BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780674|ref|YP_003065087.1| pyruvate dehydrogenase complex
dihydrolipoamide acetyltransferase [Candidatus Liberibacter asiaticus
str. psy62]
         (423 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|154251908|ref|YP_001412732.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Parvibaculum lavamentivorans DS-1]
 gi|154155858|gb|ABS63075.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Parvibaculum lavamentivorans DS-1]
          Length = 413

 Score =  323 bits (826), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 100/422 (23%), Positives = 185/422 (43%), Gaps = 11/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  +AKW K+ GD ++  + L E+ETDK  +E  +   G++ EI+
Sbjct: 1   MATEIRVPTLGESVTEATVAKWFKKPGDSVAVDEPLVELETDKVTVEVPAPAAGVLSEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E + V + +  I     +        +E      +          +E        
Sbjct: 61  AADG-ETVEVGALLGAIGEGGAKAAAPAAKKEEPKKAEAKPEPKKEEPKKQEA------- 112

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
             P     A          + +      V+   +    TK + ++ ++ ++       + 
Sbjct: 113 KEPAKPADAEPSPAVRRVAAENDLDVSKVEGTGKGGRVTKADAEEAASGKAEAKPSAPVQ 172

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A           E +    +RKTIA RL++++ T        + ++ N+++LR Q     
Sbjct: 173 APAARADNGAREERVKMTRLRKTIATRLKEAQNTAAMLTTFNEVDMTNVMALRTQYKDLF 232

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ ++P  N       ++   + +I VAV    G+V 
Sbjct: 233 EKK---HGVRVGFMGFFVKACIHALRELPAVNAEIDGEELVYKNYYNIGVAVGTDRGLVV 289

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R A   S+ +I   +  L +RA+   LK ++ QGGT +ISN G+ G      ++N P
Sbjct: 290 PVLRDAQDLSLAEIEKAINNLGRRARDGDLKLDDLQGGTFTISNGGVYGSLMSTPILNAP 349

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +    +I++  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 350 QSGILGMHKIQERPMVVGGKIEIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPQRL 409

Query: 422 LM 423
           L+
Sbjct: 410 LL 411


>gi|254780674|ref|YP_003065087.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040351|gb|ACT57147.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 423

 Score =  320 bits (819), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 423/423 (100%), Positives = 423/423 (100%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI
Sbjct: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP
Sbjct: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI
Sbjct: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
           DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT
Sbjct: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
           LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV
Sbjct: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP
Sbjct: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW
Sbjct: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420

Query: 421 MLM 423
           MLM
Sbjct: 421 MLM 423


>gi|158425635|ref|YP_001526927.1| dihydrolipoamide succinyltransferase [Azorhizobium caulinodans ORS
           571]
 gi|158332524|dbj|BAF90009.1| dihydrolipoamide succinyltransferase [Azorhizobium caulinodans ORS
           571]
          Length = 412

 Score =  312 bits (799), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 96/422 (22%), Positives = 174/422 (41%), Gaps = 12/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ GD +   + L E+ETDK  +E  +   G++ EI+
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKPGDAVKADEPLVELETDKVTVEVPAPAAGVLSEII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + +  I   +     + P ++          + +         + +   
Sbjct: 61  AKDG-DTVGVGALLGAIAEGAAGAAAAAPKAEAPKAAPAPAAAPAPAPAAAPAKAASGAN 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              + R  A       +               +  + S            +       +D
Sbjct: 120 GPAVERLAAETGVSAANVAGSGKDGRVTKGDMLAAIASGAAAPAAAPAPVAVRAPSAPVD 179

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A           E +    +R+TIA RL+ ++ T        D ++  ++ LR Q   + 
Sbjct: 180 AA--------REERVKMTKLRQTIARRLKDAQNTAAMLTTFNDVDMSAVMGLRAQFKDSF 231

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+  +P  N       ++   + +I +AV    G+V 
Sbjct: 232 EKK---HGTKLGFMGFFTKAVIAALKDLPAVNAEIDGQDIVYKNYYNIGIAVGTEKGLVV 288

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD+ S+  I   +    ++A+  KL  E+ QGGT +I+N G+ G      ++N P
Sbjct: 289 PVVRDADELSVAGIEKAIAGFGRKARDGKLGIEDMQGGTFTITNGGIYGSLMSTPILNAP 348

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   E++ V    +I V  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 349 QSGILGMHRIEERPVVVKGQIVVRPMMYLALSYDHRIVDGREAVTFLVRVKETLEDPARL 408

Query: 422 LM 423
           ++
Sbjct: 409 VL 410


>gi|85713707|ref|ZP_01044697.1| dihydrolipoamide acetyltransferase [Nitrobacter sp. Nb-311A]
 gi|85699611|gb|EAQ37478.1| dihydrolipoamide acetyltransferase [Nitrobacter sp. Nb-311A]
          Length = 428

 Score =  312 bits (798), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 97/430 (22%), Positives = 177/430 (41%), Gaps = 13/430 (3%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I +P+L  ++TE  + KW K+ GD +S  + L E+ETDK  +E  +   G + E++ 
Sbjct: 1   MTEIRVPTLGESVTEATIGKWFKKPGDAVSVDEPLVELETDKVTIEVPAPSAGTLAELVA 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPS------PPLSKENIVEVREEHSHSSPVVVREKHS 116
             G E +AV + +  I        P+                  +  +        E+  
Sbjct: 61  KEG-ETVAVGALLGQITEGGASAKPAAVKAQGIAPESATGRPDLKSDTTKPINAGPEEPR 119

Query: 117 KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLV 176
                A+P    LA       +              D     S      + +      + 
Sbjct: 120 PRPEAAAPTDAPLAPSVRKLSAESGIDASTVPGSGKDGRVTKSDMLAAIEEAASAPTPVH 179

Query: 177 DESIDANILNLFAKD---SYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSL 233
             +    +     +D     E +    +R+TIA RL++ + T        + ++  +++L
Sbjct: 180 QPAAAMQVRAPSPQDDASREERVKMTRLRQTIARRLKEVQNTAAILTTFNEVDMTGVMTL 239

Query: 234 REQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAV 293
           R       +        K+       KA   A+  +P  N       +I   +  I +AV
Sbjct: 240 RSHYKDAFEKK---HGVKLGFMGFFTKAIVQALKDIPAVNAEIDGGDLIYKNYYHIGIAV 296

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
               G+V P++R  D KSI +I   +    +RA+  +LK EE QGGT +I+N G+ G   
Sbjct: 297 GTDKGLVVPVVRDCDHKSIAEIEKSIADYGRRARDGRLKIEEMQGGTFTITNGGIYGSLM 356

Query: 354 FCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKE 413
              ++N PQ+ IL +   +++ V  + ++++  +M   LS DHR +DG  A   L + KE
Sbjct: 357 STPILNAPQAGILGMHKIQERPVAIDGKVEIRPMMYLALSYDHRVIDGKEAVTFLVRVKE 416

Query: 414 YIENPVWMLM 423
            +E+P  +++
Sbjct: 417 SLEDPARLVL 426


>gi|13473635|ref|NP_105203.1| dihydrolipoamide succinyltransferase [Mesorhizobium loti
           MAFF303099]
 gi|14024385|dbj|BAB50989.1| dihydrolipoamide succinyl transferase [Mesorhizobium loti
           MAFF303099]
          Length = 424

 Score =  311 bits (797), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 109/428 (25%), Positives = 193/428 (45%), Gaps = 12/428 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ GD I+  + L E+ETDK  +E  +   G + EI+
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKVGDAIAVDEPLVELETDKVTVEVPAAAAGTLGEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREK------H 115
              G E + V + + +I    +     P    +         S  +     +        
Sbjct: 61  AKEG-ETVGVGALLGSISAGGSAPATKPQAVSQASSPDAASTSKQAAAETAKIAGDAGAV 119

Query: 116 SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGL 175
                  +P A +L  E+ + +  LSGSG  G+++K D+   I+     +   T ++   
Sbjct: 120 EPRSMPPAPAAAKLIAENNLSVDQLSGSGKRGQVLKGDVLDAIAKGAPSQPAETPRAAPA 179

Query: 176 VDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLRE 235
                  +  +  +++  E +    +R+TIA RL++++ T        + ++  +++LR 
Sbjct: 180 PIAVRAPSSGDDASRE--ERVRMTKLRQTIARRLKEAQSTAAMLTTFNEVDMSAVMALRT 237

Query: 236 QMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSI 295
           +     +        K+       KA   A+ ++P  N       +I      + VAV  
Sbjct: 238 KYKDVFEKK---HGVKLGFMGFFTKAVTHALKEIPAVNAEIDGTDIIYKNFAHVGVAVGT 294

Query: 296 PGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFC 355
             G+V P++R ADQ SI +I  E+ +L   A+  KL   + QGGT +ISN G+ G     
Sbjct: 295 EKGLVVPVVRDADQMSIAEIEKEIGRLGIAARDGKLSVADMQGGTFTISNGGVYGSLMST 354

Query: 356 AVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYI 415
            ++N PQS IL +   + + V    +I +  +M   LS DHR VDG  A   L + KE +
Sbjct: 355 PILNAPQSGILGMHKIQDRPVVVGGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESL 414

Query: 416 ENPVWMLM 423
           E+P  +++
Sbjct: 415 EDPERLVL 422


>gi|86747403|ref|YP_483899.1| dihydrolipoamide succinyltransferase [Rhodopseudomonas palustris
           HaA2]
 gi|86570431|gb|ABD04988.1| 2-oxoglutarate dehydrogenase E2 component [Rhodopseudomonas
           palustris HaA2]
          Length = 411

 Score =  310 bits (793), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 103/421 (24%), Positives = 180/421 (42%), Gaps = 12/421 (2%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I +P+L  ++TE  + +W K++GD ++  + L E+ETDK  +E  +   G + EI+ 
Sbjct: 1   MTEIRVPTLGESVTEATIGRWFKKQGDAVAVDEPLVELETDKVTIEVPAPSAGTLGEIIA 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G E +AV + +  I        P+ P               ++        +   P  
Sbjct: 61  KDG-ETVAVGALLGQISEGGGAAKPAAPAKPAAAPAAAAAAPAAAAPKAAPADAPQAPSV 119

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
             L+     +      S          + + IE   S  T V   +          + DA
Sbjct: 120 RRLSTESGVDASTVPGSGKDGRVTKGDMLAAIEKAASAPTPVNQPAAAVQVRAPSPADDA 179

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
                      E +    +R+TIA RL++ + T        + ++ N+++LR Q     +
Sbjct: 180 A--------REERVKMTRLRQTIARRLKEVQNTAAMLTTFNEVDMTNVMALRSQYKDVFE 231

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                   K+       KA   A+  +P  N       +I   +  + VAV    G+V P
Sbjct: 232 KK---HGAKLGFMGFFTKACVQALKDIPAVNAEIDGTDLIYKNYYHVGVAVGTDKGLVVP 288

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R  D+KSI  I   +    +RA+  +LK EE QGGT +I+N G+ G      ++N PQ
Sbjct: 289 VVRDCDEKSIAAIEKGIADFGKRARDGQLKIEEMQGGTFTITNGGIYGSLMSTPILNAPQ 348

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL +   +++ V    +I++  +M   LS DHR +DG  A   L + KE +E+P  ++
Sbjct: 349 SAILGMHKIQERPVVVAGKIEIRPMMYLALSYDHRVIDGKEAVTFLVRVKESLEDPARLV 408

Query: 423 M 423
           +
Sbjct: 409 L 409


>gi|254717984|ref|ZP_05179795.1| dihydrolipoamide succinyltransferase [Brucella sp. 83/13]
 gi|265982927|ref|ZP_06095662.1| dihydrolipoamide succinyltransferase [Brucella sp. 83/13]
 gi|306839761|ref|ZP_07472562.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Brucella sp. NF 2653]
 gi|264661519|gb|EEZ31780.1| dihydrolipoamide succinyltransferase [Brucella sp. 83/13]
 gi|306405116|gb|EFM61394.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Brucella sp. NF 2653]
          Length = 408

 Score =  310 bits (793), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 103/422 (24%), Positives = 186/422 (44%), Gaps = 16/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ I+  + L E+ETDK  +E  +   G++ EI 
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKAGEAIAVDEPLVELETDKVTVEVPAPAAGVLAEIT 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + +  I  D   +  +P   KE         + +           +   
Sbjct: 61  AKEG-DTVEVGALLGQISSDGAAVAAAPAQKKEEAKPAAAAPAAAPVASASSG---SAMQ 116

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +  A +L  E G+    + GSG  G+++K D+   I+   +    +             
Sbjct: 117 PAQAAAKLLAESGLSADQVEGSGKRGQVLKGDVLDAITKGVSAAPAAP---------VAA 167

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
               +       E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 168 RPASSADDASREERVKMTRLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMELRNKYKDVF 227

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++      + +AV    G+V 
Sbjct: 228 EKK---HGVKLGFMGFFTKAVTHALKEIPAVNAEIDGTDIVYKNFCHVGMAVGTDKGLVV 284

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI ++  E+ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 285 PVIRDADQMSIAEVEKELARLARAARDGSLSMADMQGGTFTITNGGVYGSLMSTPILNAP 344

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +    +I V  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 345 QSGILGMHKIQERPMVVGGQIVVRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 404

Query: 422 LM 423
           ++
Sbjct: 405 VL 406


>gi|88811363|ref|ZP_01126618.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Nitrococcus mobilis Nb-231]
 gi|88791252|gb|EAR22364.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Nitrococcus mobilis Nb-231]
          Length = 443

 Score =  309 bits (792), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 95/445 (21%), Positives = 183/445 (41%), Gaps = 27/445 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P+L  ++TE  +  W K+ GD+++  + L ++ETDK ++E  + ++G++ +IL
Sbjct: 1   MSIEVKVPALPESVTEATVVGWHKKPGDRVARDENLVDLETDKVVLEVPAPEDGVLGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVR--------------------- 100
              G   +  +  +  +    T      P S +   + R                     
Sbjct: 61  KDEGA-TVVADEVLACLEQGETNSQAERPASAKGEDDNRAPGPTSRQGSDDAARDRTAEP 119

Query: 101 --EEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI 158
               H + +      +      +          +  I    +            + +   
Sbjct: 120 DATPHRNDNLSPAVRRMVAEHELDPARIEGTGRDGRIIKEDVIRHLASHEQPAPEQDESP 179

Query: 159 STKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPH 218
                 +      +     E+ +A      ++      P   +R+ IA RL +++Q    
Sbjct: 180 DGTAGTEQAPRQSARPPTSETSEARWTPSTSERPERRAPMTRLRQRIAERLVEAQQNTAM 239

Query: 219 FYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTT 278
                +CN+  ++SLR +     +        K+ +    +K    A+ + P  N S   
Sbjct: 240 LTTFNECNMQPIMSLRNRYKERFE---RYHGIKLGIMSFFVKTVIEALKRFPAVNASIDG 296

Query: 279 NAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQG 338
             +I H + DI +AVS   G++ P++R ADQ    +I   +    +RA++ K+  +E  G
Sbjct: 297 KDIIYHGYYDIGIAVSTERGLLVPVLRDADQLGFAEIEQAIADFGRRARESKIHIDELTG 356

