEQGIDLSSLTGSGPGGRIVRADLDAAAEAPA-----SPVPS-GEGAES-PA 168

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
           +I           IP D IR+ IA RL  S  TIP F+ +   ++ +LL+LR Q+N    
Sbjct: 169 DITR---------IPFDGIRRAIATRLSDSAATIPVFHATAAADVTDLLALRTQLNAVGD 219

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN---AMIRHKHIDISVAVSIPGGI 299
                   +ISVND+++KA ALA+   P  N +++ +     + H  I + VAV+ P G+
Sbjct: 220 -------TRISVNDLVVKAVALALRDHPGINAAYSPDDGGQTVIHHGIHVGVAVAAPSGL 272

Query: 300 VTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVIN 359
           V P++R AD+ SI  I+   ++LA RA  R L  +E  GGT ++SN+GM G+  F A+IN
Sbjct: 273 VVPVVRDADRSSISTIARRTRELADRAAARTLTVDEMNGGTFTVSNLGMFGVEHFTAIIN 332

Query: 360 PPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPV 419
           PPQ  ILA+G    ++   +E +     +  TL+ DHR +DGA A + LA     +E P+
Sbjct: 333 PPQGAILAVGGITDELALVDEGVVARRRLRVTLTCDHRIIDGAAAGRFLAGLTAVLEAPL 392

Query: 420 WML 422
            +L
Sbjct: 393 RVL 395


>gi|24582497|ref|NP_723274.1| CG5261, isoform A [Drosophila melanogaster]
 gi|7297251|gb|AAF52515.1| CG5261, isoform A [Drosophila melanogaster]
          Length = 421

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 157/440 (35%), Positives = 233/440 (52%), Gaps = 50/440 (11%)

Query: 15  MTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSP 74
           M  G +  W K+EGDK++ GD+LCEIETDKA M FE+ +EG + +IL+  GT+++ V   
Sbjct: 1   MERGSIVSWEKKEGDKLNEGDLLCEIETDKATMGFETPEEGFLAKILIQGGTKDVPVGQL 60

Query: 75  ILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKH------------------- 115
           +  I+ D   +        +         + +                            
Sbjct: 61  LCIIVPDQGSVAAFANFKDDGAAAAPAAPAAAPAPAPAAAAAPPPPPPPAAAPAAAAPPP 120

Query: 116 ---------SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKD 166
                       R  ASP+A+RLA    + L    GSG HG I   D+    +       
Sbjct: 121 APAAAPAAAGTGRVYASPMAKRLAEAQQLRLQG-KGSGVHGSIKSGDLAGQKAAAKPAAA 179

Query: 167 YSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
                                 A   YE IP  N+R  IA RL +SK  +PH+YV++ C 
Sbjct: 180 APAKAP--------------RAAGARYEDIPVTNMRAVIAKRLLESKTQLPHYYVTVQCQ 225

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           +D LL  R ++N+      E+   ++SVND I+KA A+A ++VPEAN +W    + ++  
Sbjct: 226 VDKLLKFRAKVNKKY----EKQGARVSVNDFIIKAVAIASLKVPEANSAWMDTVIRKYDD 281

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
           +D+SVAVS   G++TPI+  AD+K +L+IS +VK LA +A+  KL+P E+QGGT S+SN+
Sbjct: 282 VDVSVAVSTDKGLITPIVFNADRKGVLEISKDVKALAAKARDNKLQPHEFQGGTISVSNL 341

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKV---ATIMNATLSADHRSVDGAI 403
           GM G+N F AVINPPQS ILAIG   K++V   + +K      ++  TLSADHR VDGA+
Sbjct: 342 GMFGVNQFAAVINPPQSCILAIGTTTKQLVADPDSLKGFKEVNMLTVTLSADHRVVDGAV 401

Query: 404 ASKLLAKFKEYIENPVWMLM 423
           A++ L  F++Y+E+P  M++
Sbjct: 402 AARWLQHFRDYMEDPSNMVL 421


>gi|302658339|ref|XP_003020874.1| hypothetical protein TRV_05012 [Trichophyton verrucosum HKI 0517]
 gi|291184743|gb|EFE40256.1| hypothetical protein TRV_05012 [Trichophyton verrucosum HKI 0517]
          Length = 580

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 177/469 (37%), Positives = 254/469 (54%), Gaps = 83/469 (17%)

Query: 4   HTI-TMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HTI +MP+LSPTMT G +  W K+ GD +SPGD+L EIETDKA M+FE  DEG++ +IL 
Sbjct: 146 HTIISMPALSPTMTSGNIGAWNKKAGDTLSPGDVLVEIETDKAQMDFEFQDEGVLAKILK 205

Query: 63  PAGTENIAVNSPILNILMDSTEIPP-------------------SP-------------- 89
            AG +++AV +PI  ++ +  +I P                   SP              
Sbjct: 206 DAGEKDVAVGNPIAVMVEEGEDISPFESFSLEDAGGDKAPAADKSPKEAPKPEEAETKAA 265

Query: 90  --PLSKENIVEVREEHSHS---SPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSG 144
             P  +EN  E RE  +      P + RE      P  SP A+ LA E G+ +  + G+G
Sbjct: 266 PTPTFEENKPEAREADTTGEKLQPSLDRE------PFVSPAAKALALEKGVAIKDVKGTG 319

Query: 145 PHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKT 204
           P GR+ K D+E   ++                               +YE +P  ++RK 
Sbjct: 320 PGGRVTKEDVEKHQASAPAAGAAGP----------------------AYEDVPASSMRKV 357

Query: 205 IACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFAL 264
           IA RL QS +  PH++VS   ++  LL LR+ +N +      E   K+SVND ++KA A+
Sbjct: 358 IASRLAQSIRENPHYFVSSTLSVTRLLKLRQALNES-----SEGRYKLSVNDFLIKACAV 412

Query: 265 AMIQVPEANVSW---TTNAMIR-HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVK 320
           A+ +VP  N  W       MIR HK +DISVAV+ P G++TPI++  +   + +IS +VK
Sbjct: 413 ALKRVPTVNSRWIEQNGQVMIREHKTVDISVAVATPSGLITPIVKGVEGLGLSNISSQVK 472

Query: 321 QLAQRAKQRKLKPEEYQGGTTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQN 379
            L +RAK+ KLKPEEY GGT +ISNMGM   I  F AVINPPQS ILA+G   +KV  ++
Sbjct: 473 DLGKRAKENKLKPEEYNGGTFTISNMGMNPAIERFTAVINPPQSAILAVGT-TRKVAVRS 531

Query: 380 E-----EIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           E     EI+    +  T S DH+ +DGAI ++ + + K  +ENP+ +L+
Sbjct: 532 ELEEGTEIEWDDQIVVTGSFDHKVIDGAIGAEFMRELKRVVENPLELLL 580


>gi|320582972|gb|EFW97189.1| Dihydrolipoamide acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [Pichia angusta DL-1]
          Length = 467

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 175/451 (38%), Positives = 243/451 (53%), Gaps = 53/451 (11%)

Query: 4   HT-ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HT ITMP+LSPTMT+G L KW K+ GD + PG+ + E+ETDKA M+FE  +EG + +ILV
Sbjct: 39  HTVITMPALSPTMTQGNLVKWHKKVGDALQPGESIAEVETDKASMDFEFQEEGFLAKILV 98

Query: 63  PAGTENIAVNSPILNILMDSTEIPP-----------------------SPPLSKENIVEV 99
           P GT++I V  P+   + DS ++                           P  KE   E 
Sbjct: 99  PDGTQDIPVGKPVAVYVEDSGDVAAFEDFTAADAGDAGAPAASEPAKEKAPAPKEESKEA 158

Query: 100 -REEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI 158
            +E    S P          R  ASPLA+ +A E GI L  + G+GP+GRIV  D+E   
Sbjct: 159 PKEAQKESQPAKKSSPAPSGRIFASPLAKNIALEKGISLKQIKGTGPNGRIVAKDVE--- 215

Query: 159 STKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPH 218
               N K  +   S                A  +Y+ IP   +RK I+ RL +SKQT P 
Sbjct: 216 ----NYKPAAPEAS----------AAPAAPAAATYQDIPLTTMRKVISKRLTESKQTSPD 261

Query: 219 FYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWT- 277
           + VS   ++  LL LR  +N            K+SVND+++KA A A  +VPEAN  +  
Sbjct: 262 YIVSSSMSVSKLLKLRASLNAAANDRY-----KLSVNDLLIKAIAKACERVPEANAYYME 316

Query: 278 TNAMIRH-KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEY 336
              +IR   ++D+SVAV+ P G++TPI++ A  K +  IS EVK L +RAK+ KL PEE+
Sbjct: 317 KEGIIRQFSNVDVSVAVATPTGLITPIVKNAHAKGLETISKEVKDLGKRAKENKLSPEEF 376

Query: 337 QGGTTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQNEE---IKVATIMNATL 392
           QGGT +ISN+GM   +  F +++NPPQS ILAIG  EKK V             ++N T 
Sbjct: 377 QGGTITISNLGMNPAVTLFTSILNPPQSAILAIGTVEKKAVPDKASPHGFVFDDVINITG 436

Query: 393 SADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           + DHR+VDGA   + +   K  +ENP+ ML+
Sbjct: 437 TFDHRTVDGAKGGEFIRALKTIVENPLEMLL 467


