PSIBLAST alignment of GI: 254780674 and protein with PDB id: 3crk

>gi|186973095|pdb|3CRK|C Chain C, Crystal Structure Of The Pdhk2-L2 Complex. Length = 87
>gi|186973096|pdb|3CRK|D Chain D, Crystal Structure Of The Pdhk2-L2 Complex. Length = 87
>gi|186973099|pdb|3CRL|C Chain C, Crystal Structure Of The Pdhk2-L2 Complex. Length = 87
>gi|186973100|pdb|3CRL|D Chain D, Crystal Structure Of The Pdhk2-L2 Complex Length = 87
 Score =  100 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 55/81 (67%)

Query: 5  TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
           + +P+LSPTMT G + +W K+ G+K+S GD+L EIETD A + FE  +EG + +ILVP 
Sbjct: 7  QVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDXATIGFEVQEEGYLAKILVPE 66

Query: 65 GTENIAVNSPILNILMDSTEI 85
          GT ++ + +P+  I+    +I
Sbjct: 67 GTRDVPLGTPLCIIVEKEADI 87