Query: 339 GTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRS 398
           GT +I+N G+ G      ++NPPQS IL +   + + V +N  + V  +M   LS DHR 
Sbjct: 357 GTFTITNGGIFGSLMSTPILNPPQSGILGMHRIQDRPVVENAAVTVRPMMYLALSYDHRI 416

Query: 399 VDGAIASKLLAKFKEYIENPVWMLM 423
           +DG  A + L   KE +E+P  +L+
Sbjct: 417 IDGREAVQFLVTIKELLEDPSRLLL 441


>gi|110635727|ref|YP_675935.1| dihydrolipoamide acetyltransferase [Mesorhizobium sp. BNC1]
 gi|110286711|gb|ABG64770.1| 2-oxoglutarate dehydrogenase E2 component [Chelativorans sp. BNC1]
          Length = 428

 Score =  309 bits (792), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 95/430 (22%), Positives = 174/430 (40%), Gaps = 12/430 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + +W K+ GD I+  + + E+ETDK  +E  +   G + EI 
Sbjct: 1   MATEIRVPTLGESVTEATIGRWFKKVGDAIAADEPVVELETDKVTVEVPAPSAGTLQEIA 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  G + + V + + +I   +   P     +     E   + + +S      +  +    
Sbjct: 61  VKEG-DTVEVGALLGSIGEGAAAAPAKAAPAAREKKEAVAQAAGASGAGSTGEAIEKTAN 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                     +     S+      +         +    +    D       G       
Sbjct: 120 VGGEPPIEERKRPPAPSAAKLLAENRLSTDEVAGSGKDGQVLKGDVLAAIERGGRGAPSQ 179

Query: 182 ANILN--------LFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSL 233
              L            +   E +    +R+TIA RL+ ++          + ++  ++ L
Sbjct: 180 PAELPKVARAPSAPEDEVREERVKMTRLRQTIARRLKDAQSNAAMLTTFNEVDMTAVMDL 239

Query: 234 REQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAV 293
           R++     +        K+       KA   A+ ++P  N       +I      I VAV
Sbjct: 240 RKKYKDLFEKK---HGVKLGFMGFFTKAVCHALKEIPAVNAEIDGTDIIYKNFCHIGVAV 296

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
               G+V P++R AD+ +I +I  E+ +L   A+  KL   + QGGT +ISN G+ G   
Sbjct: 297 GTERGLVVPVVRDADRMTIAEIEKEIGRLGAEARDGKLALADMQGGTFTISNGGVYGSLM 356

Query: 354 FCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKE 413
              ++N PQS IL +   +++ +    +I V  +M   LS DHR VDG  A   L + K+
Sbjct: 357 STPILNAPQSGILGMHKIQERPMVVGGQIVVRPMMYLALSYDHRIVDGKEAVTFLVRVKD 416

Query: 414 YIENPVWMLM 423
            +E+P  +++
Sbjct: 417 VLEDPERLVL 426


>gi|220933270|ref|YP_002512169.1| dihydrolipoamide acetyltransferase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219994580|gb|ACL71182.1| dihydrolipoamide acetyltransferase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 412

 Score =  309 bits (791), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 92/422 (21%), Positives = 180/422 (42%), Gaps = 12/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++ +  +  W K+ GD +S  +IL +IETDK ++E  + ++G+I+EIL
Sbjct: 1   MSTDVKIPELPESVADATIVSWHKKAGDAVSRDEILLDIETDKVVLEVPAPEDGVIEEIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +     +  +   +     +                 +          +  P+
Sbjct: 61  AAEG-ETVTAGQVVGRLGAGAGAGAGAGKSEAPKP--------TAGKAEAANARGETPPL 111

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           +  + + +A       +          + +  +  L   ++  K  +   S         
Sbjct: 112 SPAVRKLVAEHDLDASAIRGTGKDGRILKEDVLSHLEQQESQAKPAAEKPSAPTAQPPAA 171

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           ++   L  + +   +P   +R  IA RL + +          + N+  ++ +R       
Sbjct: 172 SSPAPLPGQRTERRVPMTRLRARIAERLLEVQHNAAILTTFNEVNMAPVMEMRATHKDAF 231

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      ++A   A+ + PE N S     ++ H + DI +AVS P G+V 
Sbjct: 232 EKR---HGVRLGFMSFFVRAATEALKRFPEVNASIDGRDIVYHGYFDIGIAVSSPRGLVV 288

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D  S+  +   +    ++AK   L  ++  GGT +ISN G+ G      +INPP
Sbjct: 289 PVLRDTDTLSMAGVEKAINAFGEKAKSGGLTMDDLTGGTFTISNGGVFGSLLSTPIINPP 348

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ V +N ++ +  +M   LS DHR +DG  A + LA  K  +E+P  +
Sbjct: 349 QSAILGMHKIQERPVAENGQVVIRPMMYLALSYDHRLIDGREAVQFLATIKGLLEDPAKL 408

Query: 422 LM 423
           L+
Sbjct: 409 LL 410


>gi|154244116|ref|YP_001415074.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Xanthobacter autotrophicus Py2]
 gi|154158201|gb|ABS65417.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Xanthobacter autotrophicus Py2]
          Length = 409

 Score =  309 bits (791), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 109/422 (25%), Positives = 190/422 (45%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ GD +   + L E+ETDK  +E  +   G++ EI+
Sbjct: 1   MTTEIRVPTLGESVTEATIGKWFKKPGDTVKADEPLVELETDKVTVEVPAPAAGVLAEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + + +I   S     +P  +           + +              +
Sbjct: 61  AKDG-DTVGVGALLGSIGAGSGAAAAAPAAAAPAPAAAAPAPAPAPAAAPAAS---GSSV 116

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
             P   R+A E G+D S ++GSG  GR+ K D+   ++        +   +       ID
Sbjct: 117 NGPAVGRIAAESGVDPSGVAGSGKDGRVTKGDMLAAVAAGAAAAPAAAPIAVRAPSAPID 176

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A           E +    +R+TIA RL+ ++ T        D ++  ++SLR Q     
Sbjct: 177 AV--------REERVKMTKLRQTIARRLKDAQNTAAMLTTFNDVDMSAVMSLRAQFKDAF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+  +P  N       ++   + +I +AV    G+V 
Sbjct: 229 EKK---HGTKLGFMGFFTKAVIAALKDLPAVNAEIDGQDLVYKNYYNIGIAVGTEKGLVV 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ S+ +I   +    ++A+  KL  E+ QGGT +I+N G+ G      ++N P
Sbjct: 286 PVVRDADQLSVAEIEKAIAGFGRKARDGKLGIEDMQGGTFTITNGGIYGSLMSTPILNAP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   E++ V    ++ +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 346 QSGILGMHRIEERPVAIKGQVVIRPMMYLALSYDHRIVDGREAVTFLVRVKETLEDPARL 405

Query: 422 LM 423
           ++
Sbjct: 406 VL 407


>gi|148252004|ref|YP_001236589.1| dihydrolipoamide succinyltransferase [Bradyrhizobium sp. BTAi1]
 gi|146404177|gb|ABQ32683.1| 2-oxoglutarate dehydrogenase E2 component [Bradyrhizobium sp.
           BTAi1]
          Length = 411

 Score =  308 bits (789), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 104/421 (24%), Positives = 181/421 (42%), Gaps = 12/421 (2%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I +P+L  ++TE  + +W K+ GD ++  + L E+ETDK  +E  +   G + EI+ 
Sbjct: 1   MTEIRVPTLGESVTEATIGRWFKKAGDAVAVDEPLVELETDKVTIEVPAPSAGTLGEIIA 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G E +AV + +  I   +    P+               +  +P       +   P  
Sbjct: 61  KDG-ETVAVGALLGQINDGAVAAKPAAAAPAPAKPAAAPAAAAPAPAKALPADTPQAPSV 119

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
             L+     +      S          + + IE   S  T V   +          + DA
Sbjct: 120 RKLSAESGVDATTVPGSGKDGRVTKGDMLAAIERAASAPTPVNQPAAAVQVRAPSPADDA 179

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
                      E +    +R+TIA RL+  + T        + ++ N+++LR Q     +
Sbjct: 180 A--------REERVKMTRLRQTIARRLKDVQNTAAMLTTFNEVDMTNVMALRSQYKDVFE 231

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                  +K+       KA   A+  +P  N     + +I   +  I VAV    G+V P
Sbjct: 232 KK---HGSKLGFMGFFTKAVVQALKDIPAVNAEIDGSDLIYKNYYHIGVAVGTDKGLVVP 288

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R  D KSI DI   +    +RA+  +LK +E QGGT +I+N G+ G      ++N PQ
Sbjct: 289 VVRDCDHKSIADIEKGIADFGRRARDGQLKIDEMQGGTFTITNGGIYGSLMSTPILNAPQ 348

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL +   +++ V    +I++  +M   LS DHR +DG  A   L + KE +E+P  ++
Sbjct: 349 SGILGMHKIQERPVVVGGKIEIRPMMYLALSYDHRVIDGKEAVTFLVRVKESLEDPARLV 408

Query: 423 M 423
           +
Sbjct: 409 L 409


>gi|312113432|ref|YP_004011028.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218561|gb|ADP69929.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 437

 Score =  308 bits (788), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 111/427 (25%), Positives = 192/427 (44%), Gaps = 9/427 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + +W K+ GD +   + + E+ETDK  +E  +   G+I EIL
Sbjct: 13  MTTEIVVPTLGESVTEATIGRWFKKPGDAVKADEAVAELETDKVTLEVNAPAAGVIAEIL 72

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  G E + V + +  I   +                     + ++     +  S   P 
Sbjct: 73  VKEG-ETVGVGALLGTIAEGAGAAANGGAPKSAEKSAPAPVAAQATTPSPVQAASPRSPN 131

Query: 122 AS---PLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS--TKTNVKDYSTIQSFGLV 176
                P  RR+A E GI+ +++SG+G  GR+ K D+ ++I     +     S+       
Sbjct: 132 VDVLAPSVRRIAEETGINPATISGTGKDGRVTKGDMLSVIEGGAASASVAPSSFFEKAPP 191

Query: 177 DESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
                        +   E +    +R+TIA RL++++          + ++  ++ LR +
Sbjct: 192 PAPAVRPAAPRTIEAREERVRMTKLRQTIARRLKEAQNNAAMLTTFNEVDMSTIMDLRNR 251

Query: 237 MNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIP 296
                +        K+      +KA   A+  VP  N     + +I      I +AV   
Sbjct: 252 YKTIFEKK---HGTKLGFMGFFVKAVLHALHDVPSVNAEIDGDDIIYKNFYHIGIAVGTD 308

Query: 297 GGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCA 356
            G+V P++R AD KS+ +I  E+     +A+  KL  EE QGGT +ISN G+ G      
Sbjct: 309 RGLVVPVVRDADHKSVAEIEKEIAGFGVKARDGKLSLEEMQGGTFTISNGGVYGSLMSTP 368

Query: 357 VINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIE 416
           ++N PQS IL +   +++ V  N +I++  +M   LS DHR VDG  A   L   K+ +E
Sbjct: 369 ILNAPQSGILGMHKIQERPVVVNGKIEIRPMMYLALSYDHRLVDGKDAVTFLVHVKDALE 428

Query: 417 NPVWMLM 423
           +P  +++
Sbjct: 429 DPQRLIL 435


>gi|319780730|ref|YP_004140206.1| 2-oxoglutarate dehydrogenase E2 subunit, dihydrolipoamide
           succinyltransferase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166618|gb|ADV10156.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 424

 Score =  308 bits (788), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 101/426 (23%), Positives = 171/426 (40%), Gaps = 8/426 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ GD I+  + L E+ETDK  +E  +   G + EI 
Sbjct: 1   MATEIRVPTLGESVTEATVGKWFKKVGDTIAADEPLVELETDKVTVEVPAAAAGTLGEIT 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  G E + V + + +I          P    +            +     +      P+
Sbjct: 61  VKEG-ETVGVGALLGSISAGGAAPATKPQAVSQASSPDAASTGKQAAAETAKIAGDAGPV 119

Query: 122 ASPLARRLAGEHGIDLSSL----SGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
                        +   S       SG   R      + L +                  
Sbjct: 120 EPRTMPPAPAAAKLIAESNLSVDQISGSGKRGQVLKGDVLDAISKGAPSQPAETPKAAPA 179

Query: 178 ESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
                   +       E +    +R+TIA RL++++ T        + ++  +++LR + 
Sbjct: 180 PVAVRAPSSGDDASREERVRMTKLRQTIARRLKEAQSTAAMLTTFNEVDMSAVMALRTKY 239

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
               +        K+       KA   A+ ++P  N       +I   +  I VAV    
Sbjct: 240 KDVFEKK---HGVKLGFMGFFTKAVTHALKEIPSVNAEIDGTDIIFKNYAHIGVAVGTEK 296

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G+V P++R ADQ SI +I  ++ +L   A+  KL   + QGGT +ISN G+ G      +
Sbjct: 297 GLVVPVVRDADQMSIAEIEKDIGRLGIAARDGKLSVADMQGGTFTISNGGVYGSLMSTPI 356

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           +N PQS IL +   + + V    +I +  +M   LS DHR VDG  A   L + KE +E+
Sbjct: 357 LNAPQSGILGMHKIQDRPVVVGGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLED 416

Query: 418 PVWMLM 423
           P  +++
Sbjct: 417 PERLVL 422


>gi|239833050|ref|ZP_04681379.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Ochrobactrum intermedium LMG 3301]
 gi|239825317|gb|EEQ96885.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Ochrobactrum intermedium LMG 3301]
          Length = 409

 Score =  308 bits (788), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 99/422 (23%), Positives = 174/422 (41%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ GD ++  + L E+ETDK  +E  +   G++ EI+
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKVGDAVAVDEPLVELETDKVTVEVPAAAAGVLAEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + VN+ +  I  D      +P   KE         +                 
Sbjct: 61  AKEG-DTVEVNALLGQISGDGAAAAAAPAAKKEEAKPAAPAAAAPVASASS--------- 110

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
               A + A      L+  + S           + L     +        +      +  
Sbjct: 111 --GPAMQPAPAASKLLNENNLSADQVEGSGKRGQVLKGDVLDAIAKGVSVAPAAAAPAAA 168

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                       E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 169 RPASPADDASREERVKMTRLRQTIAKRLKDAQNTAAMLTTYNEVDMSAVMELRTKYKDIF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       +I      + +AV    G+V 
Sbjct: 229 EKK---HGVKLGFMGFFTKAVTHALKEIPAVNAEIDGTDIIYKNFAHVGMAVGTDKGLVV 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR AD  SI +I  E+ +LA+ A++  L   + QGGT +I+N G+ G      ++N P
Sbjct: 286 PVIRDADSMSIAEIEKELGRLAKAAREGSLSMADMQGGTFTITNGGVYGSLMSSPILNAP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ V    +I +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 346 QSGILGMHKIQERPVVVGGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 405

Query: 422 LM 423
           ++
Sbjct: 406 VL 407


>gi|170740407|ref|YP_001769062.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Methylobacterium sp. 4-46]
 gi|168194681|gb|ACA16628.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Methylobacterium sp. 4-46]
          Length = 418