>gi|313207224|ref|YP_004046401.1| catalytic domain-containing protein of components of various
           dehydrogenase complexes [Riemerella anatipestifer DSM
           15868]
 gi|312446540|gb|ADQ82895.1| catalytic domain-containing protein of components of various
           dehydrogenase complexes [Riemerella anatipestifer DSM
           15868]
 gi|315022974|gb|EFT35995.1| Dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex [Riemerella anatipestifer RA-YM]
 gi|325335329|gb|ADZ11603.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide
           acyltransferase (E2) component, related enzyme
           [Riemerella anatipestifer RA-GD]
          Length = 532

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 166/439 (37%), Positives = 245/439 (55%), Gaps = 45/439 (10%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFES----------V 52
           +  I MP LS TMTEGK+AKW K  GD +  GDIL EIETDKA+ +FES          V
Sbjct: 121 VEVINMPRLSDTMTEGKVAKWNKNVGDTVKEGDILAEIETDKAVQDFESEFNGTLLYQGV 180

Query: 53  DEGI---IDEILV---PAGTENIAV--NSPILNILMDSTEIPPSPPLSKENIVEVREEHS 104
            EG    +D+IL    PAGT+  A+  N  ++           S P +++    V     
Sbjct: 181 GEGEAAEVDKILAIIGPAGTDVSAIVSNGGVV-----------SKPQAQQEQSSVASSSK 229

Query: 105 HSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNV 164
             +        S +R   SPLAR++A E GID+++L GSG +GRIVK DIE      T  
Sbjct: 230 AENVSTSNASVSTDRVAISPLARKMAEEKGIDITNLKGSGENGRIVKKDIENYQPNATEQ 289

Query: 165 KDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
           +  S   +  +         +N  A ++ E  P+  +R  IA RL +SK + PH+Y+ ++
Sbjct: 290 RSASVTPAAQVA--------MNFVAGETTET-PNSQVRNVIAKRLSESKFSAPHYYLMVE 340

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
            N+D  ++ R+++N            K+S ND+++KA A+A+ + P+ N SW  + +I H
Sbjct: 341 VNMDKAITARKEINSLPD-------TKVSFNDMVIKATAMALRKHPQINSSWAGDKIIHH 393

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
             I+I VAV+IP G+V P+++ AD  +   IS  VK +A RAK + LK  E +G T SIS
Sbjct: 394 GSINIGVAVAIPDGLVVPVLKSADFMNYSQISAGVKDMASRAKSKGLKANEMEGSTFSIS 453

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIA 404
           N+GM GI +F ++IN P S IL++GA  +K V ++ +I V   M  +L+ DHR VDGA  
Sbjct: 454 NLGMFGIETFTSIINQPNSCILSVGAIIEKPVVKDGQIVVGNTMKLSLACDHRVVDGATG 513

Query: 405 SKLLAKFKEYIENPVWMLM 423
           ++ L   K Y+ENP  +L+
Sbjct: 514 AEFLQTLKTYLENPFALLV 532



 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 43/64 (67%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   ITMP LS TMTEGK++KW KQ GD +  GDIL EIETDKA+ +FES   G +  + 
Sbjct: 1  MAEIITMPRLSDTMTEGKVSKWHKQVGDAVKEGDILAEIETDKAVQDFESEVNGTLLYVG 60

Query: 62 VPAG 65
          V  G
Sbjct: 61 VSEG 64


>gi|298245491|ref|ZP_06969297.1| catalytic domain of component of various dehydrogenase complexes
           [Ktedonobacter racemifer DSM 44963]
 gi|297552972|gb|EFH86837.1| catalytic domain of component of various dehydrogenase complexes
           [Ktedonobacter racemifer DSM 44963]
          Length = 437

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 166/438 (37%), Positives = 252/438 (57%), Gaps = 26/438 (5%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ++MP LS TM EG + +W+K+ GD+I  GDI+ E+ETDKA ME E+ D GI+++IL+  G
Sbjct: 4   VSMPRLSDTMQEGTITRWLKKSGDQIKRGDIIAEVETDKANMEIEAYDSGILEQILIKEG 63

Query: 66  -----TENIAVNSPILNILMDSTEIPPSPPLSK----ENIVEVREEHSHSSPVVVR---- 112
                 + IAV     +    +T    +   SK     N     ++ S    VV      
Sbjct: 64  EVAPIGQTIAVIGTGASASKGATTSVAASAESKVAASANGASAPQQESKPEVVVASTVST 123

Query: 113 ---EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYST 169
                 ++ R  ASPLARR+A EHGIDL  + G+GP GRIV+ D+E  +S +      + 
Sbjct: 124 SEVSTTAEGRVKASPLARRIAEEHGIDLGQIKGTGPSGRIVRDDLEDYLSQQRATTPVAP 183

Query: 170 IQSFGLVDESIDANILNLFA-----KDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
             +     ++        FA     +DS EVI   +++K IA RL +SKQ +PHFYVS +
Sbjct: 184 AAAPAQPIQAAPQFQAPAFALAAIPEDS-EVITISSVQKRIANRLLESKQFVPHFYVSNE 242

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
            ++ + L+LR+ +N        E   K+SVND+I+KA ALA+ + P+ N S+     IRH
Sbjct: 243 IDMTDALALRQVLNGAAS----EEGAKVSVNDLIIKACALALEKFPDVNGSYRDGQFIRH 298

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           KHI+I VAV +P  +V P+I+ A+ K +  I+ EV++L Q+A+  KL   +  GGT SIS
Sbjct: 299 KHINIGVAVDVPNALVVPVIKDANIKGVRTIAREVRELIQKARNNKLSVADLSGGTFSIS 358

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIA 404
           N+GM+ ++ F A+INPP++ ILA+ +  K  V  + +  +  IM  TLSADHR + GA+ 
Sbjct: 359 NLGMMDVSGFSAIINPPEAAILAVASTRKTFVPVDGQPVIRDIMPLTLSADHRILYGAMV 418

Query: 405 SKLLAKFKEYIENPVWML 422
           ++ L + K  ++NP  +L
Sbjct: 419 ARFLQEVKRLLQNPYALL 436


>gi|145513428|ref|XP_001442625.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124409978|emb|CAK75228.1| unnamed protein product [Paramecium tetraurelia]
          Length = 628

 Score =  277 bits (708), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 174/464 (37%), Positives = 257/464 (55%), Gaps = 58/464 (12%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P+LSPTM +G L KW+ +EGD+ISPGD++CEIETDKA + FE  ++G I +++VPAG
Sbjct: 177 LGLPALSPTMEKGNLMKWLVKEGDRISPGDVICEIETDKATVGFEVQEDGYIAKLMVPAG 236

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEH-------------------SHS 106
           +++I + +    IL  ST    + P      +E                        ++ 
Sbjct: 237 SKDIKLGT----ILAISTPKKDNVPSFTNYTLEGAAAAAQTTQAQPPQQQQQQQQTITNE 292

Query: 107 SPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST--KTNV 164
           +PV      S  R  ASPLA+  A  + + L  + G+G  G IVK D+E  +S+  K  V
Sbjct: 293 TPVQTVS-QSGQRIFASPLAKEFAKINNVPLEYVKGTGIDGSIVKKDVERFLSSGSKPEV 351

Query: 165 KDYSTI---------------QSFGLVDESIDANILNLFAKDSYEVI----PH-----DN 200
           +    +               Q          A      A  S  V     P+      N
Sbjct: 352 QQQQQVITPPQQQQTQAPSQEQPAQQTPPPAQAKQQTKPAAASKPVAIEGNPYVDTELTN 411

Query: 201 IRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILK 260
           +R TIA RL +SK TIPH+Y+++   +D +L +RE++N+  +        KISVND I+K
Sbjct: 412 MRLTIAARLLESKTTIPHYYLTMTVTMDKVLKVREELNKLQKV-------KISVNDFIIK 464

Query: 261 AFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVK 320
           A ALA+  VP+AN  W    + +  + DIS+AV+   G++TPI+  A  K +  I+  VK
Sbjct: 465 ASALALKDVPQANSQWHGTYIRKFANADISIAVATDAGLITPIVFNAGSKGLGTIASTVK 524

Query: 321 QLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QN 379
           +LA +AK  KLKP+E+ GGT +ISN+GM GI+ F AVINPPQS ILA+G   K+ V  ++
Sbjct: 525 ELADKAKANKLKPQEFIGGTFTISNLGMFGIDQFIAVINPPQSAILAVGKTSKRFVPDEH 584

Query: 380 EEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            + KV + M+ TLS DHR VDGA+ ++ L +FK YIE+P  +L+
Sbjct: 585 GQPKVESQMDVTLSCDHRVVDGAVGAQWLQRFKYYIEDPNTLLL 628



 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 55/80 (68%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM  G + K++K+ GD I+ GD+LCE+ETDKA + FE  DEG + +ILVP G
Sbjct: 50  LEMPALSPTMETGNIQKYLKKVGDPITAGDVLCEVETDKATVGFEMQDEGFLAQILVPEG 109

Query: 66  TENIAVNSPILNILMDSTEI 85
           ++ + V   +  I+   +++
Sbjct: 110 SKGVKVGQLVAVIVPKQSDV 129


>gi|120437223|ref|YP_862909.1| dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Gramella forsetii KT0803]
 gi|117579373|emb|CAL67842.1| dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Gramella forsetii KT0803]
          Length = 569

 Score =  277 bits (708), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 164/442 (37%), Positives = 247/442 (55%), Gaps = 38/442 (8%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I MP LS TM EG +A W+K+EGDK+  GDIL EIETDKA MEFES  +G + +I +
Sbjct: 143 VEIINMPRLSDTMEEGTVASWLKKEGDKVEEGDILAEIETDKATMEFESFYDGTLLKIGI 202

