PSIBLAST alignment of GI: 254780674 and protein with PDB id: 1o78

>gi|159162771|pdb|1O78|A Chain A, Biotin Carboxyl Carrier Domain Of Transcarboxylase (1.3s) [10-48] Deletion Mutant Length = 84
 Score = 68.0 bits (164), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 13/62 (20%), Positives = 30/62 (48%), Gaps = 1/62 (1%)

Query: 18 GKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILN 77
          G ++K + +EGD +  G  +  +E  K   E  +  +G ++++LV    + +     ++ 
Sbjct: 24 GTVSKILVKEGDTVKAGQTVLVLEAMKMETEINAPTDGKVEKVLVKE-RDAVQGGQGLIK 82

Query: 78 IL 79
          I 
Sbjct: 83 IG 84