 Score =  308 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 94/422 (22%), Positives = 172/422 (40%), Gaps = 6/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++ E  + +W K+ GD +   + L E+ETDK  +E  +   G + +I+
Sbjct: 1   MATEIRVPTLGESVNEATIGRWFKKPGDTVKADEPLVELETDKVTLEVNAPAAGKLGDIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +   + + +I+  +         + +         + +S            P 
Sbjct: 61  AKDG-ETVEPGALLGSIVEGAGNGAAEAAPAPKAAPAPAAAPAQTSSASYGSHGDAAPPG 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A            +   +           K    T           +      L   +  
Sbjct: 120 ARAAQDHGPAVARLAQETGVDPASLQGSGKDGRVTKGDMLAAASGAAAPAPAPLPQVARA 179

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            +  +  A++  E +    +R+TIA RL+ ++          D ++  +++LR+Q     
Sbjct: 180 PSAPDDAARE--ERVRMTKLRQTIARRLKDAQNIAAMLTTFNDVDMSAVMALRQQYKDVF 237

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+  VP  N       ++   +  I +AV    G+V 
Sbjct: 238 EKK---HGTKLGFMGFFTKAVIQALKDVPAVNAEIDGQDIVYKNYYHIGIAVGTDKGLVV 294

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD  SI  I   +    ++A+  KL  +E QGGT +I+N G+ G      ++N P
Sbjct: 295 PVVRDADNLSIAGIEKTIANFGRKARDGKLSIDEMQGGTFTITNGGIYGSLMSTPILNAP 354

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   E++ V +  +I+   +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 355 QSGILGMHRIEERPVVRGGKIEARPMMYLALSYDHRIVDGKEAVTFLVRVKEALEDPARL 414

Query: 422 LM 423
           ++
Sbjct: 415 VL 416


>gi|294851165|ref|ZP_06791838.1| dihydrolipoyllysine-residue succinyltransferase [Brucella sp. NVSL
           07-0026]
 gi|294819754|gb|EFG36753.1| dihydrolipoyllysine-residue succinyltransferase [Brucella sp. NVSL
           07-0026]
          Length = 408

 Score =  308 bits (787), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 103/422 (24%), Positives = 186/422 (44%), Gaps = 16/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ I+  + L E+ETDK  +E  +   G++ EI 
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKAGEAIAVDEPLVELETDKVTVEVPAPAAGVLAEIT 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + +  I  D   +  +P   KE         + +         +     
Sbjct: 61  AKEG-DTVEVGALLGQISSDGAAVAAAPAQKKEEAKPAAAAPAAAPVASASSGPAMQ--- 116

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +P A +   E G+    + GSG  G+++K D+   I+   +    +             
Sbjct: 117 PAPAAAKHLAESGLSADQVEGSGKRGQVLKGDVLDAITKGVSAAPAAP---------VAA 167

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
               +       E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 168 RPASSADDASREERVKMTRLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMELRNKYKDVF 227

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++      + +AV    G+V 
Sbjct: 228 EKK---HGVKLGFMGFFTKAVTHALKEIPAVNAEIDGTDIVYKNFCHVGMAVGTDKGLVV 284

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI ++  E+ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 285 PVIRDADQMSIAEVEKELARLARAARDGSLSMADMQGGTFTITNGGVYGSLMSTPILNAP 344

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +    +I V  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 345 QSGILGMHKIQERPMVVGGQIVVRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 404

Query: 422 LM 423
           ++
Sbjct: 405 VL 406


>gi|306843374|ref|ZP_07475975.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Brucella sp. BO1]
 gi|306276065|gb|EFM57765.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Brucella sp. BO1]
          Length = 408

 Score =  308 bits (787), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 104/422 (24%), Positives = 187/422 (44%), Gaps = 16/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ I+  + L E+ETDK  +E  +   G++ EI 
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKAGEAIAVDEPLVELETDKVTVEVPAPAAGVLAEIT 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + +  I  D   +  +P   KE         + +         +     
Sbjct: 61  AKEG-DTVEVGALLGQISSDGAAVAAAPAQKKEEAKPAAAAPAAAPVASASSGPAMQ--- 116

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +P A +L  E G+    + GSG  G+++K D+   I+   +    +             
Sbjct: 117 PAPAAAKLLAESGLSADQVDGSGKRGQVLKGDVLDAITKGVSAAPAAP---------VAA 167

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
               +       E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 168 RPASSADDASREERVKMTRLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMELRNKYKDIF 227

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++      + +AV    G+V 
Sbjct: 228 EKK---HGVKLGFMGFFTKAVTHALKEIPAVNAEIDGTDIVYKNFCHVGMAVGTDKGLVV 284

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI ++  E+ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 285 PVIRDADQMSIAEVEKELARLARAARDGSLSMADMQGGTFTITNGGVYGSLMSTPILNAP 344

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +    +I V  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 345 QSGILGMHKIQERPMVVGGQIVVRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 404

Query: 422 LM 423
           ++
Sbjct: 405 VL 406


>gi|154253579|ref|YP_001414403.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Parvibaculum lavamentivorans DS-1]
 gi|154157529|gb|ABS64746.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Parvibaculum lavamentivorans DS-1]
          Length = 430

 Score =  308 bits (787), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 172/435 (39%), Positives = 253/435 (58%), Gaps = 18/435 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW  +EGD++  GD++ EIETDKA ME E+VDEG I ++L
Sbjct: 1   MPTNILMPALSPTMEEGTLAKWHVKEGDEVKSGDVIAEIETDKATMEVEAVDEGRIGKLL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  GTE +AVN PI  +L +  E             E +      +  V + + S     
Sbjct: 61  VAEGTEGVAVNKPIAILLEEGEEAADIDNAPPPKKDEPKTSAKPEAKEVEKPRSSATPSS 120

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN-------------VKDYS 168
                   A   G  + +   +         D+  +  +  N                  
Sbjct: 121 DGNARPTQATGTGHRVFASPLARRIAEQQGIDLSAISGSGPNGRIVKADLEGAAKAAPKK 180

Query: 169 TIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNID 228
                     +   +    +A+ ++E +  D +R+TIA RL QS Q IPHFY++IDC +D
Sbjct: 181 QAAGAVAQGAAQSIDPRAYYAEGTFEEVSLDGMRRTIARRLTQSMQEIPHFYLTIDCELD 240

Query: 229 NLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHID 288
            LL  R+++N            K+SVND +++A ALA+I+VP+ANVS+  NA+++HK  D
Sbjct: 241 ELLKARKKLNDEA-----GEGVKLSVNDFLIRAAALALIKVPDANVSFAGNALLKHKSAD 295

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           I +AV++ GG++TPIIR AD+K + +IS E K+LA+RA+ +KLKP EY+GG+ SISN+GM
Sbjct: 296 IGIAVALEGGLITPIIRNADKKGLAEISNEAKELAERARNKKLKPNEYEGGSFSISNLGM 355

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLL 408
            GI  F AVINPPQ+ ILA+G GE++ V +N +++VATIM  T+S DHR++DGA+ ++ L
Sbjct: 356 FGIKHFTAVINPPQAAILAVGKGEERPVVRNGKVEVATIMTVTMSCDHRAIDGALGARFL 415

Query: 409 AKFKEYIENPVWMLM 423
             F+ ++E P  ML+
Sbjct: 416 EAFRSFVEYPARMLL 430


>gi|256370324|ref|YP_003107835.1| dihydrolipoamide acetyltransferase [Brucella microti CCM 4915]
 gi|256000487|gb|ACU48886.1| dihydrolipoamide acetyltransferase [Brucella microti CCM 4915]
          Length = 408

 Score =  308 bits (787), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 104/422 (24%), Positives = 187/422 (44%), Gaps = 16/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ I+  + L E+ETDK  +E  +   G++ EI 
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKAGEAIAVDEPLVELETDKVTVEVPAPAAGVLAEIT 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + +  I  D   +  +P   KE         + +         +     
Sbjct: 61  AKEG-DTVEVGALLGQISSDGAAVAAAPAQKKEEAKPAAAAPAAAPVASASSGPAMQ--- 116

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +P A +L  E G+    + GSG  G+++K D+   I+   +    +             
Sbjct: 117 PAPAAAKLLAESGLSADQVKGSGKRGQVLKGDVLDAITKGVSAAPAAP---------VAA 167

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
               +       E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 168 RPASSADDASREERVKMTRLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMELRNKYKDVF 227

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++      + +AV    G+V 
Sbjct: 228 EKK---HGVKLGFMGFFTKAVTHALKEIPAVNAEIDGTDIVYKNFCHVGMAVGTDKGLVV 284

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI ++  E+ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 285 PVIRDADQMSIAEVEKELARLARAARDGSLSMADMQGGTFTITNGGVYGSLMSTPILNAP 344

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +    +I V  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 345 QSGILGMHKIQERPMVVGGQIVVRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 404

Query: 422 LM 423
           ++
Sbjct: 405 VL 406


>gi|256059899|ref|ZP_05450085.1| dihydrolipoamide succinyltransferase [Brucella neotomae 5K33]
 gi|261323869|ref|ZP_05963066.1| dihydrolipoamide succinyltransferase [Brucella neotomae 5K33]
 gi|261299849|gb|EEY03346.1| dihydrolipoamide succinyltransferase [Brucella neotomae 5K33]
          Length = 408

 Score =  307 bits (786), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 103/422 (24%), Positives = 186/422 (44%), Gaps = 16/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ I+  + L E+ETDK  +E  +   G++ EI 
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKAGEAIAVDEPLVELETDKVTVEVPAPAAGVLAEIT 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + +  I  D   +  +P   KE         + +         +     
Sbjct: 61  AKEG-DTVEVGALLGQISSDGAAVAAAPAQKKEEAKPAAAAPAAAPVASASSGPAMQ--- 116

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +P A +L  E G+    + GSG  G+++K D+   I+   +    +             
Sbjct: 117 PAPAAAKLLAESGLSADQVEGSGKRGQVLKGDVLDAITKGVSAAPAAP---------VAA 167

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
               +       E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 168 RPASSADDASREERVKMTRLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMELRNKYKDVF 227

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++   N       ++      + +AV    G+V 
Sbjct: 228 EKK---HGVKLGFMGFFTKAVTHALKEISAVNAEIDGTDIVYKNFCHVGMAVGTDKGLVV 284

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI ++  E+ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 285 PVIRDADQMSIAEVEKELARLARAARDDSLSMADMQGGTFTITNGGVYGSLMSTPILNAP 344

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +    +I V  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 345 QSGILGMHKIQERPMVVGGQIVVRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 404

Query: 422 LM 423
           ++
Sbjct: 405 VL 406


>gi|39933265|ref|NP_945541.1| dihydrolipoamide succinyltransferase [Rhodopseudomonas palustris
           CGA009]
 gi|192288616|ref|YP_001989221.1| dihydrolipoamide succinyltransferase [Rhodopseudomonas palustris
           TIE-1]
 gi|39652890|emb|CAE25632.1| dihydrolipoamide succinyl transferase [Rhodopseudomonas palustris
           CGA009]
 gi|192282365|gb|ACE98745.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Rhodopseudomonas palustris TIE-1]
          Length = 417

 Score =  307 bits (786), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 98/421 (23%), Positives = 181/421 (42%), Gaps = 6/421 (1%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I +P+L  ++TE  + +W K+ G+ ++  + L E+ETDK  +E  +   G + EI+ 
Sbjct: 1   MTEIRVPTLGESVTEATIGRWFKKPGEAVAVDEPLVELETDKVTIEVPAPSAGTLGEIVA 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G E +AV + +  I   +    P+     +           +               A
Sbjct: 61  KDG-ETVAVGALLGQITDGAAPAKPAAAAPAKAAAPAAAPAPAAPAPAAAPAAKAPPSDA 119

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
                         + + +  G       +  + L + +      + +       +    
Sbjct: 120 PLAPSVRRLSTESGVDASTVPGSGKDGRVTKGDMLAAIEKAASAPTPVNQPAAAVQVRGP 179

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
           +  +  A++  E +    +R+TIA RL++ + T        + ++ N+++LR Q     +
Sbjct: 180 SPADDAARE--ERVKMTRLRQTIARRLKEVQNTAAMLTTFNEVDMTNVMALRAQYKDVFE 237

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                   K+       KA   A+  +P  N       +I   +  I VAV    G+V P
Sbjct: 238 KK---HGAKLGFMGFFTKACVQALKDIPAVNAEMDGTDLIYKNYYHIGVAVGTDKGLVVP 294

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R  D+KSI DI   +    +RA+  +LK EE QGGT +I+N G+ G      ++N PQ
Sbjct: 295 VVRDCDEKSIADIEKSIVDYGKRARDGQLKIEEMQGGTFTITNGGIYGSLMSTPILNAPQ 354

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL +   +++ V    +I+V  +M   LS DHR +DG  A   L + KE +E+P  ++
Sbjct: 355 SGILGMHKIQERPVVIGGKIEVRPMMYLALSYDHRVIDGKEAVTFLVRVKESLEDPARLV 414

Query: 423 M 423
           +
Sbjct: 415 L 415


>gi|23502772|ref|NP_698899.1| dihydrolipoamide succinyltransferase [Brucella suis 1330]
 gi|148559863|ref|YP_001259746.1| dihydrolipoamide succinyltransferase [Brucella ovis ATCC 25840]
 gi|163843945|ref|YP_001628349.1| dihydrolipoamide acetyltransferase [Brucella suis ATCC 23445]
 gi|254707550|ref|ZP_05169378.1| dihydrolipoamide succinyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|254708913|ref|ZP_05170724.1| dihydrolipoamide succinyltransferase [Brucella pinnipedialis B2/94]
 gi|254713660|ref|ZP_05175471.1| dihydrolipoamide succinyltransferase [Brucella ceti M644/93/1]
 gi|254715986|ref|ZP_05177797.1| dihydrolipoamide succinyltransferase [Brucella ceti M13/05/1]
 gi|256030439|ref|ZP_05444053.1| dihydrolipoamide succinyltransferase [Brucella pinnipedialis
           M292/94/1]
 gi|256158423|ref|ZP_05456321.1| dihydrolipoamide succinyltransferase [Brucella ceti M490/95/1]
 gi|256253843|ref|ZP_05459379.1| dihydrolipoamide succinyltransferase [Brucella ceti B1/94]
 gi|261217751|ref|ZP_05932032.1| dihydrolipoamide succinyltransferase [Brucella ceti M13/05/1]
 gi|261220979|ref|ZP_05935260.1| dihydrolipoamide succinyltransferase [Brucella ceti B1/94]
 gi|261315034|ref|ZP_05954231.1| dihydrolipoamide succinyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|261316409|ref|ZP_05955606.1| dihydrolipoamide succinyltransferase [Brucella pinnipedialis B2/94]
 gi|261321401|ref|ZP_05960598.1| dihydrolipoamide succinyltransferase [Brucella ceti M644/93/1]
 gi|265987481|ref|ZP_06100038.1| dihydrolipoamide succinyltransferase [Brucella pinnipedialis
           M292/94/1]
 gi|265996938|ref|ZP_06109495.1| dihydrolipoamide succinyltransferase [Brucella ceti M490/95/1]
 gi|23348792|gb|AAN30814.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Brucella suis 1330]
 gi|148371120|gb|ABQ61099.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Brucella ovis ATCC 25840]
 gi|163674668|gb|ABY38779.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Brucella suis ATCC 23445]
 gi|260919563|gb|EEX86216.1| dihydrolipoamide succinyltransferase [Brucella ceti B1/94]
 gi|260922840|gb|EEX89408.1| dihydrolipoamide succinyltransferase [Brucella ceti M13/05/1]
 gi|261294091|gb|EEX97587.1| dihydrolipoamide succinyltransferase [Brucella ceti M644/93/1]
 gi|261295632|gb|EEX99128.1| dihydrolipoamide succinyltransferase [Brucella pinnipedialis B2/94]
 gi|261304060|gb|EEY07557.1| dihydrolipoamide succinyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|262551406|gb|EEZ07396.1| dihydrolipoamide succinyltransferase [Brucella ceti M490/95/1]
 gi|264659678|gb|EEZ29939.1| dihydrolipoamide succinyltransferase [Brucella pinnipedialis
           M292/94/1]
          Length = 408