Query: 63  PAGTENIAVNSPILNILMDSTEIPP----------------------SPPLSKENIVEVR 100
             G E+  V+S +  I  + T++                            SK++  + +
Sbjct: 203 QEG-ESAKVDSLLAIIGPEGTDVSKIDTSGGGEKKKKKSDSADKKEEDTDASKDSEKQDK 261

Query: 101 EEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST 160
           EE   SS     E     R  ASPLA+++A + GI+LS +SGSG +GRIVK DIE    +
Sbjct: 262 EEKDSSSQ---SEGKDGKRIFASPLAKKMAEDKGINLSDVSGSGENGRIVKKDIENFKES 318

Query: 161 KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
                D          +++  A       ++S+E   +  +RK IA RL +SK T PH+Y
Sbjct: 319 -----DKPAETKADSAEKTTAAQPYTPAGEESFEDRKNSQMRKVIAKRLGESKFTAPHYY 373

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           ++I+ ++ N ++ R+ +N            K+S ND+++KA A+A+ + P+ N  WT + 
Sbjct: 374 LTIEVDMANAMASRKHINEMPDV-------KVSFNDMVIKASAMALRKHPQVNSQWTGDN 426

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
               KHI + VAV++  G+V P+++ ADQ S+  I   VK LA +A+ +K++P + +G T
Sbjct: 427 TKIAKHIHMGVAVAVEEGLVVPVLKFADQMSLTQIGGNVKDLAGKARNKKIQPADMEGST 486

Query: 341 TSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVD 400
            ++SN+GM GI  F ++IN P S IL++G   +K V +N EI V   M  TL+ DHR+VD
Sbjct: 487 FTVSNLGMFGIVEFTSIINQPNSAILSVGTIVEKPVVKNGEIVVGNTMKLTLACDHRTVD 546

Query: 401 GAIASKLLAKFKEYIENPVWML 422
           GA  +  L   K Y+ENPV ML
Sbjct: 547 GATGAAFLQTLKTYMENPVTML 568



 Score = 77.4 bits (189), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 44/64 (68%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   I MP LS TM EG +AKW+K++GDK+  GDIL EIETDKA MEFES  EG +  I 
Sbjct: 1  MAEVIKMPRLSDTMEEGTVAKWLKKKGDKVEEGDILAEIETDKATMEFESFYEGTLLHIG 60

Query: 62 VPAG 65
          V  G
Sbjct: 61 VEEG 64


>gi|256818908|ref|YP_003140187.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Capnocytophaga ochracea DSM 7271]
 gi|256580491|gb|ACU91626.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Capnocytophaga ochracea DSM 7271]
          Length = 538

 Score =  277 bits (708), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 160/437 (36%), Positives = 248/437 (56%), Gaps = 37/437 (8%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGI------ 56
           +  +TMP LS TMTEG +A W+K+ GD +  GDIL EIETDKA MEFES   G       
Sbjct: 121 VEVVTMPRLSDTMTEGTVASWLKKVGDTVKEGDILAEIETDKATMEFESFYSGTLLYIGL 180

Query: 57  -------IDEILV---PAGTENIAVNSPILNILMDSTEI-PPSPPLSKENIVEVREEHSH 105
                  +D +L    PAGT+   VN+ +  +         PS P ++    E     + 
Sbjct: 181 KEGESAAVDSLLAIIGPAGTD---VNAVLAAVKAGGASTSAPSTPKAESKPAETATSATT 237

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           S        ++ +R  ASPLA+++A + GI+L+ + G+G +GRIVK D+E    +    K
Sbjct: 238 SVA------NANDRVFASPLAKKIAQDKGINLTEVKGTGENGRIVKKDVENFTPS---AK 288

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             +   +      +    ++ +  + + EV  +  +RKTIA RL +SK T PH+Y++I+ 
Sbjct: 289 VATATTATPATASAAIPTVIPVGVEVTEEV-KNSQMRKTIAKRLAESKFTAPHYYLAIEI 347

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           ++DN +  R Q+N            KIS ND+++KA A+A+ + P+ N SW  +  + +K
Sbjct: 348 DMDNAMESRAQINNLPD-------TKISFNDMVVKACAMALKKHPQVNTSWKGDTTLYNK 400

Query: 286 HIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
           H+++ VAV+I  G+V P+I+  D  ++  I   VK LA +A+ +KL P E +G T ++SN
Sbjct: 401 HVNVGVAVAIEDGLVVPVIKFTDTLTLTQIGALVKDLAGKARNKKLTPAEMEGSTFTVSN 460

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIAS 405
           +GM G++ F ++IN P S IL++GA  +K V +N +I V   M  TL+ DHR++DGA  +
Sbjct: 461 LGMFGVDVFTSIINQPNSAILSVGAIVEKPVVKNGQIVVGHTMQVTLACDHRTIDGATGA 520

Query: 406 KLLAKFKEYIENPVWML 422
           + L   K YIENPV ML
Sbjct: 521 QFLQTLKAYIENPVTML 537



 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/56 (62%), Positives = 41/56 (73%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGII 57
          M   ITMP LS TM EG +AKW+K+ GDK++ GDIL EIETDKA MEFES   G +
Sbjct: 1  MAEIITMPRLSDTMEEGVVAKWLKKVGDKVNEGDILAEIETDKATMEFESFHTGTL 56


>gi|315224289|ref|ZP_07866123.1| dihydrolipoyllysine-residue acetyltransferase [Capnocytophaga
           ochracea F0287]
 gi|314945679|gb|EFS97694.1| dihydrolipoyllysine-residue acetyltransferase [Capnocytophaga
           ochracea F0287]
          Length = 538

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 162/436 (37%), Positives = 250/436 (57%), Gaps = 35/436 (8%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGI------ 56
           +  +TMP LS TMTEG +A W+K+ GD +  GDIL EIETDKA MEFES   G       
Sbjct: 121 VEVVTMPRLSDTMTEGTVASWLKKVGDTVKEGDILAEIETDKATMEFESFYSGTLLYIGL 180

Query: 57  -------IDEILV---PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHS 106
                  +D +L    PAGT+  AV + +      ST  P +P    +       E + S
Sbjct: 181 KEGESAAVDSLLAIIGPAGTDINAVLAAV-KAGGASTSAPATPKAESK-----PAETATS 234

Query: 107 SPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKD 166
           +   V   ++ +R  ASPLA+++A + GI+L+ + G+G +GRIVK D+E    +    K 
Sbjct: 235 ATTSVA--NANDRVFASPLAKKIAQDKGINLTEVKGTGENGRIVKKDVENFTPS---AKV 289

Query: 167 YSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
            +   +      +    ++ +  + + EV  +  +RKTIA RL +SK T PH+Y++I+ +
Sbjct: 290 ATATTATPATASAAIPTVIPVGVEVTEEV-KNSQMRKTIAKRLAESKFTAPHYYLAIEID 348

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           +DN +  R Q+N            KIS ND+++KA A+A+ + P+ N SW  +  + +KH
Sbjct: 349 MDNAMESRAQINNLPD-------TKISFNDMVVKACAMALKKHPQVNTSWKGDTTLYNKH 401

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
           +++ VAV+I  G+V P+I+  D  ++  I   VK LA +A+ +KL P E +G T ++SN+
Sbjct: 402 VNVGVAVAIEDGLVVPVIKFTDTLTLTQIGALVKDLAGKARNKKLTPAEMEGSTFTVSNL 461

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASK 406
           GM G++ F ++IN P S IL++GA  +K V +N +I V   M  TL+ DHR++DGA  ++
Sbjct: 462 GMFGVDVFTSIINQPNSAILSVGAIVEKPVVKNGQIVVGHTMQVTLACDHRTIDGATGAQ 521

Query: 407 LLAKFKEYIENPVWML 422
            L   K YIENPV ML
Sbjct: 522 FLQTLKAYIENPVTML 537



 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/56 (62%), Positives = 41/56 (73%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGII 57
          M   ITMP LS TM EG +AKW+K+ GDK++ GDIL EIETDKA MEFES   G +
Sbjct: 1  MAEIITMPRLSDTMEEGVVAKWLKKVGDKVNEGDILAEIETDKATMEFESFHTGTL 56


>gi|71894701|ref|NP_001026358.1| pyruvate dehydrogenase complex, component X [Gallus gallus]
 gi|60098969|emb|CAH65315.1| hypothetical protein RCJMB04_17g4 [Gallus gallus]
          Length = 502

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 178/460 (38%), Positives = 260/460 (56%), Gaps = 53/460 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + MP+LSPTM EG + KW+K+EG+ ++ GD LCEIETDKA++  ES D+GI+ +ILV  G
Sbjct: 53  VLMPALSPTMEEGNIVKWLKKEGEMVNAGDALCEIETDKAVVTMESSDDGILAKILVEEG 112

Query: 66  TENIAVNSPILNILMD------STEIPP--------SPPLSKENIVEVREEHSHSSPVVV 111
           ++N+ + S ++ +L++        EIP         +PP +   +       S S+P  V
Sbjct: 113 SKNVRLGS-LIGLLVEEGQDWKQVEIPADANDQSSLAPPAAA--VTSTPAGPSVSAPPKV 169

Query: 112 REKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDY---- 167
             +  K +   SP AR +   HG+D SS++ SGP G   K D   L+  K   K      
Sbjct: 170 EHQPGKLQFRLSPAARNIVETHGLDPSSVTPSGPRGIFTKEDALKLLQGKQKDKPSELKP 229

