PSIBLAST alignment of GI: 254780674 and protein with PDB id: 3ho8

gi|242556707|pdb|3HO8|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase In Complex With Coenzyme A Length = 1150
>gi|242556708|pdb|3HO8|D Chain D, Crystal Structure Of S. Aureus Pyruvate Carboxylase In Complex With Coenzyme A Length = 1150
 Score = 58.0 bits (138), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 12/62 (19%), Positives = 25/62 (40%), Gaps = 1/62 (1%)

Query: 18   GKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILN 77
            G + +     G+ +     L   E  K     ++  +G+I ++ V  G + IA    ++ 
Sbjct: 1086 GSVTEVKVSVGETVKANQPLLITEAMKMETTIQAPFDGVIKQVTVNNG-DTIATGDLLIE 1144

Query: 78   IL 79
            I 
Sbjct: 1145 IE 1146