 Score =  307 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 104/422 (24%), Positives = 187/422 (44%), Gaps = 16/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ I+  + L E+ETDK  +E  +   G++ EI 
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKAGEAIAVDEPLVELETDKVTVEVPAPAAGVLAEIT 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + +  I  D   +  +P   KE         + +         +     
Sbjct: 61  AKEG-DTVEVGALLGQISSDGAAVAAAPAQKKEEAKPAAAAPAAAPVASASSGPAMQ--- 116

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +P A +L  E G+    + GSG  G+++K D+   I+   +    +             
Sbjct: 117 PAPAAAKLLAESGLSADQVEGSGKRGQVLKGDVLDAITKGVSAAPAAP---------VAA 167

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
               +       E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 168 RPASSADDASREERVKMTRLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMELRNKYKDVF 227

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++      + +AV    G+V 
Sbjct: 228 EKK---HGVKLGFMGFFTKAVTHALKEIPAVNAEIDGTDIVYKNFCHVGMAVGTDKGLVV 284

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI ++  E+ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 285 PVIRDADQMSIAEVEKELARLARAARDGSLSMADMQGGTFTITNGGVYGSLMSTPILNAP 344

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +    +I V  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 345 QSGILGMHKIQERPMVVGGQIVVRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 404

Query: 422 LM 423
           ++
Sbjct: 405 VL 406


>gi|161619840|ref|YP_001593727.1| dihydrolipoamide acetyltransferase [Brucella canis ATCC 23365]
 gi|254704936|ref|ZP_05166764.1| dihydrolipoamide succinyltransferase [Brucella suis bv. 3 str. 686]
 gi|260567588|ref|ZP_05838058.1| dihydrolipoamide acetyltransferase [Brucella suis bv. 4 str. 40]
 gi|261755633|ref|ZP_05999342.1| dihydrolipoamide succinyltransferase [Brucella suis bv. 3 str. 686]
 gi|161336651|gb|ABX62956.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Brucella canis ATCC 23365]
 gi|260157106|gb|EEW92186.1| dihydrolipoamide acetyltransferase [Brucella suis bv. 4 str. 40]
 gi|261745386|gb|EEY33312.1| dihydrolipoamide succinyltransferase [Brucella suis bv. 3 str. 686]
          Length = 408

 Score =  307 bits (785), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 104/422 (24%), Positives = 187/422 (44%), Gaps = 16/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ I+  + L E+ETDK  +E  +   G++ EI 
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKAGEAIAVDEPLVELETDKVTVEVPAPAAGVLAEIT 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + +  I  D   +  +P   KE         + +         +     
Sbjct: 61  AKEG-DTVEVGALLGQISGDGAAVAAAPAQKKEEAKPAAAAPAAAPVASASSGPAMQ--- 116

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +P A +L  E G+    + GSG  G+++K D+   I+   +    +             
Sbjct: 117 PAPAAAKLLAESGLSADQVEGSGKRGQVLKGDVLDAITKGVSAAPAAP---------VAA 167

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
               +       E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 168 RPASSADDASREERVKMTRLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMELRNKYKDVF 227

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++      + +AV    G+V 
Sbjct: 228 EKK---HGVKLGFMGFFTKAVTHALKEIPAVNAEIDGTDIVYKNFCHVGMAVGTDKGLVV 284

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI ++  E+ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 285 PVIRDADQMSIAEVEKELARLARAARDGSLSMADMQGGTFTITNGGVYGSLMSTPILNAP 344

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +    +I V  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 345 QSGILGMHKIQERPMVVGGQIVVRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 404

Query: 422 LM 423
           ++
Sbjct: 405 VL 406


>gi|332559437|ref|ZP_08413759.1| dihydrolipoamide acetyltransferase [Rhodobacter sphaeroides WS8N]
 gi|332277149|gb|EGJ22464.1| dihydrolipoamide acetyltransferase [Rhodobacter sphaeroides WS8N]
          Length = 407

 Score =  307 bits (785), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 106/423 (25%), Positives = 185/423 (43%), Gaps = 18/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           MM   + +P+L  +++E  +A W K+ GD+++  ++LCE+ETDK  +E  +   G++ EI
Sbjct: 1   MMGTEVRVPTLGESVSEATVATWFKKPGDRVAADEMLCELETDKVSVEVPAPAAGVLAEI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           LV  GT  +A  S +  I  D   +  +P        E       +    V +  S  + 
Sbjct: 61  LVTEGT-TVAAGSKLALISSDGQGVAAAPKAETPKKTEAAPAQEPAPKKDVEDAPSARKA 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           +A       A +              G      I      +                 ++
Sbjct: 120 MAEAGLSPDAVQ--------------GTGRDGRIMKDDVARAVAGASQAAAPAPAPQPAL 165

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
               +        E +    +R+TIA RL++++ T        + ++  ++ LR +    
Sbjct: 166 PRQPVPADDAAREERVKMTRLRQTIARRLKEAQNTAAMLTTYNEVDMSGVMGLRNEYKDA 225

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        K+      +KA   A+ +VPE N       ++   ++ + VAV  P G+V
Sbjct: 226 FEKK---HGTKMGFMSFFVKACCHALKEVPEVNAEIDGTDIVYKNYVHMGVAVGTPSGLV 282

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            P++R ADQ     I  ++ +L  RA+  KL   E QGG+ +ISN G+ G      ++NP
Sbjct: 283 VPVVRDADQMGFAQIEKKIAELGLRARDGKLSMAEMQGGSFTISNGGVYGSLMSSPILNP 342

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL +   +++ V +  +I +  +M   LS DHR VDG  A   L + KE +E+P  
Sbjct: 343 PQSGILGMHKIQERPVVEKGQIVIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRR 402

Query: 421 MLM 423
           +L+
Sbjct: 403 LLL 405


>gi|153008269|ref|YP_001369484.1| dihydrolipoamide succinyltransferase [Ochrobactrum anthropi ATCC
           49188]
 gi|151560157|gb|ABS13655.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Ochrobactrum anthropi ATCC 49188]
          Length = 409

 Score =  307 bits (785), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 100/422 (23%), Positives = 174/422 (41%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ GD I+  + L E+ETDK  +E  +   G++ EI 
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKVGDAIAIDEPLVELETDKVTVEVPAAAAGVLAEIT 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + VN+ +  I  D   +  +P   KE         +                 
Sbjct: 61  AKEG-DTVEVNALLGQISTDGAAVAAAPAAKKEEAKPAAAPAAAPVASASS--------- 110

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
               A + A      L+  + S           + L     +        +      +  
Sbjct: 111 --GPAMQPAPAASKLLAENNLSADQVDGSGKRGQVLKGDVLDAIAKGVSAAPAPAAPAAA 168

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
               +       E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 169 RPASSADDASREERVKMTRLRQTIAKRLKDAQNTAAMLTTYNEVDMSAVMELRTKYKDVF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       +I      + +AV    G+V 
Sbjct: 229 EKK---HGVKLGFMGFFTKAVTHALKEIPAVNAEIDGTDIIYKNFAHVGMAVGTDKGLVV 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI  +  E+ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 286 PVIRDADQLSIAGVEKELGRLAKAARDGTLSVADMQGGTFTITNGGVYGSLMSSPILNAP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ V    +I +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 346 QSGILGMHKIQERPVVVGGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 405

Query: 422 LM 423
           ++
Sbjct: 406 VL 407


>gi|62290776|ref|YP_222569.1| dihydrolipoamide succinyltransferase [Brucella abortus bv. 1 str.
           9-941]
 gi|82700688|ref|YP_415262.1| dihydrolipoamide succinyltransferase [Brucella melitensis biovar
           Abortus 2308]
 gi|189024991|ref|YP_001935759.1| dihydrolipoamide succinyltransferase [Brucella abortus S19]
 gi|237816284|ref|ZP_04595277.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Brucella abortus str. 2308 A]
 gi|254690066|ref|ZP_05153320.1| dihydrolipoamide succinyltransferase [Brucella abortus bv. 6 str.
           870]
 gi|254694554|ref|ZP_05156382.1| dihydrolipoamide succinyltransferase [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696179|ref|ZP_05158007.1| dihydrolipoamide succinyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731097|ref|ZP_05189675.1| dihydrolipoamide succinyltransferase [Brucella abortus bv. 4 str.
           292]
 gi|256258319|ref|ZP_05463855.1| dihydrolipoamide succinyltransferase [Brucella abortus bv. 9 str.
           C68]
 gi|260546043|ref|ZP_05821783.1| dihydrolipoamide acetyltransferase [Brucella abortus NCTC 8038]
 gi|260755602|ref|ZP_05867950.1| dihydrolipoamide succinyltransferase [Brucella abortus bv. 6 str.
           870]
 gi|260758827|ref|ZP_05871175.1| dihydrolipoamide succinyltransferase [Brucella abortus bv. 4 str.
           292]
 gi|260760551|ref|ZP_05872894.1| dihydrolipoamide succinyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884628|ref|ZP_05896242.1| dihydrolipoamide succinyltransferase [Brucella abortus bv. 9 str.
           C68]
 gi|261214875|ref|ZP_05929156.1| dihydrolipoamide succinyltransferase [Brucella abortus bv. 3 str.
           Tulya]
 gi|297247164|ref|ZP_06930882.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Brucella abortus bv. 5 str. B3196]
 gi|62196908|gb|AAX75208.1| SucB, 2-oxoglutarate dehydrogenase, E2 dihydrolipoamide
           succinyltransferase [Brucella abortus bv. 1 str. 9-941]
 gi|82616789|emb|CAJ11878.1| Biotin/lipoyl attachment:Antifreeze protein, type I:Catalytic
           domain of components of various dehydrogenase
           complexes:Ribosom [Brucella melitensis biovar Abortus
           2308]
 gi|189020563|gb|ACD73285.1| dihydrolipoamide acetyltransferase [Brucella abortus S19]
 gi|237788351|gb|EEP62566.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Brucella abortus str. 2308 A]
 gi|260096150|gb|EEW80026.1| dihydrolipoamide acetyltransferase [Brucella abortus NCTC 8038]
 gi|260669145|gb|EEX56085.1| dihydrolipoamide succinyltransferase [Brucella abortus bv. 4 str.
           292]
 gi|260670983|gb|EEX57804.1| dihydrolipoamide succinyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675710|gb|EEX62531.1| dihydrolipoamide succinyltransferase [Brucella abortus bv. 6 str.
           870]
 gi|260874156|gb|EEX81225.1| dihydrolipoamide succinyltransferase [Brucella abortus bv. 9 str.
           C68]
 gi|260916482|gb|EEX83343.1| dihydrolipoamide succinyltransferase [Brucella abortus bv. 3 str.
           Tulya]
 gi|297174333|gb|EFH33680.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Brucella abortus bv. 5 str. B3196]
          Length = 408

 Score =  307 bits (785), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 94/422 (22%), Positives = 172/422 (40%), Gaps = 16/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ I+  + L E+ETDK  +E  +   G++ EI 
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKAGEAIAVDEPLVELETDKVTVEVPAPAAGVLAEIT 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + +  I  D   +  +P   KE         + +               
Sbjct: 61  AKEG-DTVEVGALLGQISSDGAAVAAAPAQKKEEAKPAAAAPAAAPVASA---------- 109

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                  +                  ++  S     +     ++  +   S         
Sbjct: 110 --SSGPAMQPAPAAAKLLAESGLSADQVEGSGKRGQVLKGDVLEAITKGVSAAPAAPVAA 167

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
               +       E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 168 RPASSADDASREERVKMTRLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMELRNKYKDVF 227

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++      + +AV    G+V 
Sbjct: 228 EKK---HGVKLGFMGFFTKAVTHALKEIPAVNAEIDGTDIVYKNFCHVGMAVGTDKGLVV 284

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI ++  E+ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 285 PVIRDADQMSIAEVEKELARLARAARDGSLSMADMQGGTFTITNGGVYGSLMSTPILNAP 344

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +    +I V  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 345 QSGILGMHKIQERPMVVGGQIVVRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 404

Query: 422 LM 423
           ++
Sbjct: 405 VL 406


>gi|91975025|ref|YP_567684.1| dihydrolipoamide succinyltransferase [Rhodopseudomonas palustris
           BisB5]
 gi|91681481|gb|ABE37783.1| 2-oxoglutarate dehydrogenase E2 component [Rhodopseudomonas
           palustris BisB5]
          Length = 433

 Score =  307 bits (785), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 99/435 (22%), Positives = 183/435 (42%), Gaps = 18/435 (4%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I +P+L  ++TE  + +W K++GD ++  + L E+ETDK  +E  +   G + EI+ 
Sbjct: 1   MTDIRVPTLGESVTEATIGRWFKKQGDAVAVDEPLVELETDKVTIEVPAPSAGTLGEIIA 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G E +AV + +  I        P+   + +    V  E +   P +  +         
Sbjct: 61  KDG-ETVAVGALLGQISEGGGAAKPAAKDTPKATAAVAPETTTGRPDLKTDTTKPINAGP 119

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
             +  +   +     +  + S              +         +       ++++  A
Sbjct: 120 EEVRPKPELKTPPSDAPQAPSVRRLSSESGVDAATVPGSGKDGRVTKGDMLAAIEKAASA 179

Query: 183 NIL--------------NLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNID 228
                                    E +    +R+TIA RL++ + T        + ++ 
Sbjct: 180 PTPVNQPAAAMQVRAPSPADDAAREERVKMTRLRQTIARRLKEVQNTAAMLTTFNEVDMT 239

Query: 229 NLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHID 288
           N+++LR Q     +        K+       KA   A+  +P AN       +I   +  
Sbjct: 240 NVMALRAQYKDVFEKK---HGAKLGFMGFFTKACVQALKDIPAANAEIDGTDLIYKNYYH 296

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           + VAV    G+V P++R  D+KSI DI   +    +RA+  +LK EE QGGT +I+N G+
Sbjct: 297 VGVAVGTDKGLVVPVVRDCDEKSIADIEKSIADFGKRARDGQLKIEEMQGGTFTITNGGI 356

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLL 408
            G      ++N PQS IL +   +++ V    +++V  +M   LS DHR +DG  A   L
Sbjct: 357 YGSLMSTPILNAPQSAILGMHKIQERPVAIGGKVEVRPMMYLALSYDHRVIDGKEAVTFL 416