Query: 168 ----STIQSFGLVDESIDANILNLF---------------AKDSYEVIPHDNIRKTIACR 208
               +T Q   +      A + + +               A  ++  IP  NIR+ IA R
Sbjct: 230 VVSPATPQPTAVPSALPAAAVPSAYPRPIVPPVSTPGQPAAPGTFTEIPASNIRRVIAKR 289

Query: 209 LQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQ 268
           L +SK TIPH Y + DC+ID +L LR ++       +++I  K+SVND I+KA A+ + Q
Sbjct: 290 LTESKTTIPHAYAAADCDIDAILKLRSEL------AKDDI--KVSVNDFIIKAAAVTLKQ 341

Query: 269 VPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQ 328
           +P+ N +W      + + IDIS+AV+   G++TPII+    K I +I+   K LA++A+ 
Sbjct: 342 MPDVNATWDGEGCRQLQSIDISIAVATDRGLITPIIKDVPAKGIQEIAASAKALAKKARD 401

Query: 329 RKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAG--EKKVVFQ---NEEIK 383
            KL PEEYQGG+ SISN+GM GIN F AVINPPQ+ ILA+G    E K+V     NE++K
Sbjct: 402 GKLLPEEYQGGSFSISNLGMFGINDFIAVINPPQACILAVGRARPELKIVEDEEGNEKLK 461

Query: 384 VATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
              +M  TLS+D R VD  +ASK L  FK  IENP+ + +
Sbjct: 462 QHQLMTVTLSSDGRVVDDELASKFLETFKANIENPIRLAL 501


>gi|255731724|ref|XP_002550786.1| dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex, mitochondrial precursor [Candida
           tropicalis MYA-3404]
 gi|240131795|gb|EER31354.1| dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex, mitochondrial precursor [Candida
           tropicalis MYA-3404]
          Length = 470

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 169/450 (37%), Positives = 247/450 (54%), Gaps = 50/450 (11%)

Query: 4   HT-ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HT I MP+LSPTMT+G +  W K+ GD+++PG+ + EIETDKA M+FE  +EG + +IL+
Sbjct: 41  HTVIHMPALSPTMTQGNIQSWAKKVGDELAPGEPIAEIETDKASMDFEFQEEGYLAKILM 100

Query: 63  PAGTENIAVNSPILNILMDSTEI-------------PPSPPLSKENIVEVREEHSHSSP- 108
            AG++ + V  PI   + D++E+              P      E+    +EE S S+  
Sbjct: 101 DAGSKEVPVGQPIAVYVEDASEVSAFENFTAADAGEAPQGAAPAESEAPKKEEESKSAKE 160

Query: 109 ---------VVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
                        ++   +R  ASPLA+ +A E GI L  + GSGPHGRI   DIE L S
Sbjct: 161 SPAAASTSSSAASKQAPTDRIFASPLAKTIALEKGISLKGVKGSGPHGRITAKDIEGLES 220

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
                                           +YE IP  ++RKTIA RL QS Q  P +
Sbjct: 221 KPAAAATTPAAAPA---------------PGATYEDIPITSMRKTIASRLLQSTQQSPSY 265

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSW-TT 278
            +    ++  LL LR  +N T      E   K+S+ND+++KA A   ++VPE N +W   
Sbjct: 266 IIQSQISVSKLLKLRASLNST-----AEDRYKLSINDLLIKAIARTCVRVPEVNSAWLGE 320

Query: 279 NAMIR-HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQ 337
             +IR +K++D+SVAV+ P G++TPI+  A+ K + DIS +VK L +RAK  KL PEE+Q
Sbjct: 321 QGVIRQYKNVDVSVAVATPTGLITPIVFNAESKGLADISNQVKDLGKRAKIGKLAPEEFQ 380

Query: 338 GGTTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVV---FQNEEIKVATIMNATLS 393
           GGT  ISN+GM   + +F ++INPPQS ILAIG  EKK V      +      ++  T +
Sbjct: 381 GGTICISNLGMNNAVTAFTSIINPPQSAILAIGTTEKKAVPSEVNEQGFVFDDVITITGT 440

Query: 394 ADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            DHR +DGA+  + + + K  +ENP+ +L+
Sbjct: 441 FDHRVIDGALGGEWMKELKRIVENPLELLI 470


>gi|163742725|ref|ZP_02150110.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Phaeobacter gallaeciensis 2.10]
 gi|161383980|gb|EDQ08364.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Phaeobacter gallaeciensis 2.10]
          Length = 444

 Score =  276 bits (706), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 136/311 (43%), Positives = 205/311 (65%), Gaps = 10/311 (3%)

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
           NR  ASPLARR+A + G+DL+ L+GSGP GRIVK+D+E            +   +     
Sbjct: 137 NRIFASPLARRIAADKGLDLAQLNGSGPRGRIVKADVENAKPQVAAAPAAAAPATAAAPA 196

Query: 178 ESIDAN-----ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232
            ++        +  ++   +YE +  D +RKTIA RL ++KQT+PHFY+  D  +D LL 
Sbjct: 197 AAVSTGPSTDQVARMYEGRTYEEVKLDGMRKTIAARLTEAKQTVPHFYLRRDIQLDALLK 256

Query: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVA 292
            R ++N+ L+        K+SVND I+KA ALA+  VP+AN  W  + +++ +  D++VA
Sbjct: 257 FRGELNKQLEAR----GVKLSVNDFIIKACALALQAVPDANAVWAGDRVLKMEASDVAVA 312

Query: 293 VSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGIN 352
           V+I GG+ TP+++ +D KS+  +S E+K LA+RA+ RKL P EYQGG+ +ISN+GM GI+
Sbjct: 313 VAIEGGLFTPVLQNSDTKSLSTLSTEMKDLAKRARDRKLAPHEYQGGSFAISNLGMFGID 372

Query: 353 SFCAVINPPQSTILAIGAGEKK-VVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKF 411
           +F A++NPP + ILA+GAG KK VV  + E+ VAT+M+ T+S DHR +DGA+ ++LL   
Sbjct: 373 NFDAIVNPPHAGILAVGAGVKKPVVGADGELAVATVMSVTMSVDHRVIDGALGAELLNAI 432

Query: 412 KEYIENPVWML 422
           K+ +ENP+ ML
Sbjct: 433 KDNLENPMMML 443


>gi|322709946|gb|EFZ01521.1| dihydrolipoamide acetyltransferase component [Metarhizium
           anisopliae ARSEF 23]
          Length = 458

 Score =  276 bits (706), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 170/450 (37%), Positives = 255/450 (56%), Gaps = 58/450 (12%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
             + MP+LSPTM  G +  W K+ GD ++PGD+L EIETDKA M+FE  +EG+I +IL  
Sbjct: 37  QVVKMPALSPTMQAGNIGSWQKKAGDSVAPGDVLVEIETDKAQMDFEFQEEGVIAKILKE 96

Query: 64  AGTENIAVNSPILNILMDSTEIPPSPPLSKENI-------VEVREEHSHSSPV------- 109
           +G +++AV SPI  ++ + T+I      + E+           +EE S S P        
Sbjct: 97  SGEKDVAVGSPIAILVEEGTDISAFEKFTLEDAGGNAQPAQPKQEEKSESQPAPSSAPST 156

Query: 110 -VVREKHSK---------NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
               E++S            P  +P A+RLA E+GI L  + G+G  G+I + D++  IS
Sbjct: 157 SAEPEQYSSEGKLETALDREPNVAPAAKRLARENGIGLDGVKGTGKGGKITEEDVKKAIS 216

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
           +       +T                       +E IP  N+RKTIA RLQ+S Q  PHF
Sbjct: 217 SPAVASPAAT-----------------------FEDIPLSNMRKTIASRLQESVQKNPHF 253

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN 279
           +V+   ++  LL LR+ +N +      E   K+SVND ++KA A A  +VP  N SW   
Sbjct: 254 FVTSSLSVTKLLKLRQALNSS-----SEGKYKLSVNDFLIKAIAAASKKVPAVNSSWREG 308

Query: 280 AMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
           ++ +   +D+SVAVS P G++TPI+   D + +  IS +VK+LA++A+  KLKPEEYQGG
Sbjct: 309 SIRQFNTVDVSVAVSTPTGLITPIVTGVDARGLESISGKVKELAKKARDNKLKPEEYQGG 368

Query: 340 TTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVV-FQNEE----IKVATIMNATLS 393
           T SISNMGM   ++ F AVINPPQ+ ILA+G  +K  V  +N++    ++    +  T S
Sbjct: 369 TISISNMGMNAAVDHFTAVINPPQAAILAVGTTKKVAVPVENDDGTTGVEWDDQITVTAS 428

Query: 394 ADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            DH+ VDGA+ ++ + +FK+ IENP+ +L+
Sbjct: 429 FDHKVVDGAVGAEWIREFKKVIENPLELLL 458


>gi|229594592|ref|XP_001032780.3| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           family protein [Tetrahymena thermophila]
 gi|225566767|gb|EAR85117.3| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           family protein [Tetrahymena thermophila SB210]
          Length = 628

 Score =  276 bits (705), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 163/444 (36%), Positives = 249/444 (56%), Gaps = 34/444 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDK-AIMEFESVDEGIIDEILVPA 64
           + +P+LSPTMTEGK+A +  + GDK++ GD + +++TDK ++        G + +ILV  
Sbjct: 193 VLLPALSPTMTEGKIASFHVKVGDKVTEGDNIFDVQTDKDSVPNIYQEASGFVAKILVKE 252

Query: 65  GTENIAVNSPILNI--------------LMDSTEIPPSPPLSKENIVEVREEHSHSSPVV 110
           G E I  N P+L +              L D+ +   +    +E     +   + ++   
Sbjct: 253 G-ETIPANHPVLVVVAKKDDLAKFEQFTLNDALKKGSASSAPQEAAQPAQTSSAQTATQT 311

Query: 111 VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
                S  R  ASP A+ +A E G+DLS++ GSGP+GRI+  D++   +        +  
Sbjct: 312 TVASGSSGRVAASPYAKTVAQEKGVDLSTVQGSGPNGRIIAKDVQNATTKAAQQTVAAQQ 371

Query: 171 QSFGLVDESID------ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
            +     E+           + +     Y+ IP   +RKTIA RL QSK T+PHFY++ID
Sbjct: 372 PAAETKQEAPKPAPQQPKVEVVVQGGVEYQKIPITPMRKTIAERLVQSKTTVPHFYLNID 431

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
             +D +L LR+ +N       E+ ++KISVND+I+KA ALA+  +P  N  W  + + + 
Sbjct: 432 VQMDEVLHLRKTLN-------EQSTSKISVNDLIVKASALALRDMPGVNSQWHGDHIRQF 484

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
           KH D++VAVS   G++TPI+  A+   +  IS + K+LA++A++  L P EYQGGT +IS
Sbjct: 485 KHADVAVAVSTKTGLITPIVFNAETLGLSQISSKTKELAEKARKGGLLPTEYQGGTFTIS 544

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNE-----EIKVATIMNATLSADHRSV 399
           N+GM GI+ F A++NPP  TILA+GA  +KVV  N+       K    M  TLS DHR V
Sbjct: 545 NLGMYGIDHFAAIVNPPHGTILAVGATSQKVVPDNDPHAKYPFKTIQSMTVTLSCDHRVV 604

Query: 400 DGAIASKLLAKFKEYIENPVWMLM 423
           DGA+ ++ L KFK Y+E P  ML+
Sbjct: 605 DGALGAEWLQKFKGYLEKPYTMLL 628



 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 50/82 (60%), Gaps = 2/82 (2%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDK-AIMEFESVDEGIIDEILVPA 64
           + +P+LSPTMTEGK+A W  + G KI  GD + +++TDK ++      + G + +ILV  
Sbjct: 65  VALPALSPTMTEGKIAAWHIKVGQKIQEGDNIFDVQTDKDSVPNVYQEETGFVAKILVNE 124

Query: 65  GTENIAVNSPILNILMDSTEIP 86
           G E I  N+P++ +     +IP
Sbjct: 125 G-ELIPANTPVVVVCKSEADIP 145


>gi|288920662|ref|ZP_06414965.1| catalytic domain of component of various dehydrogenase complexes
           [Frankia sp. EUN1f]
 gi|288347932|gb|EFC82206.1| catalytic domain of component of various dehydrogenase complexes
           [Frankia sp. EUN1f]
          Length = 436

 Score =  276 bits (705), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 162/446 (36%), Positives = 255/446 (57%), Gaps = 43/446 (9%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP LS TM +G +A W KQ GDKI+ G+IL EIETDKAIME E+ D+G+++ ILV  G
Sbjct: 4   ITMPRLSDTMEDGLIALWRKQVGDKITSGEILVEIETDKAIMELEAYDDGVLERILVDEG 63

Query: 66  TENIAVNSPILNILMDSTEIPPSP-------------PLSKENIVEVREEHSHSSPVV-- 110
              + + +PI  ++ D T    SP             P S  +    R + +  +     
Sbjct: 64  GR-VPIGTPIA-VIGDGTGTASSPDSSGGPASDTAPGPASPTSTTYGRADTTGGTDGAGA 121

Query: 111 ---VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDY 167
                E    +RP +SPLAR++A E G+DL+++ G+GP GRIV++D+E       +V D 
Sbjct: 122 SADSAEDGRADRPRSSPLARKIAAERGVDLANIVGTGPGGRIVRADVE-------HVAD- 173

Query: 168 STIQSFGLV--DESIDANILNLFAKDS---------YEVIPHDNIRKTIACRLQQSKQTI 216
            TI S G+V  +    A      A+D+          + +P   I++  A RL +SKQ  
Sbjct: 174 -TIWSNGIVLPEPVRPAPNGTPTARDAARSPAPEADVDELPLSRIQRVAAKRLTESKQQA 232

Query: 217 PHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSW 276
           PHFY++   ++  L + R  +N TL         K+S+ND+++KA A  +   P  NVS+
Sbjct: 233 PHFYLTRAVDLTALTAFRTTLNETLAATG---GPKLSINDLLVKAVATTIRANPSVNVSF 289

Query: 277 TTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEY 336
             + + RH+ I++ +AV++  G+V P+I  AD++ + +I+   ++LA+RA+  +L+P + 
Sbjct: 290 GGDVLRRHRRINLGIAVAVESGLVVPVITDADRRPVSEIATVGRELAERARAGRLQPADM 349

Query: 337 QGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADH 396
            GGT +ISN+GM GI  F AVINPP++ ILA+GA  ++V   + E+    I+  TLSADH
Sbjct: 350 SGGTFTISNLGMFGIEQFAAVINPPEAAILAVGAATQEVRIVDGEMVPRAILRLTLSADH 409

Query: 397 RSVDGAIASKLLAKFKEYIENPVWML 422
           R++DGA  ++ L      +E P+ ++
Sbjct: 410 RAIDGATGARFLQDLARMLETPLRIV 435


>gi|302502268|ref|XP_003013125.1| hypothetical protein ARB_00670 [Arthroderma benhamiae CBS 112371]
 gi|291176687|gb|EFE32485.1| hypothetical protein ARB_00670 [Arthroderma benhamiae CBS 112371]
          Length = 476

 Score =  276 bits (705), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 174/469 (37%), Positives = 254/469 (54%), Gaps = 83/469 (17%)

Query: 4   HTI-TMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HTI +MP+LSPTMT G +  W K+ GD +SPGD+L EIETDKA M+FE  +EG++ +IL 
Sbjct: 42  HTIISMPALSPTMTSGNIGAWNKKAGDTLSPGDVLVEIETDKAQMDFEFQEEGVLAKILK 101

Query: 63  PAGTENIAVNSPILNILMDSTEIPP-------------------SP-------------- 89
            AG +++AV +PI  ++ +  +I P                   SP              
Sbjct: 102 DAGEKDVAVGNPIAVMVEEGEDISPFESFSLEDAGGDKAPAADKSPKEAPKPEEAETKAA 161

Query: 90  --PLSKENIVEVREEHSHS---SPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSG 144
             P  +EN  E +E  +      P + RE      P  SP A+ LA E G+ +  + G+G
Sbjct: 162 PTPTFEENKPEAQEADTTGEKLQPSLDRE------PFVSPAAKALALEKGVAIKDVKGTG 215

Query: 145 PHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKT 204
           P GR+ K D+E   ++                               +YE +P  ++RK 
Sbjct: 216 PGGRVTKEDVEKHQASAPATGAAGP----------------------AYEDVPASSMRKV 253

Query: 205 IACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFAL 264
           IA RL QS +  PH++VS   ++  LL LR+ +N +      E   K+SVND ++KA A+
Sbjct: 254 IASRLAQSIRENPHYFVSSTLSVTRLLKLRQALNES-----SEGRYKLSVNDFLIKACAV 308

Query: 265 AMIQVPEANVSW---TTNAMIR-HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVK 320
           A+ +VP  N  W       MIR HK +DISVAV+ P G++TPI++  +   + +IS +VK
Sbjct: 309 ALKRVPTVNSRWIEQNGQVMIREHKTVDISVAVATPSGLITPIVKGVEGLGLSNISSQVK 368

Query: 321 QLAQRAKQRKLKPEEYQGGTTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQN 379
            L +RAK+ KLKPEEY GGT +ISNMGM   I  F AVINPPQS ILA+G   +KV  ++
Sbjct: 369 DLGKRAKENKLKPEEYNGGTFTISNMGMNPAIERFTAVINPPQSAILAVGT-TRKVAVRS 427

Query: 380 E-----EIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           E     EI+    +  T S DH+ +DGA+ ++ + + K  +ENP+ +L+
Sbjct: 428 ELEEGTEIEWDDQIVVTGSFDHKVIDGAVGAEFMRELKRVVENPLELLL 476


>gi|260826562|ref|XP_002608234.1| hypothetical protein BRAFLDRAFT_59834 [Branchiostoma floridae]
 gi|229293585|gb|EEN64244.1| hypothetical protein BRAFLDRAFT_59834 [Branchiostoma floridae]
          Length = 443

 Score =  276 bits (705), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 165/427 (38%), Positives = 237/427 (55%), Gaps = 24/427 (5%)

Query: 8   MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTE 67
           MP+LSPTM EG +  W+K+EGD I+ GD LCEIETDKA +  ++ D+G++ +ILVP  T+
Sbjct: 19  MPALSPTMEEGTIISWLKKEGDPIAAGDPLCEIETDKATLTMDADDDGVMAKILVPGNTK 78

Query: 68  NIAVNSPILNILMDS-----TEIP-----PSPPL---SKENIVEVREEHSHSSPVVVRE- 113
           N+ +N  I  ++ +       +IP     PS  +   +   +    E  S S    +R  
Sbjct: 79  NVRINELIALMVAEGEDHTQVDIPTETGTPSAAVDTPADAPVPTATENSSSSELSSMRHV 138