Query: 409 AKFKEYIENPVWMLM 423
            + KE +E+P  +++
Sbjct: 417 VRVKESLEDPARLVL 431


>gi|144898633|emb|CAM75497.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 419

 Score =  307 bits (785), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 186/425 (43%), Positives = 274/425 (64%), Gaps = 9/425 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + MP+LSPTMTEG LA+W+K+EGD +  GD+L EIETDKA MEFE+VDEG++ +IL
Sbjct: 1   MPIELLMPALSPTMTEGTLARWLKKEGDAVKSGDVLAEIETDKATMEFEAVDEGVLGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEI---PPSPPLSKENIVEVREEHSHSSPVVVREKHSKN 118
           +  GT  +AVN+PI  +L +  +       P  +    V      + ++       H   
Sbjct: 61  IADGTSGVAVNTPIGVLLEEGEDASSIVAKPKAAAPAAVAPAAAAAPAAAAAPAPSHGGE 120

Query: 119 RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDE 178
           R  ASPLA+R+A + G+DL ++ GSGP+GR+VK+D+E  +         +T  +     +
Sbjct: 121 RVFASPLAKRIAADAGLDLKAVKGSGPYGRVVKADVEQALKGGVAAAPVATAAAPVAAAK 180

Query: 179 SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMN 238
           +  A  +    + ++E IP+ ++RK IA RL ++K TIPHFY+SIDC +D LL +R  +N
Sbjct: 181 AAPAPAVANPFEPAFEEIPNSSMRKVIARRLTEAKSTIPHFYLSIDCELDALLKVRSDLN 240

Query: 239 RTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGG 298
                +      K+SVND I++A ALA+ +VP AN SW   A+ R+  +D+SVAV+ P G
Sbjct: 241 GRSDAY------KLSVNDFIIRAVALALKKVPAANASWGEEAIKRYTDVDVSVAVATPNG 294

Query: 299 IVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVI 358
           ++TPI+  AD K +  IS E+K+LA +A+  KLKPEE+QGG  +ISN+GM G+  F A+I
Sbjct: 295 LITPIVHHADHKGLAAISNEMKELAAKARDGKLKPEEFQGGGFTISNLGMFGVKDFAAII 354

Query: 359 NPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENP 418
           NPPQ  ILA+GAGE++ V +   + +AT+M  TLS DHR VDGA+ ++ LA FK+ +E+P
Sbjct: 355 NPPQGCILAVGAGEQRPVVKAGALAIATVMTCTLSVDHRVVDGAVGAEFLAAFKKLVEDP 414

Query: 419 VWMLM 423
           + ML+
Sbjct: 415 LSMLL 419


>gi|241206652|ref|YP_002977748.1| dihydrolipoamide succinyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860542|gb|ACS58209.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 420

 Score =  306 bits (784), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 99/422 (23%), Positives = 179/422 (42%), Gaps = 4/422 (0%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  +  W K+ GD I   + + E+ETDK  +E  +   G + EI+
Sbjct: 1   MASEIRVPTLGESVSEATVGTWFKKVGDAIKADEPILELETDKVTIEVPAPASGTLSEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V AG E + + + +  I   +         +           + + P  V    S +   
Sbjct: 61  VAAG-ETVGLGALLGQIAEGAAAAAAPAAAAPAAAPAQPAPAAAAQPAPVAAAASSSSAS 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            S +    A    +  ++LS     G   +  +          K  S   +      +  
Sbjct: 120 VSTMPPAPAASKMLAENNLSADQVDGSGKRGQVLKGDVIAAVAKGISAPAAAPAATPAAA 179

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                +      E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 180 RGPSTVEDASREERVKMTRLRQTIAKRLKDAQNTAAMLTTYNEVDMKAVMDLRNKYKDIF 239

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       +I   +  + +AV    G+V 
Sbjct: 240 EKK---HGVKLGFMGFFTKAVTHALKELPAVNAEIDGTDVIYKNYCHVGMAVGTDKGLVV 296

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI +I  E+ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 297 PVIRDADQMSIAEIEKELGRLAKAARDGSLSMADMQGGTFTITNGGVYGSLMSSPILNAP 356

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ V    ++ +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 357 QSGILGMHKIQERPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 416

Query: 422 LM 423
           ++
Sbjct: 417 VL 418


>gi|254700566|ref|ZP_05162394.1| dihydrolipoamide succinyltransferase [Brucella suis bv. 5 str. 513]
 gi|261751071|ref|ZP_05994780.1| dihydrolipoamide succinyltransferase [Brucella suis bv. 5 str. 513]
 gi|261740824|gb|EEY28750.1| dihydrolipoamide succinyltransferase [Brucella suis bv. 5 str. 513]
          Length = 408

 Score =  306 bits (783), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 103/422 (24%), Positives = 187/422 (44%), Gaps = 16/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ I+  + L E+ETDK  +E  +   G++ EI 
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKAGEAIAVDEPLVELETDKVTVEVPAPAAGVLAEIT 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + +  I  +   +  +P   KE         + +         +     
Sbjct: 61  AKEG-DTVEVGALLGQISSNGAAVAAAPAQKKEEAKPAAAAPAAAPVASASSGPAMQ--- 116

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +P A +L  E G+    + GSG  G+++K D+   I+   +    +             
Sbjct: 117 PAPAAAKLLAESGLSADQVEGSGKRGQVLKGDVLDAITKGVSAAPAAP---------VAA 167

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
               +       E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 168 RPASSADDASREERVKMTRLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMELRNKYKDVF 227

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++      + +AV    G+V 
Sbjct: 228 EKK---HGVKLGFMGFFTKAVTHALKEIPAVNAEIDGTDIVYKNFCHVGMAVGTDKGLVV 284

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI ++  E+ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 285 PVIRDADQMSIAEVEKELARLARAARDGSLSMADMQGGTFTITNGGVYGSLMSTPILNAP 344

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +    +I V  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 345 QSGILGMHKIQERPMVVGGQIAVRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 404

Query: 422 LM 423
           ++
Sbjct: 405 VL 406


>gi|326405306|ref|YP_004285388.1| pyruvate dehydrogenase E2 component [Acidiphilium multivorum
           AIU301]
 gi|325052168|dbj|BAJ82506.1| pyruvate dehydrogenase E2 component [Acidiphilium multivorum
           AIU301]
          Length = 428

 Score =  306 bits (783), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 182/429 (42%), Positives = 254/429 (59%), Gaps = 8/429 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEG LA+W+K+EG+ I  GD++ EIETDKA ME E+VDEG++ +IL
Sbjct: 1   MATNILMPALSPTMTEGTLARWLKKEGETIKAGDVIAEIETDKATMEVEAVDEGVLGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V AG+EN+AVN+PI  ++     +P S P +         E   +         +     
Sbjct: 61  VAAGSENVAVNAPIAILVEPGEAVPDSAPAAPAPKPAAAPEPVAAPAPAAAAPAAPAAET 120

Query: 122 ASPLARRLAGEHGIDLSSLS-------GSGPHGRIVKSDIETLISTKTNVKDYSTIQSFG 174
                R  A      ++  +               +                    ++  
Sbjct: 121 TGHGPRVFASPLARRMAQQAGIDLATLKGSGPNGRIVKADIDAARGSAPEAAAPAPKAPA 180

Query: 175 LVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLR 234
               +  A          ++ IPH ++RK IA RLQ +KQTIPHFY+S+D  +D LL LR
Sbjct: 181 AAPPAQAAAAPAAPITAPHDAIPHSSMRKVIAKRLQAAKQTIPHFYLSMDVELDALLKLR 240

Query: 235 EQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVS 294
            ++N          + K+SVND+I+KA A+A+ +VP AN S+T  AMIR+  +DISVAV+
Sbjct: 241 AELNAQSPKEGP-GAFKLSVNDLIIKAVAVALRRVPAANASFTEEAMIRYHDVDISVAVA 299

Query: 295 IPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSF 354
           IP G++TPIIR+ADQK +  IS E+K LA RAK  KLKP+E+QGG+ SISN+GM GI+SF
Sbjct: 300 IPDGLITPIIRKADQKGLAAISNEMKDLAARAKAGKLKPDEFQGGSFSISNLGMYGISSF 359

Query: 355 CAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEY 414
            A+INPPQ  ILAIGAGEK+ V + E+I +AT+M  TLS DHR VDGA+ ++ LA FK  
Sbjct: 360 SAIINPPQGGILAIGAGEKRPVVKGEQIAIATVMTVTLSCDHRVVDGAVGAEFLAAFKSI 419

Query: 415 IENPVWMLM 423
           +E P+ +++
Sbjct: 420 VEQPLGLML 428


>gi|225628122|ref|ZP_03786157.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Brucella ceti str. Cudo]
 gi|225616947|gb|EEH13994.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Brucella ceti str. Cudo]
          Length = 408

 Score =  306 bits (783), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 104/422 (24%), Positives = 187/422 (44%), Gaps = 16/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ I+  + L E+ETDK  +E  +   G++ EI 
Sbjct: 1   MATEIRVPTLGESVTEVTIGKWFKKAGEAIAVDEPLVELETDKVTVEVPAPAAGVLAEIT 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + +  I  D   +  +P   KE         + +         +     
Sbjct: 61  AKEG-DTVEVGALLGQISSDGAAVAAAPAQKKEEAKPAAAAPAAAPVASASSGPAMQ--- 116

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +P A +L  E G+    + GSG  G+++K D+   I+   +    +             
Sbjct: 117 PAPAAAKLLAESGLSADQVEGSGKRGQVLKGDVLDAITKGVSAAPAAP---------VAA 167

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
               +       E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 168 RPASSADDASREERVKMTRLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMELRNKYKDVF 227

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++      + +AV    G+V 
Sbjct: 228 EKK---HGVKLGFMGFFTKAVTHALKEIPAVNAEIDGTDIVYKNFCHVGMAVGTDKGLVV 284

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI ++  E+ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 285 PVIRDADQMSIAEVEKELARLARAARDGSLSMADMQGGTFTITNGGVYGSLMSTPILNAP 344

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +    +I V  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 345 QSGILGMHKIQERPMVVGGQIVVRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 404

Query: 422 LM 423
           ++
Sbjct: 405 VL 406


>gi|17986425|ref|NP_539059.1| dihydrolipoamide succinyltransferase [Brucella melitensis bv. 1
           str. 16M]
 gi|225853360|ref|YP_002733593.1| dihydrolipoamide succinyltransferase [Brucella melitensis ATCC
           23457]
 gi|256045529|ref|ZP_05448412.1| dihydrolipoamide succinyltransferase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256263155|ref|ZP_05465687.1| dihydrolipoamide succinyltransferase [Brucella melitensis bv. 2
           str. 63/9]
 gi|260562839|ref|ZP_05833325.1| dihydrolipoamide succinyltransferase [Brucella melitensis bv. 1
           str. 16M]
 gi|265991953|ref|ZP_06104510.1| dihydrolipoamide succinyltransferase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|7248874|gb|AAF43701.1|AF235020_2 dihydrolipoamide succinyltransferase [Brucella melitensis]
 gi|17982020|gb|AAL51323.1| dihydrolipoamide succinyltransferase component (e2) of
           2-oxoglutarate dehydrogenase complex [Brucella
           melitensis bv. 1 str. 16M]
 gi|225641725|gb|ACO01639.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Brucella melitensis ATCC 23457]
 gi|260152855|gb|EEW87947.1| dihydrolipoamide succinyltransferase [Brucella melitensis bv. 1
           str. 16M]
 gi|263003019|gb|EEZ15312.1| dihydrolipoamide succinyltransferase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|263093060|gb|EEZ17210.1| dihydrolipoamide succinyltransferase [Brucella melitensis bv. 2
           str. 63/9]
 gi|326409924|gb|ADZ66989.1| dihydrolipoamide succinyltransferase [Brucella melitensis M28]
 gi|326539638|gb|ADZ87853.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Brucella melitensis M5-90]
          Length = 408

 Score =  306 bits (783), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 94/422 (22%), Positives = 171/422 (40%), Gaps = 16/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ I+  + L E+ETDK  +E  +   G++ EI 
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKAGEAIAVDEPLVELETDKVTVEVPAPAAGVLAEIT 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V   +  I  D   +  +P   KE         + +               
Sbjct: 61  AKEG-DTVEVGELLGQISSDGAAVAAAPAQKKEEAKPAAAAPAAAPVASA---------- 109

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                  +                  ++  S     +     ++  +   S         
Sbjct: 110 --SSGPAMQPAPAAAKLLAESGLSADQVEGSGKRGQVLKGDVLEAITKGVSAAPAAPVAA 167

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
               +       E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 168 RPASSADDASREERVKMTRLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMELRNKYKDVF 227

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++      + +AV    G+V 
Sbjct: 228 EKK---HGVKLGFMGFFTKAVTHALKEIPAVNAEIDGTDIVYKNFCHVGMAVGTDKGLVV 284

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI ++  E+ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 285 PVIRDADQMSIAEVEKELARLARAARDGSLSMADMQGGTFTITNGGVYGSLMSTPILNAP 344

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +    +I V  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 345 QSGILGMHKIQERPMVVGGQIVVRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 404

Query: 422 LM 423
           ++
Sbjct: 405 VL 406


>gi|115522324|ref|YP_779235.1| dihydrolipoamide succinyltransferase [Rhodopseudomonas palustris
           BisA53]
 gi|115516271|gb|ABJ04255.1| 2-oxoglutarate dehydrogenase E2 component [Rhodopseudomonas
           palustris BisA53]
          Length = 435

 Score =  306 bits (783), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 98/437 (22%), Positives = 177/437 (40%), Gaps = 20/437 (4%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I +P+L  ++TE  + +W K+ GD ++  + L E+ETDK  +E  +   G + EI+ 
Sbjct: 1   MTEIRVPTLGESVTEATIGRWFKKPGDAVAVDEPLVELETDKVTIEVPAPSAGTLGEIVA 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G E ++V + +  I   +   P +   SK   V                K     P  
Sbjct: 61  KDG-ETVSVGALLGQISDGAAAKPAAKEASKAATVAPEVTTGRPDLKTDSTKPINAGPEE 119

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
                    +     +    +    R+         +   + KD    +   L      A
Sbjct: 120 MRPRAETKPDTKTPPADAPLAPSVRRLSAETGVDAATVPGSGKDGRVTKGDMLAAIEKAA 179

Query: 183 NILNLFAKD----------------SYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCN 226
           +     +                    E +    +R+TIA RL+  + T        + +
Sbjct: 180 SAPTPVSAPAAAVQVRAPSPADDAAREERVKMTRLRQTIARRLKDVQNTAAMLTTFNEVD 239

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKH 286
           + ++++LR Q     +       +K+      ++A    +  +P  N       +I   +
Sbjct: 240 MSHIMALRAQYKDVFEKR---HGSKLGFMGFFVRACVQGLRDIPAVNAEIDGTDLIYKNY 296

Query: 287 IDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNM 346
             I VAV    G+V P++R  D KSI  I   +    +RA+  +LK +E QGGT +I+N 
Sbjct: 297 YHIGVAVGTDKGLVVPVVRDCDHKSIAQIEKGIADFGRRARDGQLKIDEMQGGTFTITNG 356