Query: 114 KHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDI--ETLISTKTNVKDYSTIQ 171
              K     SP  R L   +G+D +++  +GPHGR++K     E +  T  +        
Sbjct: 139 AGGKGHVDLSPAVRYLVDSNGLDAATIVPTGPHGRLLKGSRRQEAVAPTTPSAPTPVAAP 198

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
                  +  A       +D +  IPH ++R+ IA RL QSK T+PH Y SIDC +D++L
Sbjct: 199 PPPPPPVTHPAVPPAAAEEDEFVDIPHTSMRRVIAKRLTQSKTTVPHAYSSIDCEMDSVL 258

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISV 291
            LR+Q+  +          K+SVND I+KA   A+  VPE N  W   A+    ++DISV
Sbjct: 259 RLRKQLQGS--------GVKVSVNDFIIKAVGQALKTVPEVNAQWMGEAVQLLSNVDISV 310

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGI 351
           AV+   G++TPI+     + + +IS  VK+LA RA+  KL P+EYQGGT S+SN+GM GI
Sbjct: 311 AVATDKGLITPIVTDVPSRGLQNISETVKELAGRARIGKLLPQEYQGGTFSVSNLGMFGI 370

Query: 352 NSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKF 411
           + F A+INPPQS I+AIG     V    +     T+M  TL +D R VD A+AS  L  F
Sbjct: 371 SQFSAIINPPQSCIMAIGGSRVLVEPTEDGHTTKTVMTVTLCSDSRVVDDALASTFLENF 430

Query: 412 KEYIENP 418
           KE +ENP
Sbjct: 431 KENLENP 437


>gi|255348606|ref|ZP_05380613.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Chlamydia
           trachomatis 70]
 gi|255503146|ref|ZP_05381536.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Chlamydia
           trachomatis 70s]
 gi|255506824|ref|ZP_05382463.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Chlamydia
           trachomatis D(s)2923]
 gi|289525286|emb|CBJ14762.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex [Chlamydia trachomatis Sweden2]
 gi|296434835|gb|ADH17013.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Chlamydia
           trachomatis E/150]
 gi|296438555|gb|ADH20708.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Chlamydia
           trachomatis E/11023]
          Length = 429

 Score =  276 bits (705), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 175/453 (38%), Positives = 258/453 (56%), Gaps = 56/453 (12%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M+  + MP LSPTM  G L KW K+ GD+I  GD+L EI TDKA++E  + ++G + EIL
Sbjct: 1   MVSLLKMPKLSPTMEIGILVKWHKKAGDEIHFGDVLLEISTDKAVLEHTASEDGWLLEIL 60

Query: 62  VPAGTEN-----IAVNSPILNILMDSTEIPP-------------SPPLSKEN-------- 95
           V  GT+      IAV S   N   D  ++ P             SP  S +         
Sbjct: 61  VKEGTKTPIGTPIAVFSTEQNAQYDLKQLLPLEETVVTDAATEASPKDSAQTDSQYTSGP 120

Query: 96  ---IVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKS 152
              ++  R E   ++P+ +  KHS +  +ASPLA++LA E  +DLS ++GSGP GRIVK 
Sbjct: 121 SITMMGFRPEPPLATPLTI--KHSNDPVLASPLAKKLAKEQNLDLSGVTGSGPGGRIVKK 178

Query: 153 DIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQS 212
           D+E     +        I  FG   E+ + N        SY   P   +R+ I+ RLQ +
Sbjct: 179 DLEKAPPLR--------IAGFGY-PEAPNVN------PGSYIEEPLSPVREVISKRLQAA 223

Query: 213 KQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEA 272
           K  IPHFYV        LL+L +++        +E + K+S+ND I++A ALA+ + PE 
Sbjct: 224 KTFIPHFYVRQRIYASPLLALLKEL--------QEQNIKLSINDCIVRACALALKEFPEI 275

Query: 273 NVSWTT--NAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRK 330
           N  + +  N +IR   IDIS+AV+IP G++TPI+R AD+K+I  IS E+K LA +AKQ+ 
Sbjct: 276 NSGFNSVDNKIIRFSTIDISIAVAIPDGVITPIVRCADRKNIGMISAEIKGLATKAKQQS 335

Query: 331 LKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNA 390
           L  EEY+GG+  +SN+GM GI+ F A++NPPQ+ ILA+G+ E++ V  N E+ V +    
Sbjct: 336 LAEEEYKGGSFCVSNLGMTGISDFTAILNPPQAAILAVGSVEEQPVVLNGELAVGSTCML 395

Query: 391 TLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           TLS DHR +DG  A+  + + +  +E P  +L+
Sbjct: 396 TLSVDHRVIDGYPAAMFMKRLQRLLEAPSVLLL 428


>gi|242810228|ref|XP_002485538.1| pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase
           component, putative [Talaromyces stipitatus ATCC 10500]
 gi|218716163|gb|EED15585.1| pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase
           component, putative [Talaromyces stipitatus ATCC 10500]
          Length = 472

 Score =  275 bits (704), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 172/454 (37%), Positives = 255/454 (56%), Gaps = 62/454 (13%)

Query: 4   HTI-TMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HTI +MP+LSPTMT G +  W K+ GD ++PGD+L EIETDKA M+FE  ++G++ ++L 
Sbjct: 47  HTIISMPALSPTMTAGNIGTWQKKPGDTLAPGDVLVEIETDKAQMDFEFQEDGVLAKVLK 106

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENI------VEVREEHSHSSPVVVREKHS 116
            +G ++IAV SPI  ++ + T+I P    + E+          +EE    +P    E   
Sbjct: 107 DSGEKDIAVGSPIAVLVEEGTDIAPFESFTLEDAGGDKTPAAPKEEAKEEAPKPAPETQD 166

Query: 117 K------------------NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI 158
           K                    P  SP A+ LA E GI L +L G+G +G+I K D+E   
Sbjct: 167 KPEAIEPEVTGERLQPALDREPQISPAAKVLALEKGIPLKALKGTGRNGQITKEDVE--- 223

Query: 159 STKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPH 218
                 K  +T  + G                 SYE IP  ++RKTIA RLQ+S Q  PH
Sbjct: 224 ----KYKPATTAAAAG----------------PSYEDIPLTSMRKTIATRLQKSTQENPH 263

Query: 219 FYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWT- 277
           ++VS   ++  L+ LR+ +N +          K+SVND ++KA A+A+ +VP  N SWT 
Sbjct: 264 YFVSATLSVSKLIKLRQALNASADGKY-----KLSVNDFLIKACAIALRKVPAVNSSWTE 318

Query: 278 --TNAMIR-HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPE 334
               A+IR + ++DISVAV+   G++TPI++ A    +  IS  VK L +RA++ KLKPE
Sbjct: 319 ENGQAIIRQYNNVDISVAVATSSGLITPIVKNAHNLGLSSISNTVKDLGKRARENKLKPE 378

Query: 335 EYQGGTTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVV-FQNEE---IKVATIMN 389
           EYQGGT +ISN+GM   +  F AVINPPQ+ ILA+G   K  V  + EE   ++    + 
Sbjct: 379 EYQGGTFTISNLGMNAAVERFTAVINPPQAAILAVGTTRKVAVPVETEEGTSVEWDDQII 438

Query: 390 ATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            T S DHR +DGA+  + + + K+ +ENP+ +++
Sbjct: 439 VTASFDHRVIDGAVGGEWIKELKKVVENPLELML 472


>gi|114636950|ref|XP_001149409.1| PREDICTED: pyruvate dehydrogenase complex, component X isoform 1
           [Pan troglodytes]
          Length = 504

 Score =  275 bits (704), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 171/448 (38%), Positives = 247/448 (55%), Gaps = 39/448 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTM EG + KW+K+EG+ +S GD LCEIETDKA++  ++ D+GI+ +I+V  G
Sbjct: 59  ILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEG 118

Query: 66  TENIAVNSPILNILMDS-----TEIP----PSPPLSKENIVEVREEHSHSSPVVVREKHS 116
           ++NI + S I  I+ +       EIP    P PP+SK +      E   S PV       
Sbjct: 119 SKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPG 178

Query: 117 KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLV 176
             R   SP AR +  +H +D S  + +GP G   K D   L+  K   K   +  +    
Sbjct: 179 TLRFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPA 238

Query: 177 DESIDANILNLFAKDSYEV--------------------IPHDNIRKTIACRLQQSKQTI 216
                 + L   A  SY                      IP  NIR+ IA RL +SK T+
Sbjct: 239 ATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTV 298

Query: 217 PHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSW 276
           PH Y + DC++  +L +R+ +   L F  ++I  K+SVND I+KA A+ + Q+P+ NVSW
Sbjct: 299 PHAYATADCDLGAVLKVRQDL---LIFLSDDI--KVSVNDFIIKAAAVTLKQMPDVNVSW 353

Query: 277 TTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEY 336
                 +   IDISVAV+   G++TPII+ A  K I +I+  VK L+++A+  KL PEEY
Sbjct: 354 DGEGPKQLPFIDISVAVATDKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEY 413

Query: 337 QGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE-----IKVATIMNAT 391
           QGG+ SISN+GM GI+ F AVINPPQ+ ILA+G     +    +E     ++   ++  T
Sbjct: 414 QGGSFSISNLGMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVT 473

Query: 392 LSADHRSVDGAIASKLLAKFKEYIENPV 419
           +S+D R VD  +A++ L  FK  +ENP+
Sbjct: 474 MSSDSRVVDDELATRFLKSFKANLENPI 501


>gi|298707059|emb|CBJ29861.1| Dihydrolipoamide S-acetyltransferase [Ectocarpus siliculosus]
          Length = 1262

 Score =  275 bits (704), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 161/436 (36%), Positives = 239/436 (54%), Gaps = 61/436 (13%)

Query: 6    ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
            + MP+LSPTM  G + +W K  GD++S GD++C++ETDKA + F+  D+G++  I+  AG
Sbjct: 870  VNMPALSPTMESGTVTEWHKSPGDELSAGDVICDVETDKATVAFDVQDDGVLARIISEAG 929

Query: 66   TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASPL 125
            +  ++V SP+  I+ D+                                       A+ +
Sbjct: 930  SGEVSVGSPVAVIVEDADAY------------------------------------AAFV 953

Query: 126  ARRLAGE-HGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDAN- 183
                AGE  GID SSL G+G  GRI K+D+   ++        +   S      +  A  
Sbjct: 954  KADAAGESKGIDASSLEGTGKGGRITKADLVLALAKGVEFPAAAKAASSQAPAPATAAAA 1013

Query: 184  -------------ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNL 230
                         ++   +   +   P +NI+K  A RL QSK  +PH YVS+ C +D L
Sbjct: 1014 AQPAAAAAAAAPPVVPSSSSGDFVDEPANNIKKITAKRLTQSKAEVPHLYVSMACEVDGL 1073

Query: 231  LSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDIS 290
            ++ R+ + +       E   K+SVNDII+++ ALA+  VPEAN  W+  A    + IDIS
Sbjct: 1074 MAFRKALQK-------EHDVKVSVNDIIIRSAALALRDVPEANAKWSGGARQSGESIDIS 1126

Query: 291  VAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLG 350
            VAV+ P G++TPI+  ADQ+ + +IS +V+ LA RA+ R+LKPEE+QGG+ ++SN+GM G
Sbjct: 1127 VAVATPTGLITPIVTDADQRGLSNISGKVRDLATRARDRQLKPEEFQGGSFTVSNLGMFG 1186

Query: 351  INSFCAVINPPQSTILAIGAGEKKVVFQNE---EIKVATIMNATLSADHRSVDGAIASKL 407
            IN F AVIN PQ+ ILA+G G  KV    E   + +V + +   LSAD R VD AIA++L
Sbjct: 1187 INEFSAVINMPQACILAVGGGAPKVKPGREAGDKPRVCSEVTVRLSADRRVVDEAIAAQL 1246

Query: 408  LAKFKEYIENPVWMLM 423
            L  FK Y+E P  +LM
Sbjct: 1247 LQSFKHYMETPELLLM 1262


>gi|166154458|ref|YP_001654576.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Chlamydia
           trachomatis 434/Bu]
 gi|166155333|ref|YP_001653588.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Chlamydia
           trachomatis L2b/UCH-1/proctitis]
 gi|301335717|ref|ZP_07223961.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Chlamydia
           trachomatis L2tet1]
 gi|165930446|emb|CAP03939.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex [Chlamydia trachomatis 434/Bu]
 gi|165931321|emb|CAP06893.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
          Length = 429

 Score =  275 bits (703), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 174/453 (38%), Positives = 258/453 (56%), Gaps = 56/453 (12%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M+  + MP LSPTM  G L KW K+ GD+I  GD+L EI TDKA++E  + ++G + EIL
Sbjct: 1   MVSLLKMPKLSPTMEIGILVKWHKKAGDEIHFGDVLLEISTDKAVLEHTASEDGWLLEIL 60

Query: 62  VPAGTEN-----IAVNSPILNILMDSTEIPP-------------SPPLSKEN-------- 95
           V  GT+      IAV S   N   D  ++ P             SP  S +         
Sbjct: 61  VKEGTKTPIGTPIAVFSTEQNAQYDLKQLLPLEETVVTDAATEASPKDSAQTDSQYTSGP 120

Query: 96  ---IVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKS 152
              ++  R E   ++P+ +  KHS +  +ASPLA++LA E  +DLS ++GSGP GRI+K 
Sbjct: 121 SITMMGFRPEPPLATPLTI--KHSNDPVLASPLAKKLAKEQNLDLSGVTGSGPGGRIIKK 178

Query: 153 DIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQS 212
           D+E     +        I  FG   E+ + N        SY   P   +R+ I+ RLQ +
Sbjct: 179 DLEKAPPLR--------IAGFGY-PEAPNVN------PGSYIEEPLSPVREVISKRLQAA 223

Query: 213 KQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEA 272
           K  IPHFYV        LL+L +++        +E + K+S+ND I++A ALA+ + PE 
Sbjct: 224 KTFIPHFYVRQRIYASPLLALLKEL--------QEQNIKLSINDCIVRACALALKEFPEI 275

Query: 273 NVSWTT--NAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRK 330
           N  + +  N +IR   IDIS+AV+IP G++TPI+R AD+K+I  IS E+K LA +AKQ+ 
Sbjct: 276 NSGFNSVDNKIIRFSTIDISIAVAIPDGVITPIVRCADRKNIGMISAEIKGLATKAKQQS 335

Query: 331 LKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNA 390
           L  EEY+GG+  +SN+GM GI+ F A++NPPQ+ ILA+G+ E++ V  N E+ V +    
Sbjct: 336 LAEEEYKGGSFCVSNLGMTGISDFTAILNPPQAAILAVGSVEEQPVVLNGELAVGSTCML 395

Query: 391 TLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           TLS DHR +DG  A+  + + +  +E P  +L+
Sbjct: 396 TLSVDHRVIDGYPAAMFMKRLQRLLEAPSVLLL 428


>gi|326471792|gb|EGD95801.1| pyruvate dehydrogenase complex [Trichophyton tonsurans CBS 112818]
 gi|326484667|gb|EGE08677.1| pyruvate dehydrogenase complex [Trichophyton equinum CBS 127.97]
          Length = 490

 Score =  275 bits (703), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 174/469 (37%), Positives = 254/469 (54%), Gaps = 83/469 (17%)

Query: 4   HTI-TMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HTI +MP+LSPTMT G +  W K+ GD +SPGD+L EIETDKA M+FE  +EG++ +IL 
Sbjct: 56  HTIISMPALSPTMTSGNIGAWNKKAGDTLSPGDVLVEIETDKAQMDFEFQEEGVLAKILK 115

Query: 63  PAGTENIAVNSPILNILMDSTEIPP-------------------SP-------------- 89
            AG +++AV +PI  ++ +  +I P                   SP              
Sbjct: 116 DAGEKDVAVGNPIAVMVEEGEDISPFESFSLEDAGGDKAPAADKSPKEAPKPEEAETKAA 175

Query: 90  --PLSKENIVEVREEHSHS---SPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSG 144
             P  +EN  E +E  +      P + RE      P  SP A+ LA E G+ +  + G+G
Sbjct: 176 PTPTFEENKPEAQEADTTGERLQPSIDRE------PFVSPAAKALALEKGVAIKDVKGTG 229

Query: 145 PHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKT 204
           P GR+ K D+E   ++                               +YE +P  ++RK 
Sbjct: 230 PGGRVTKEDVEKHQASAPAAGAAGP----------------------AYEDVPASSMRKV 267

Query: 205 IACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFAL 264
           IA RL QS +  PH++VS   ++  LL LR+ +N +      E   K+SVND ++KA A+
Sbjct: 268 IASRLAQSIRENPHYFVSSTLSVTRLLKLRQALNESA-----EGRYKLSVNDFLIKACAV 322

Query: 265 AMIQVPEANVSW---TTNAMIR-HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVK 320
           A+ +VP  N  W       MIR HK +DISVAV+ P G++TPI++  +   + +IS +VK
Sbjct: 323 ALKRVPTVNSRWIEQNGQVMIREHKTVDISVAVATPSGLITPIVKGVEGLGLSNISSQVK 382

Query: 321 QLAQRAKQRKLKPEEYQGGTTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVVFQN 379
            L +RAK+ KLKPEEY GGT +ISNMGM   I  F AVINPPQS ILA+G   +KV  ++
Sbjct: 383 DLGKRAKENKLKPEEYNGGTFTISNMGMNPAIERFTAVINPPQSAILAVGT-TRKVAVRS 441

Query: 380 E-----EIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           E     EI+    +  T S DH+ +DGA+ ++ + + K  +ENP+ +L+
Sbjct: 442 ELEEGTEIEWDDQIVVTGSFDHKVIDGAVGAEFMRELKRVVENPLELLL 490


>gi|167523809|ref|XP_001746241.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163775512|gb|EDQ89136.1| predicted protein [Monosiga brevicollis MX1]
          Length = 444

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 153/390 (39%), Positives = 220/390 (56%), Gaps = 48/390 (12%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           +  P+LSPTMT G L +W    GD+++ GD L ++ETDKA M FES ++G + ++LV  G
Sbjct: 63  VNFPALSPTMTTGTLMEWQVAVGDEVAAGDALGQVETDKAAMAFESTEDGFVAKLLVEDG 122

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIV--EVREEHSHSSPVVVREKH-------- 115
           T +IA+  P++ ++ D  +IP     + E     E ++E   + P   ++          
Sbjct: 123 TSDIAIGQPVMVLVEDKDDIPAFENFTPEASATPEPKKEEPKAEPEPAKDSQPATPAPTP 182