Query: 347 GMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASK 406
           G+ G      ++N PQS IL +   + + V    +I++  +M   LS DHR +DG  A  
Sbjct: 357 GIYGSLMSTPILNAPQSGILGMHKIQDRPVVVGGKIEIRPMMYLALSYDHRVIDGKEAVS 416

Query: 407 LLAKFKEYIENPVWMLM 423
            L + KE +E+P  +++
Sbjct: 417 FLVRVKESLEDPARLVL 433


>gi|220921136|ref|YP_002496437.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Methylobacterium nodulans ORS 2060]
 gi|219945742|gb|ACL56134.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Methylobacterium nodulans ORS 2060]
          Length = 420

 Score =  306 bits (782), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 93/422 (22%), Positives = 165/422 (39%), Gaps = 4/422 (0%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++ E  + +W K+ GD +   + L E+ETDK  +E  +   G + +I+
Sbjct: 1   MATEIRVPTLGESVNEATIGRWFKKPGDIVKADEPLVELETDKVTLEVNAPAAGKLGDIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +   + + +I+                     +  + +S              
Sbjct: 61  AKDG-ETVEPGALLGSIVEGGAAAGNGSAEPAAKPAAAPDAPAQTSSASYGSHGEAAPAG 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A P          +   +           K    T                       I 
Sbjct: 120 ARPSRDHGPAVARLAQETGVDPATLQGSGKDGRVTKGDILAAASGAPAPAPAPAPLPQIA 179

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                       E +    +R+TIA RL+ ++          D ++  +++LR+Q     
Sbjct: 180 RAPSAPADAAREERVRMTKLRQTIARRLKDAQNIAAMLTTFNDVDMSAVMALRQQYKDVF 239

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+  VP  N       ++   +  + +AV    G+V 
Sbjct: 240 EKK---HGTKLGFMGFFTKAVIQALKDVPAVNAEIDGQDIVYKNYYHVGIAVGTDKGLVV 296

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD  SI  I   +    ++A++ KL  +E QGGT +I+N G+ G      ++N P
Sbjct: 297 PVVRDADMLSIAGIEKTIANFGRKAREGKLSIDEMQGGTFTITNGGIYGSLMSTPILNAP 356

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   E++ V +N +I+   +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 357 QSGILGMHRIEERPVVRNGKIEARPMMYLALSYDHRIVDGKEAVTFLVRVKEALEDPARL 416

Query: 422 LM 423
           ++
Sbjct: 417 VL 418


>gi|294085402|ref|YP_003552162.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664977|gb|ADE40078.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 417

 Score =  306 bits (782), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 93/422 (22%), Positives = 187/422 (44%), Gaps = 7/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++++  +A+WIK+ GD ++  + + E+ETDK  +E  S   G + E++
Sbjct: 1   MATDIIVPTLGESVSDATIARWIKKAGDTVAADEPVVELETDKVTLEVPSPVAGKLSELV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  G + + V + +  +         +     E     + +   +    +          
Sbjct: 61  VAEG-DTVEVGAVLARVEAGKGA--RAAADKAEPAKAEQAKAPEAKAEAIPADKVPTASK 117

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A       A    ++ ++L+ +   G  V   +             +      +  ++  
Sbjct: 118 ADAHPLSPAVRRLVEENNLNPASIVGTGVDGRLTKADVLAAMKAPTAPTAPAQVASQTPR 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                + A    E +P   +R+ IA RL++++          + ++  L++LR       
Sbjct: 178 QTPREIDAARE-ERVPMSKLRRVIAGRLKEAQNNAAMLTTFNEVDMTELMALRASYRTEF 236

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++    + ++A  +A+ + P  N     N +I   + +I VAV  P G+V 
Sbjct: 237 E---NTHQVRLGFMGMFVQASVMALREFPAVNAEIDGNDIIYKNYYNIGVAVGTPQGLVV 293

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+I+ A+  ++ ++   +     RA+  K+ P++  GGT +ISN G+ G      ++NPP
Sbjct: 294 PVIKGAEAMNLAEVERTIGDFGMRARDGKIAPDDMAGGTFTISNGGVYGSLMSTPILNPP 353

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   EK+ V  ++ I +  +M   LS DHR +DG  A   LA+ K+ +E+P  +
Sbjct: 354 QSGILGMHKIEKRAVVVDDAIVIRPMMYLALSYDHRIIDGREAVSFLARVKDLVEDPRRL 413

Query: 422 LM 423
           L+
Sbjct: 414 LI 415


>gi|163792310|ref|ZP_02186287.1| Dihydrolipoamide succinyltransferase [alpha proteobacterium BAL199]
 gi|159182015|gb|EDP66524.1| Dihydrolipoamide succinyltransferase [alpha proteobacterium BAL199]
          Length = 429

 Score =  305 bits (781), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 100/431 (23%), Positives = 179/431 (41%), Gaps = 13/431 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   IT+P+L  +++E  +AKW+K  GD +   + L E+ETDK  +E  +   G++ EI 
Sbjct: 1   MATQITVPALGESVSEATVAKWMKAVGDAVKADEPLVELETDKVTLEVNAPASGVLTEIA 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +AV + +  I   +T   P+               +  + V    K +     
Sbjct: 61  AKDGAE-VAVGALLGTIDETATASAPAKKPEVPKEAAKPAPEAKKADVPAAPKPAAAPVA 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDI---------ETLISTKTNVKDYSTIQS 172
           A+             +  L                       +   + +      +   +
Sbjct: 120 AAASGSYDVKTLSPAVRKLVEDNDLDPAKIKPTGKDGRLVKEDVQKAVEAGNAKRTYSAA 179

Query: 173 FGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232
                      +         E +    +R+ IA RL++++ T        + ++  +++
Sbjct: 180 PAAGSAPAAGPLPPRPDDPREERVKMTRLRQAIARRLKEAQNTAAMLTTFNEVDMTAVMA 239

Query: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVA 292
           LR +   + +        K+      +K    A+ ++P  N     + ++   + DI VA
Sbjct: 240 LRNEYKDSFEKK---HGVKLGFMSFFVKGALAALKELPAVNTEIYGDEIVYKNYFDIGVA 296

Query: 293 VSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGIN 352
           V  P G+V PI+R ADQ S   +   +  L  +A+  KL   E QGGT +ISN G+ G  
Sbjct: 297 VGTPQGLVVPILRDADQLSFAGVEKAINALGLKARDGKLSLAEMQGGTFTISNGGVYGSL 356

Query: 353 SFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFK 412
               ++NPPQS IL +   + + +   ++++V  +M   LS DHR VDG  A   L + K
Sbjct: 357 MSTPILNPPQSGILGMHKIQPRPMAIGDKVEVRPMMYLALSYDHRIVDGREAVTFLVRLK 416

Query: 413 EYIENPVWMLM 423
           + IE+P  +L+
Sbjct: 417 DAIEDPRRLLL 427


>gi|148827082|ref|YP_001291835.1| ribonucleotide-diphosphate reductase subunit beta [Haemophilus
           influenzae PittGG]
 gi|148718324|gb|ABQ99451.1| ribonucleotide-diphosphate reductase subunit beta [Haemophilus
           influenzae PittGG]
          Length = 409

 Score =  305 bits (781), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 101/422 (23%), Positives = 187/422 (44%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD +   +++ EIETDK ++E  ++ +G++ E++
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKVGDTVKRDEVIVEIETDKVVLEVPALSDGVLAEVV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +     +  I         S  L   N     +  + +          ++  I
Sbjct: 61  QAEG-ETVVSKQLLGKISTAQEGDVSSATLKATNEPTPSDRQNAAIENSHNHNADQSPAI 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              LA        I  S + G      I +   +                   +   +  
Sbjct: 120 RRLLAEHDLQADQIQGSGVGGRLTREDIEREIAKRQAQQVKQEAATEQNTISTVAYSA-- 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                     S + +P   +RK IA RL ++K +        + ++  +++LR+      
Sbjct: 178 ---------RSEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMQPIMTLRKTYGEKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---HGVRLGFMSFYIKAVVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ +I  ++K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVLRDCDKLSMAEIEKQIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +  N ++ +  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 346 QSAILGMHAIKERPIALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|256112256|ref|ZP_05453177.1| dihydrolipoamide succinyltransferase [Brucella melitensis bv. 3
           str. Ether]
 gi|265993685|ref|ZP_06106242.1| dihydrolipoamide succinyltransferase [Brucella melitensis bv. 3
           str. Ether]
 gi|262764666|gb|EEZ10587.1| dihydrolipoamide succinyltransferase [Brucella melitensis bv. 3
           str. Ether]
          Length = 408

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 94/422 (22%), Positives = 171/422 (40%), Gaps = 16/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ I+  + L E+ETDK  +E  +   G++ EI 
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKAGEAIAVDEPLVELETDKVTVEVPAPAAGVLAEIT 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V   +  I  D   +  +P   KE         + +               
Sbjct: 61  AKEG-DTVEVGELLGQISSDGAAVAAAPAQKKEEAKPAAAAPAAAPVASA---------- 109

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                  +                  ++  S     +     ++  +   S         
Sbjct: 110 --SSGPAMQPAPAAAKLLAESGLSADQVEGSGKRGQVLKGDVLEAITKGVSAAPAAPVAA 167

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
               +       E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 168 RPASSADDASREERVKMTRLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMELRNKYKDVF 227

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++      + +AV    G+V 
Sbjct: 228 EKK---HGVKLGFMGFFTKAVTHALKEIPAVNAEIDGTDIVYKNFCHVGMAVGTDKGLVV 284

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI ++  E+ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 285 PVIRDADQMSIAEVEKELARLARAARDGSLSMADMQGGTFTITNGGVYGSLMSTPILNAP 344

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +    +I V  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 345 QSGILGMHKIQERPMIVGGQIVVRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 404

Query: 422 LM 423
           ++
Sbjct: 405 VL 406


>gi|260464178|ref|ZP_05812371.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Mesorhizobium opportunistum
           WSM2075]
 gi|259029981|gb|EEW31264.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Mesorhizobium opportunistum
           WSM2075]
          Length = 430

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 97/432 (22%), Positives = 170/432 (39%), Gaps = 14/432 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ GD I+  + L E+ETDK  +E  +   G + EI 
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKVGDAIAVDEPLVELETDKVTVEVPAAAAGTLGEIT 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E + V + +  I        P+     +     +     ++    +      R  
Sbjct: 61  AKEG-ETVGVGALLGMISAGGAGAAPANKQEAKPQAVAQASSPDAAHTTKQAAAETARIA 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                           ++   +  +  + +                  I        +  
Sbjct: 120 GDAGPVEPRTMPPAPAAAKLIAENNLSVDQLSGSGKRGQVLKGDVLDAISKGAPSQPAET 179

Query: 182 ANILNLF----------AKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
                                 E +    +R+TIA RL++++ T        + ++  ++
Sbjct: 180 PKAAPAPVAMRAPSSGDDASREERVRMTKLRQTIARRLKEAQSTAAMLTTFNEVDMSAVM 239

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISV 291
           +LR +     +        K+       KA   A+ ++P  N       +I   +  I V
Sbjct: 240 ALRTKYKDVFEKK---HGVKLGFMGFFTKAVTHALKEIPSVNAEIDGTDIIFKNYAHIGV 296

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGI 351
           AV    G+V P++R ADQ SI +I  E+ +L   A+  KL   + QGGT +ISN G+ G 
Sbjct: 297 AVGTEKGLVVPVVRDADQMSIAEIEKEIGRLGIAARDGKLSVADMQGGTFTISNGGVYGS 356

Query: 352 NSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKF 411
                ++N PQS IL +   + + V    +I +  +M   LS DHR VDG  A   L + 
Sbjct: 357 LMSTPILNAPQSGILGMHKIQDRPVVVGGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRV 416

Query: 412 KEYIENPVWMLM 423
           KE +E+P  +++
Sbjct: 417 KESLEDPERLVL 428


>gi|325578253|ref|ZP_08148388.1| 2-oxoglutarate dehydrogenase E2, dihydrolipoamide acetyltransferase
           [Haemophilus parainfluenzae ATCC 33392]
 gi|325159989|gb|EGC72118.1| 2-oxoglutarate dehydrogenase E2, dihydrolipoamide acetyltransferase
           [Haemophilus parainfluenzae ATCC 33392]
          Length = 408

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 101/422 (23%), Positives = 187/422 (44%), Gaps = 16/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ G+ +   ++L EIETDK ++E  ++ +G++ EIL
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKVGETVKRDEVLVEIETDKVVLEVPALSDGVVAEIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  +              +   +       +      R++ S     
Sbjct: 61  QEEGA-TVVSKQLLGKLST-----------QQAGDISSETVKDNEPTPADRQRASIENSH 108

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +   +  A    +    L      G  V   I      +   K  +      +  E   
Sbjct: 109 NNSADQGPAIRRLLAEHDLDAEKIQGSGVGGRITREDVAREVAKRDAQKAKQDVATEQNT 168

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            + +      S + +P   +RK IA RL ++K T        + ++  ++ LR+      
Sbjct: 169 ISTVAYS-SRSEKRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMKLRKTYGEKF 227

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 228 EKQ---HGARLGFMSFYIKAVVEALKRYPEVNASIDGDDIVYHNYFDISIAVSTPRGLVT 284

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ DI  ++K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 285 PVLRNCDKLSMADIEKQIKLLAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 344

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ V  + ++ +  +M   LS DHR +DG  +   L   K+ +E+P  +
Sbjct: 345 QSAILGMHAIKERPVAVDGQVVIRPMMYLALSYDHRLIDGRESVGFLVAIKDLLEDPTRL 404

Query: 422 LM 423
           L+
Sbjct: 405 LL 406


>gi|148261803|ref|YP_001235930.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Acidiphilium cryptum JF-5]
 gi|146403484|gb|ABQ32011.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Acidiphilium cryptum JF-5]
          Length = 425

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 182/426 (42%), Positives = 255/426 (59%), Gaps = 5/426 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEG LA+W+K+EG+ I  GD++ EIETDKA ME E+VDEG++ +IL
Sbjct: 1   MATNILMPALSPTMTEGTLARWLKKEGETIKAGDVIAEIETDKATMEVEAVDEGVLGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V AG+EN+AVN+PI  ++     +P S P +         E   +         ++    
Sbjct: 61  VAAGSENVAVNAPIAILVEPGEAVPDSAPAAPAPKPAAAPEPVAAPAPAAAAPAAETTGH 120

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN----VKDYSTIQSFGLVD 177
              +            + +  +   G      I                    ++     
Sbjct: 121 GPRVFASPLARRMAQQAGIDLATLKGSGPNGRIVKADIDAARGSGPEAAAPAPKAPAAAP 180

Query: 178 ESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
            +  A          ++ IPH ++RK IA RLQ +KQTIPHFY+S+D  +D LL LR ++
Sbjct: 181 PAQAAAAPAAPITAPHDAIPHSSMRKVIAKRLQAAKQTIPHFYLSMDVELDALLKLRAEL 240

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
           N          + K+SVND+I+KA A+A+ +VP AN S+T  AMIR+  +DISVAV+IP 
Sbjct: 241 NAQSPKEGP-GAFKLSVNDLIIKAVAVALRRVPAANASFTEEAMIRYHDVDISVAVAIPD 299

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G++TPIIR+ADQK +  IS E+K LA RAK  KLKP+E+QGG+ SISN+GM GI+SF A+
Sbjct: 300 GLITPIIRKADQKGLAAISNEMKDLAARAKAGKLKPDEFQGGSFSISNLGMYGISSFSAI 359

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           INPPQ  ILAIGAGEK+ V + E+I +AT+M  TLS DHR VDGA+ ++ LA FK  +E 
Sbjct: 360 INPPQGGILAIGAGEKRPVVKGEQIAIATMMTVTLSCDHRVVDGAVGAEFLAAFKSIVER 419

Query: 418 PVWMLM 423
           P+ +++
Sbjct: 420 PLGLML 425


>gi|91205115|ref|YP_537470.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           bellii RML369-C]
 gi|122425947|sp|Q1RJT3|ODP2_RICBR RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component of pyruvate dehydrogenase complex; AltName:
           Full=Dihydrolipoamide acetyltransferase component of
           pyruvate dehydrogenase complex; AltName: Full=E2
 gi|91068659|gb|ABE04381.1| Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rickettsia bellii RML369-C]
          Length = 418

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 175/422 (41%), Positives = 268/422 (63%), Gaps = 7/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + MP+LSPTMTEG LA+W+K+EGDKI+PG+++ EIETDKA ME E+VDEG + +I+
Sbjct: 1   MPIKLLMPALSPTMTEGNLARWLKKEGDKINPGEVIAEIETDKATMEVEAVDEGTLAKII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +P G++N+ VNS I  ++ +  E        +E I +          +    +    + +
Sbjct: 61  IPQGSQNVPVNSLIAVLIEEGEE----LSGIEEFIAKNNSNSPKKEEISKPAETIAPQNV 116

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   + ++ I + +   +    +I    IE +  +  + +                
Sbjct: 117 KEENITTASDQNNIKVFASPLAKRLAKIQNVRIEEIKGSGPHGRIIKQDVLSHKGGSKAL 176

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           +N +     + Y + P++NIRK IA RL +SKQT+PHFY+SI+CN+D LL +RE +N++ 
Sbjct: 177 SNKIVSRNPEEYRLAPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKSF 236

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
               ++ S KISVND I+ A A A+ +VP AN SW  +A+  + ++DISVAV+I  G+VT
Sbjct: 237 ---GDDKSAKISVNDFIILAVAKALQEVPNANASWGDDAIRYYNNVDISVAVAIENGLVT 293

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PIIR ADQK+I+D+S E+K L ++A++ KL PEE+QGG  +ISN+GM GI +F A+INPP
Sbjct: 294 PIIRNADQKNIVDLSSEMKGLIKKARENKLTPEEFQGGGFTISNLGMYGIKNFNAIINPP 353

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS I+ +G+  K+ + +N++I +ATIM+ TLSADHR VDGA+ ++ LA FK +IE+P  M
Sbjct: 354 QSCIMGVGSSSKRAIVKNDQISIATIMDVTLSADHRVVDGAVGAEFLAAFKRFIESPALM 413

Query: 422 LM 423
           L+
Sbjct: 414 LL 415


>gi|293392044|ref|ZP_06636378.1| dihydrolipoyllysine-residue succinyltransferase [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290952578|gb|EFE02697.1| dihydrolipoyllysine-residue succinyltransferase [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 407

 Score =  304 bits (778), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 105/422 (24%), Positives = 184/422 (43%), Gaps = 17/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD +   +++ EIETDK ++E  +  +G++ +IL
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKAGDAVKRDEVIVEIETDKVVLEVPAQADGVLAQIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  +    T    +   + E   + R       P V           
Sbjct: 61  QEEGA-TVVSKQLLGTLEDSVTAAAIATEKTAEPTPKDRRTEVPDEPHV----------- 108

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
               A+  A    +    L  S             +              +      + D
Sbjct: 109 --TDAQGPAVRRLLAEHGLQPSDVADVKGTGVGGRITREDVEAILAQRTAAAAQPQVAED 166

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                 +A  S + +P   +RK IA RL ++K T        + ++  +++LR+Q     
Sbjct: 167 TLSTVAYAARSEKRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMNLRKQYGEKF 226

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + +I H + D+S+AVS P G+VT
Sbjct: 227 EKQ---HGVRLGFMSFYIKAVVEALKRYPEVNASIDGDDVIYHNYFDVSIAVSTPRGLVT 283

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D  S+ DI   +K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 284 PVLRDCDNLSMADIEKSIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 343

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ V  N ++ +  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 344 QSAILGMHAIKERPVALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRL 403

Query: 422 LM 423
           L+
Sbjct: 404 LL 405


>gi|91762635|ref|ZP_01264600.1| 2-oxoglutarate dehydrogenase complex E2 component [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|91718437|gb|EAS85087.1| 2-oxoglutarate dehydrogenase complex E2 component [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 425

 Score =  304 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 101/427 (23%), Positives = 188/427 (44%), Gaps = 9/427 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++TE  +AKW+K+EGD +   + + E+ETDK  +E  S  +G++ EI 
Sbjct: 1   MSEKILVPVLGESITEATVAKWLKKEGDTVVADEAIVELETDKVNLEVPSPIDGVLSEIN 60

Query: 62  VPAGTENIAVNSPILNILMDST-----EIPPSPPLSKENIVEVREEHSHSSPVVVREKHS 116
              G E + V + +  I  +       +I       K     V  E    +P V++E   
Sbjct: 61  SKDG-ETVEVGALLGMISQNGAQPSEKKIITKIEPKKTENNVVNLEIKKEAPKVLKEPEE 119

Query: 117 KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLV 176
           +   + +   +        + + +        +V++ I+    + +  +          +
Sbjct: 120 EEPLVLTNEVKEEKTNSSNNNNEILSPAVRKIVVENKIDLKKVSGSGKEGRVLKGDLISM 179

Query: 177 DESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
                            E I    +R+TIA RL+Q+++         + ++  ++ +R++
Sbjct: 180 MGENPQPSERKIKYGQEERIKMSRLRQTIAKRLKQAQENAALLTTFNEVDMTGIMEMRKE 239

Query: 237 MNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIP 296
                Q        K+      +KA   A+   P  N     + +I   + ++S AV   
Sbjct: 240 NQEDFQSR---YGIKLGFMSFFVKACVAALKMYPSVNAEIDGDEIIYKNYYNMSFAVGTE 296

Query: 297 GGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCA 356
            G+V P++R  DQ S  DI   +K ++++A+  K+  E+ QGGT +ISN G+ G      
Sbjct: 297 KGLVVPVLRDTDQLSFADIEKNIKTISEKARDGKITIEDLQGGTFTISNGGVYGSMLSTP 356

Query: 357 VINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIE 416
           ++N PQS +L +    ++ +  + EIK+  IM   LS DHR +DG  +   L   KE +E
Sbjct: 357 ILNLPQSGVLGMHNIVERPMVVDGEIKIRPIMYLALSYDHRIIDGKESVSFLKMVKENLE 416

Query: 417 NPVWMLM 423
           +P  + +
Sbjct: 417 DPRRLFL 423


>gi|71082941|ref|YP_265660.1| 2-oxoglutarate dehydrogenase complex E2 component [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|71062054|gb|AAZ21057.1| 2-oxoglutarate dehydrogenase complex E2 component [Candidatus
           Pelagibacter ubique HTCC1062]
          Length = 425

 Score =  304 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 102/427 (23%), Positives = 189/427 (44%), Gaps = 9/427 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++TE  +AKW+K+EGD +   + + E+ETDK  +E  S  +G++ EI 
Sbjct: 1   MSEKILVPVLGESITEATVAKWLKKEGDTVVADEAIVELETDKVNLEVPSPIDGVLSEIN 60

Query: 62  VPAGTENIAVNSPILNILMDST-----EIPPSPPLSKENIVEVREEHSHSSPVVVREKHS 116
              G E + V + +  I  +       +I       K     V  E    +P V++E   
Sbjct: 61  SKDG-ETVEVGALLGMISQNGAQPSEKKIITKIEPKKTENNVVNLEIKKEAPKVLKEPEE 119

Query: 117 KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLV 176
           +   + +   +        + + +        +V++ I+    + +  +          +
Sbjct: 120 EEPLVLTNEVKEEKTNSSNNNNEILSPAVRKIVVENKIDLKKVSGSGKEGRVLKGDLISM 179

Query: 177 DESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
                            E I    +R+TIA RL+Q+++         + ++  ++ +R++
Sbjct: 180 MGENPQPSERKIKYGQEERIKMSRLRQTIAKRLKQAQENAALLTTFNEVDMTGIMEMRKE 239

Query: 237 MNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIP 296
                Q        K+      +KA   A+   P  N     + +I   + ++S AV   
Sbjct: 240 NQEDFQSR---YGIKLGFMSFFVKACVAALKMYPSVNAEIDGDEIIYKNYYNMSFAVGTE 296

Query: 297 GGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCA 356
            G+V P++R ADQ S  DI   +K ++++A+  K+  E+ QGGT +ISN G+ G      
Sbjct: 297 KGLVVPVLRDADQLSFADIEKNIKTISEKARDGKITIEDLQGGTFTISNGGVYGSMLSTP 356

Query: 357 VINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIE 416
           ++N PQS +L +    ++ +  + EIK+  IM   LS DHR +DG  +   L   KE +E
Sbjct: 357 ILNLPQSGVLGMHNIVERPMVVDGEIKIRPIMYLALSYDHRIIDGKESVSFLKMVKENLE 416

Query: 417 NPVWMLM 423
           +P  + +
Sbjct: 417 DPRRLFL 423


>gi|15966805|ref|NP_387158.1| dihydrolipoamide acetyltransferase [Sinorhizobium meliloti 1021]
 gi|307301633|ref|ZP_07581392.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Sinorhizobium meliloti BL225C]
 gi|307316343|ref|ZP_07595787.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Sinorhizobium meliloti AK83]
 gi|15076077|emb|CAC47631.1| Probable dihydrolipoamide succinyl transferase component of
           2-oxoglutarate dehydrogenase complex (E2) protein
           [Sinorhizobium meliloti 1021]
 gi|306898183|gb|EFN28925.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Sinorhizobium meliloti AK83]
 gi|306903331|gb|EFN33920.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Sinorhizobium meliloti BL225C]
          Length = 417

 Score =  304 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 97/422 (22%), Positives = 178/422 (42%), Gaps = 7/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  +  W K+ GD I   + + E+ETDK  +E  +   G + EI+
Sbjct: 1   MATEIRVPTLGESVSEATVGTWFKKVGDAIKADEPILELETDKVTIEVPAPAAGTLSEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             AG E + + + +  I   +     +P  +++         + ++        +     
Sbjct: 61  AQAG-ETVGLGALLGQIAEGAGAAAAAPAAAEKKPEPAAATAAPAAAAQPAAAAATQTST 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           + P A   A     +  S       G+  +     +++                V     
Sbjct: 120 SMPPAPAAAKLIAENNLSADQIDGSGKRGQVLKGDVLAAVAKGISAPAAAEPAKVQARAP 179

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A   +   +   E +    +R+TIA RL+ ++ T        + ++  ++SLR +     
Sbjct: 180 APAEDAARE---ERVKMTRLRQTIARRLKDAQNTAAMLTTYNEVDMSAVMSLRSKYKDIF 236

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       +I      + VAV    G+V 
Sbjct: 237 EKK---HGVKLGFMGFFTKAVTHALKELPAVNAEVDGTEIIYKNFCHVGVAVGTDKGLVV 293

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ SI +I  E+ +L + A+   L   + QGGT +ISN G+ G      ++N P
Sbjct: 294 PVVRDADQMSIAEIEKEIGRLGKAARDGTLSMADMQGGTFTISNGGVYGSLMSSPILNAP 353

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   + + V    ++ +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 354 QSGILGMHKIQDRPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 413

Query: 422 LM 423
           ++
Sbjct: 414 VL 415


>gi|301156156|emb|CBW15627.1| dihydrolipoyltranssuccinase [Haemophilus parainfluenzae T3T1]
          Length = 408

 Score =  304 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 101/422 (23%), Positives = 187/422 (44%), Gaps = 16/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ G+ +   ++L EIETDK ++E  ++ +G++ EIL
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKVGETVKRDEVLVEIETDKVVLEVPALSDGVVAEIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  +              +   +       +      R+K +     
Sbjct: 61  QEEGA-TVVSKQLLGKLST-----------QQAGDISSETVKGNEPTPADRQKAAIENSH 108

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +   +  A    +    L      G  V   I      +   K  +      +  E   
Sbjct: 109 NNSADQGPAIRRLLAEHDLDAEKIQGSGVGGRITREDVAREVAKRDAQKAKQDVATEQNT 168

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            + +      S + +P   +RK IA RL ++K T        + ++  ++ LR+      
Sbjct: 169 VSTVAYS-SRSEKRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMKLRKTYGEKF 227

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 228 EKQ---HGVRLGFMSFYIKAVVEALKRYPEVNASIDGDDIVYHNYFDISIAVSTPRGLVT 284

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ DI  ++K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 285 PVLRNCDKLSMADIEKQIKSLAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 344

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ V  + ++ +  +M   LS DHR +DG  +   L   K+ +E+P  +
Sbjct: 345 QSAILGMHAIKERPVAVDGQVVIRPMMYLALSYDHRLIDGRESVGFLVAIKDLLEDPTRL 404

Query: 422 LM 423
           L+
Sbjct: 405 LL 406


>gi|296114444|ref|ZP_06833097.1| 2-oxoglutarate dehydrogenase E2 component [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295978800|gb|EFG85525.1| 2-oxoglutarate dehydrogenase E2 component [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 416

 Score =  304 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 98/422 (23%), Positives = 182/422 (43%), Gaps = 8/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++T   +AKW+KQ GD +S  D + E+ETDK  +E  +   G++  +L
Sbjct: 1   MSAEIKVPTLGESVTTATVAKWLKQPGDTVSADDPVAELETDKVSVEVPAPQAGVLGPLL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  G E + V + +  +   + +                +    S+  V R         
Sbjct: 61  VAEGAE-VEVGTVLSTVEAGTGKPAAPVAKPAPAPAAGVQAQPLSTGPVARPATP----- 114

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           AS +A + A       +  + +       +    +    +    D     +         
Sbjct: 115 ASDVAAQGAAHAPFPAAQKAMTEQGVSAAQVGTGSGKDGRITKGDVQAFLAQPRAATPAA 174

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A           E +    +R+TIA RL+ ++ T        + ++  + ++R +     
Sbjct: 175 APRPPRQDDPREERVKMTRLRRTIARRLKDAQNTAALLTTFNEVDMSAVKAMRAEYKDAF 234

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
                    K+    I  +A   A+ + P  N     + +I  + +++ +AV  P G+V 
Sbjct: 235 AKKHN--GAKLGFMSIFSRAVIAALQEFPAINAEIDGDDVIYREFVNLGIAVGGPNGLVV 292