Query: 116 ---------SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETL--------I 158
                    S +R  ASPLARRLA +  I L  L+GSGP GRI ++D+E           
Sbjct: 183 APSPSTTEKSGDRIFASPLARRLAAQAEIALDQLNGSGPRGRITRADVEAYQQSAPAPAA 242

Query: 159 STKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPH 218
              T+ K  S   S  L                 Y  +P  N+RK IA RLQ+SKQ +PH
Sbjct: 243 GASTSTKAASPAGSDDL----------------EYTDVPLSNMRKVIAKRLQESKQQVPH 286

Query: 219 FYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTT 278
           +Y++ D N+D +L+LR+Q N            K+SVND ++KA A A+  V E N +W  
Sbjct: 287 YYLTSDVNVDAVLALRQQFNAEANGEY-----KLSVNDFVIKASAAALQDVTECNSAWMD 341

Query: 279 NAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQG 338
             +  +  +DISVAVS   G++TPI+  AD K + +IS  VK+LA RA++ KL PEEYQG
Sbjct: 342 TFIREYDSVDISVAVSTDAGLITPIVFDADLKGLREISENVKELAGRAREGKLAPEEYQG 401

Query: 339 GTTSISNMGMLGINSFCAVINPPQSTILAI 368
           GT +ISN+GM G++SF A+INPPQ+ ILA+
Sbjct: 402 GTFTISNLGMYGVSSFSAIINPPQACILAV 431


>gi|241957293|ref|XP_002421366.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex, putative;
           dihydrolipoyllysine-residue acetyltransferase component
           of pyruvate dehydrogenase complex, mitochondrial
           precursor, putative [Candida dubliniensis CD36]
 gi|223644710|emb|CAX40700.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex, putative [Candida dubliniensis
           CD36]
          Length = 476

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 168/448 (37%), Positives = 250/448 (55%), Gaps = 43/448 (9%)

Query: 4   HT-ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           HT I MP+LSPTMT+G +  W K+ GD+++PG+ + EIETDKA M+FE  +EG + +IL+
Sbjct: 44  HTVINMPALSPTMTQGNIQSWAKKVGDELTPGEAIAEIETDKASMDFEFQEEGYLAKILL 103

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKEN-----------------IVEVREEHSH 105
            AG +++ V  PI   + D++E+      +  +                   E +   + 
Sbjct: 104 DAGAKDVPVGQPIAVYVEDASEVAAFEDFTAADAGEAPKPAPAAAEEAPKKEEPKASTTT 163

Query: 106 SSPVVVREKHSKNRP----IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTK 161
            +P       SK  P    IASP A+ +A E GI L  + GSGP+GRIV  D+E  +  +
Sbjct: 164 QAPASTGAPSSKKAPTDRIIASPFAKTIALEKGISLKGIKGSGPNGRIVAKDLEG-VEPQ 222

Query: 162 TNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYV 221
                 +T  +      S  A         SYE IP  ++RKTIA RL QS Q  P + +
Sbjct: 223 AAAAAPATPAATTGAAPSATA---------SYEDIPITSMRKTIASRLLQSTQQSPSYII 273

Query: 222 SIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSW-TTNA 280
               ++  LL LR  +N T      E   K+S+ND+++KA A   ++VPE N +W     
Sbjct: 274 QSQISVSKLLKLRASLNAT-----AEERYKLSINDLLIKAIARTCVRVPEVNAAWLGEQG 328

Query: 281 MIR-HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
           +IR +K++D+SVAV+ P G++TPI+  A+ K + +IS +VK L +RAK  KL PEE+QGG
Sbjct: 329 VIRQYKNVDVSVAVATPTGLITPIVTNAESKGLAEISNQVKDLGKRAKVGKLLPEEFQGG 388

Query: 340 TTSISNMGM-LGINSFCAVINPPQSTILAIGAGEKKVV---FQNEEIKVATIMNATLSAD 395
           T  ISN+GM   + +F ++INPPQS ILAIG  EKK V      +      ++  T + D
Sbjct: 389 TICISNLGMNHAVTAFTSIINPPQSAILAIGTTEKKAVPSEVNEQGFVFDDVITITGTFD 448

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR +DGA+  + + + K  +ENP+ ML+
Sbjct: 449 HRVIDGALGGEWMKELKRIVENPLEMLI 476


>gi|268316954|ref|YP_003290673.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodothermus marinus DSM 4252]
 gi|262334488|gb|ACY48285.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodothermus marinus DSM 4252]
          Length = 441

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 163/456 (35%), Positives = 250/456 (54%), Gaps = 57/456 (12%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP +S TM EG L  W+ +EG ++S GD++ ++ETDKA M+ E  D+G++ + +V  G
Sbjct: 5   IEMPKMSDTMEEGVLVAWLVEEGQRVSAGDVIAQVETDKATMDLEVYDDGVLLKKVVKEG 64

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHS------------------- 106
            E++ +   ++ +L D            E+I E+ E +S                     
Sbjct: 65  -ESVPIGG-LIAVLGDEG----------EDISEILERYSGQKEAPAQAEPAPEAAPAEAA 112

Query: 107 --------------SPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKS 152
                         +P V     ++ R  ASPLAR+LA E+G+DL ++ G+GP GRIV+ 
Sbjct: 113 PQAEQPARAGDGAPAPAVTAGDGAEARIKASPLARKLAREYGLDLRTIQGTGPEGRIVRR 172

Query: 153 DIETLISTK---TNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRL 209
           DIE  ++ +     V   +   +              L     YE +P  ++R+TIA RL
Sbjct: 173 DIEAALARQRPSVEVAAPAPEAAPAPAPAPTPTPAPEL----PYESVPITSMRRTIARRL 228

Query: 210 QQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQV 269
            QSK T PHFY+++D +++  ++ R+Q+N   +    +   KIS ND+I KA ALA+ + 
Sbjct: 229 AQSKFTAPHFYLTVDVDVEKAIAFRQQLN---ELAEAQERPKISFNDLITKACALALRRH 285

Query: 270 PEANVSW--TTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAK 327
           PE N S+      + R K I I +AV++  G+VTP+IR ADQK +  I+ E + LA++A+
Sbjct: 286 PEINASYLEQEGEIRRWKEIHIGIAVALEDGLVTPVIRNADQKGLGQIAEETRALAEKAR 345

Query: 328 QRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATI 387
           QRKL+P+E +G T + SN+GM GI  F A+INPP + ILAIGA     V +N  I     
Sbjct: 346 QRKLQPQEMEGATFTTSNLGMYGIEEFTAIINPPNACILAIGAIRDVPVVKNGMIVPGKR 405

Query: 388 MNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           M  TLS DHR VDGA  ++ L   ++Y+E P+ +L+
Sbjct: 406 MRLTLSCDHRIVDGATGARFLKTVQQYLEEPLNLLL 441


>gi|307111510|gb|EFN59744.1| hypothetical protein CHLNCDRAFT_48412 [Chlorella variabilis]
          Length = 419

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 154/427 (36%), Positives = 236/427 (55%), Gaps = 23/427 (5%)

Query: 8   MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTE 67
           MP+LSPTM++G L  W  + G +++PGD+L ++ETDKA + +E+ DEG + ++LVP G +
Sbjct: 1   MPALSPTMSQGNLVAWHVKVGQEVAPGDVLADVETDKATLSWENQDEGFVAKLLVPEGAK 60

Query: 68  NIAVNSPILNILMDSTEIPP-----SPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
           +IAV +P+  ++ ++ ++                 E +   + +        H  +R   
Sbjct: 61  DIAVGAPVALLVEEAEQVVAFKDYAPGGAPAAAAAEQQAPAAAAGTAAPGGAHHSDR--M 118

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
            P AR L  E GI    ++ +GPHG I K D+   ++        +          +  A
Sbjct: 119 GPAARTLLAESGIPADLVTPTGPHGIITKGDVLAAMAAGVKAAPPAAAPRPAPAAAAAPA 178

Query: 183 NILNLF------AKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
                       A  +Y  +P+  IRK IA RL +SKQTIPH Y+S D ++D + +LR+ 
Sbjct: 179 ARQAAAAQNVPPAGAAYTDVPNSQIRKVIAQRLLESKQTIPHLYLSADVDLDGVAALRDS 238

Query: 237 MNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSW--TTNAMIRHKHIDISVAVS 294
           +             K+SVND +++A ALA+ +VP AN  W     A +    +DI++AV+
Sbjct: 239 LKAQ--------GAKVSVNDCVVRAVALALAEVPAANSLWDAAQEAAVPAGSVDIAIAVA 290

Query: 295 IPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSF 354
              G++TPIIR AD K +  I  EV++LA RA+  KL+PEE+QGG+ SISN+GM GI+ F
Sbjct: 291 TDTGLITPIIRAADTKPLPQIVAEVRELAGRARANKLRPEEFQGGSFSISNLGMFGIDKF 350

Query: 355 CAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEY 414
           CA++NPPQ+ I+A+G   K  V ++      T M  TLSAD+R  DG +A+  LA F  +
Sbjct: 351 CAIVNPPQACIMAVGGARKVAVMKDGLPASKTQMTVTLSADNRVYDGEVAAAFLAAFSRH 410

Query: 415 IENPVWM 421
           I NP  M
Sbjct: 411 ISNPYRM 417


>gi|254576873|ref|XP_002494423.1| ZYRO0A01144p [Zygosaccharomyces rouxii]
 gi|238937