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQK+  +I   +    ++A++  LK +E  GGT SI+N G+ G      +IN P
Sbjct: 293 PVIRDADQKNFAEIENAIAGFGKKAREGTLKIDELSGGTFSITNGGIYGSLMSTPIINAP 352

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + + + + V  + ++ +  +M   L+ DHR VDG  A   L + K+ +E+P  +
Sbjct: 353 QSAILGMHSIQDRPVAVDGQVVIRPMMYIALTYDHRIVDGKEAVSFLVRVKQNVEDPRRL 412

Query: 422 LM 423
           L+
Sbjct: 413 LL 414


>gi|316931842|ref|YP_004106824.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Rhodopseudomonas palustris DX-1]
 gi|315599556|gb|ADU42091.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Rhodopseudomonas palustris DX-1]
          Length = 413

 Score =  303 bits (776), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 98/421 (23%), Positives = 177/421 (42%), Gaps = 10/421 (2%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I +P+L  ++TE  + +W KQ G+ ++  + L E+ETDK  +E  +   G + EI+ 
Sbjct: 1   MTEIRVPTLGESVTEATIGRWFKQPGEAVAVDEPLVELETDKVTIEVPAPSAGTLGEIVA 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G E +AV + +  I  D          +           + +      +    + P+A
Sbjct: 61  KDG-ETVAVGALLGQI-TDGAAPAKPAAAAPAKAAPAPAAQAPAPAAPAAKTPPSDAPLA 118

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
             + R          +               +  +    +     +   +   V     A
Sbjct: 119 PSVRRLSTESGVDASTVPGSGKDGRVTKGDMLAAIEKAASAPTPVNQPAAAVQVRAPSPA 178

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
           +          E +    +R+TIA RL++ + T        + ++ N+++LR Q     +
Sbjct: 179 DDAA-----REERVKMTRLRQTIARRLKEVQNTAAMLTTFNEVDMTNVMALRAQYKDVFE 233

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                   K+       KA   A+  +P  N       +I   +  + VAV    G+V P
Sbjct: 234 KK---HGAKLGFMGFFTKACVQALKDIPAVNAEIDGTDLIYKNYYHVGVAVGTDKGLVVP 290

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R  D KSI +I   +    +RA+  +LK EE QGGT +I+N G+ G      ++N PQ
Sbjct: 291 VVRDCDTKSIAEIETSISDFGRRARDGQLKIEEMQGGTFTITNGGIYGSLMSTPILNAPQ 350

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL +   +++ V    +I+V  +M   LS DHR +DG  A   L + KE +E+P  ++
Sbjct: 351 SGILGMHKIQERPVVVGGKIEVRPMMYLALSYDHRVIDGKEAVTFLVRVKESLEDPARLV 410

Query: 423 M 423
           +
Sbjct: 411 L 411


>gi|150398137|ref|YP_001328604.1| dihydrolipoamide succinyltransferase [Sinorhizobium medicae WSM419]
 gi|150029652|gb|ABR61769.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Sinorhizobium medicae WSM419]
          Length = 415

 Score =  303 bits (776), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 95/422 (22%), Positives = 171/422 (40%), Gaps = 9/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  +  W K+ GD I   + + E+ETDK  +E  +   G + EI+
Sbjct: 1   MATEIRVPTLGESVSEATVGTWFKKVGDAIKADEPIVELETDKVTIEVPAPAAGTLSEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             AG E + + + +  I   +     +P  +++    V    + ++          +  +
Sbjct: 61  AQAG-ETVGLGALLGQIAEGAGAAAAAPAAAEKKPEPVAAAPAAAARPPTAAAPQTSTSM 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
               A           +           V          K      +   +         
Sbjct: 120 PPAPASAKLIAENSLSADQIDGSGKRGQVLKGDVLAAVAKGISAPAAAEPAQVQARAPAP 179

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A           E +    +R+TIA RL+ ++ T        + ++  ++SLR +     
Sbjct: 180 AEDAA-----REERVKMTRLRQTIARRLKDAQNTAAMLTTYNEVDMSAVMSLRSKYKDIF 234

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       +I      + VAV    G+V 
Sbjct: 235 EKK---HGVKLGFMGFFTKAVTHALKELPAVNAEIDGTEIIYKNFCHVGVAVGTDKGLVV 291

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ SI +I  E+ +L + A+   L   + QGGT +ISN G+ G      ++N P
Sbjct: 292 PVVRDADQMSIAEIEKEIGRLGKAARDGALSMADMQGGTFTISNGGVYGSLMSSPILNAP 351

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   + + V    ++ +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 352 QSGILGMHKIQDRPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 411

Query: 422 LM 423
           ++
Sbjct: 412 VL 413


>gi|75674621|ref|YP_317042.1| dihydrolipoamide acetyltransferase [Nitrobacter winogradskyi
           Nb-255]
 gi|74419491|gb|ABA03690.1| 2-oxoglutarate dehydrogenase E2 component [Nitrobacter winogradskyi
           Nb-255]
          Length = 424

 Score =  303 bits (776), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 96/426 (22%), Positives = 175/426 (41%), Gaps = 9/426 (2%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I +P+L  ++TE  + KW K++GD +S  + L E+ETDK  +E  +   G + E++ 
Sbjct: 1   MTEIRVPTLGESVTEATIGKWFKKQGDAVSVDEPLVELETDKVTIEVPAPSAGTLAELVA 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G E +AV + +  I        P+   ++    E                ++      
Sbjct: 61  RQG-ETVAVGALLGQITEGGAPAKPAAAKTQGISAESTTGRPDLKSDTTTPINAGPEEPR 119

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
                       +   S         +  S  +  ++    +       S     +   A
Sbjct: 120 PRAEADAPLAPSVRKLSAESGIDASTVSGSGKDGRVTKGDMLAAIEKAASAPTPVDQPAA 179

Query: 183 N-----ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
                           E +    +R+TIA RL+  + T        + ++  +++LR   
Sbjct: 180 AVQVRAPSPADDASREERVKMTRLRQTIARRLKDVQNTAAILTTFNEVDMSGVMALRAHY 239

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
               +        K+       KA   A+  +P  N     + +I   +  I +AV    
Sbjct: 240 KDVFEKK---HGVKLGFMGFFTKAIVQALRDIPAVNAEIDGSDLIYKNYYHIGIAVGTDK 296

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G+V P++R  DQKSI +I   V    +RA+  +LK EE QGGT +I+N G+ G      +
Sbjct: 297 GLVVPVVRDCDQKSIAEIEKSVADYGRRARDGQLKIEEMQGGTFTITNGGIYGSLMSTPI 356

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           +N PQ+ IL +   +++ V    ++++  +M   LS DHR +DG  A   L + KE +E+
Sbjct: 357 LNAPQAGILGMHKIQERPVAIGGKVEIRPMMYLALSYDHRVIDGKEAVTFLVRVKESLED 416

Query: 418 PVWMLM 423
           P  +++
Sbjct: 417 PARLVL 422


>gi|319407855|emb|CBI81508.1| dihydrolipoamide succinyltransferase [Bartonella sp. 1-1C]
          Length = 405

 Score =  303 bits (776), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 98/422 (23%), Positives = 176/422 (41%), Gaps = 19/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ ++  + L E+ETDK  +E  S   G + EI+
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKIGEAVAMDEPLVELETDKVTVEVPSPVAGKLSEII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + VN+ +  I   +  +  S        V      S  +  V         P 
Sbjct: 61  AKEG-DTVEVNALLGVIEAGADGVSVSSAPPASPSVISMPASSPMAASVSTSSLGGTMPP 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A   A+ +A  +               +    +  L                        
Sbjct: 120 APSAAKLMAENNIEKSDLSGSGKRGQILKGDVLNALTQGIKT---------------PAS 164

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            +          E +    +R+TIA RL+ ++ T        + ++  ++ LR++     
Sbjct: 165 LSSAVSVDTVHEERVRMTKLRQTIARRLKDAQNTAAMLTTFNEVDMSTVMDLRKRYKDLF 224

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       +I   +++  +AV    G+V 
Sbjct: 225 EKK---HGVKLGFMGFFTKAVCHALKELPAVNAEIDGTDIIYKNYVNAGIAVGTDKGLVV 281

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ SI +I  E+ +L + A+  KL   +  GGT +I+N G+ G      ++N P
Sbjct: 282 PVVRNADQMSIAEIEKEIGRLGRLARDGKLAVADMLGGTFTITNGGVYGSLMSTPILNAP 341

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +    +I +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 342 QSGILGMHAIKERAMVVGGQIVIRPMMYLALSYDHRIVDGQEAVTFLVRVKESLEDPERL 401

Query: 422 LM 423
           ++
Sbjct: 402 VL 403


>gi|254521762|ref|ZP_05133817.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Stenotrophomonas sp. SKA14]
 gi|219719353|gb|EED37878.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Stenotrophomonas sp. SKA14]
          Length = 399

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 110/421 (26%), Positives = 189/421 (44%), Gaps = 25/421 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   +  P L  ++ +G +A W K+ GD +   + L ++ETDK ++E  S  +G++ EI 
Sbjct: 1   MATEVKAPVLPESVADGTIATWHKKVGDAVKRDENLLDLETDKVVLEVPSPVDGVLKEIK 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G+  +  +  +  I   +    P+P   ++         + ++              
Sbjct: 61  FAEGS-TVTSSQVVAIIEEGAVAAAPAPAAEEKKAEAAPAAAAPAAAAAPAPAAKSAADA 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
             P AR  A   G++ + + G+G  G + K DI                        + +
Sbjct: 120 LPPGARFTAITEGVNPADVDGTGRRGAVTKEDIVNF---------------------ARN 158

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                       E +P   IRK IA RL +SK +        + ++  + + R+++    
Sbjct: 159 GGAGKAGGARPEERVPMTRIRKRIAERLMESKNSTAMLTTFNEVDLSKVSAARKELQDEF 218

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
                    K+      +KA A A+ + P  N S   + +I H + DIS+AVS   G+VT
Sbjct: 219 VKA---HGIKLGFMSFFVKAAANALQRFPLVNASIDGDDIIYHGYSDISIAVSTEKGLVT 275

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  ++ S  DI   +   A++A+  KL  EE QGGT +++N G  G      +INPP
Sbjct: 276 PVLRNVERMSFADIEKTIADYAKKARDGKLSLEELQGGTFTVTNGGTFGSLLSTPIINPP 335

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ + QN ++ +A +M   LS DHR +DG  + + L   K  +ENP  M
Sbjct: 336 QSAILGMHAIKERPIAQNGQVVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRM 395

Query: 422 L 422
           L
Sbjct: 396 L 396


>gi|319943658|ref|ZP_08017939.1| dihydrolipoyllysine-residue succinyltransferase [Lautropia
           mirabilis ATCC 51599]
 gi|319742891|gb|EFV95297.1| dihydrolipoyllysine-residue succinyltransferase [Lautropia
           mirabilis ATCC 51599]
          Length = 422

 Score =  303 bits (775), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 108/424 (25%), Positives = 185/424 (43%), Gaps = 5/424 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    + +P LS ++ E  L +W K+ GD ++  + L +IETDK ++E  +   G+I +I
Sbjct: 1   MAQIEVKVPQLSESVAEATLLQWHKKVGDAVARDENLVDIETDKVVLELPAPSAGVITDI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
               G   +  +  I  I  ++T    +P  +    V      + ++        +    
Sbjct: 61  KKGDGA-TVVADELIAIIDTEATAGASAPQAAAPAQVPAAAAPAQAAAPATTGGAASGIA 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           + +               + SG         +   T     +       + +   +  + 
Sbjct: 120 MPAAAKLLAEKGIDPAQVAGSGRDGRITKADALNATAKPAASTPAALPAVNAPAALPVAR 179

Query: 181 DANILNLFAKDSYE-VIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
               LN   +   E  +P   +R+ +A RL QS+QT        + N+  ++SLR++   
Sbjct: 180 TPVDLNRVLEGRSEQRVPMSRLRQRVAERLLQSQQTNAILTTFNEVNMQPVMSLRKKYQE 239

Query: 240 TLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGI 299
             +        ++      +KA   A+ + P  N S   N ++ H + DI VAV  P G+
Sbjct: 240 KFEKE---HGVRLGFMSFFVKAAVHALKKFPIVNASIDGNDIVYHGYFDIGVAVGSPRGL 296

Query: 300 VTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVIN 359
           V P+IR ADQ S   I   +    +RA+  K+  EE  GGT SISN G+ G      +IN
Sbjct: 297 VVPVIRNADQLSFHQIEQTIADFGKRAQAGKIGIEELSGGTFSISNGGVFGSMLSTPIIN 356

Query: 360 PPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPV 419
           PPQS IL + A +++ V +N ++ +  I    LS DHR +DG  A   L   K+ +E+P 
Sbjct: 357 PPQSAILGVHATKERPVVENGQVVIRPINYLALSYDHRIIDGREAVLFLVAIKDALEDPA 416

Query: 420 WMLM 423
            +L+
Sbjct: 417 RLLL 420


>gi|146337553|ref|YP_001202601.1| dihydrolipoamide succinyltransferase [Bradyrhizobium sp. ORS278]
 gi|146190359|emb|CAL74355.1| Dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex (E2); acid-inducible
           [Bradyrhizobium sp. ORS278]
          Length = 413

 Score =  303 bits (775), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 97/421 (23%), Positives = 178/421 (42%), Gaps = 10/421 (2%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I +P+L  ++TE  + +W K+ GD ++  + L E+ETDK  +E  +   G + EI+ 
Sbjct: 1   MTDIRVPTLGESVTEATIGRWFKKAGDAVAVDEPLVELETDKVTIEVPAPSAGTLGEIIA 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G E +AV + +  I  D          +           + +      +    + P A
Sbjct: 61  KDG-ETVAVGALLGQI-NDGAAAAKPAAAAPAPAPAKPAAAAPAPAPAPAKALPADTPQA 118

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
             + +  A       +               +  +    +     +   +   V     A
Sbjct: 119 PSVRKLSAESGVDATTVPGSGKDGRVTKGDMLAAIERAASAPTPVNQPAASVQVRAPSPA 178

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
           +          E +    +R+TIA RL+  + T        + ++ ++++LR Q     +
Sbjct: 179 DDAA-----REERVKMTRLRQTIARRLKDVQNTAAMLTTFNEVDMTHVMALRSQYKDVFE 233

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                  +K+       KA   A+  +P  N     + +I   +  I VAV    G+V P
Sbjct: 234 KK---HGSKLGFMGFFTKAVVQALKDIPAVNAEIDGSDLIYKNYYHIGVAVGTDKGLVVP 290

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R  D KSI DI   +    +RA+  +LK +E QGGT +I+N G+ G      ++N PQ
Sbjct: 291 VVRDCDHKSIADIEKGIADFGRRARDGQLKIDEMQGGTFTITNGGIYGSLMSTPILNAPQ 350

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL +   +++ +    +I+V  +M   LS DHR +DG  A   L + KE +E+P  ++
Sbjct: 351 SGILGMHKIQERPMVVGGKIEVRPMMYLALSYDHRVIDGKEAVTFLVRVKESLEDPARLV 410

Query: 423 M 423
           +
Sbjct: 411 L 411


>gi|92116162|ref|YP_575891.1| dihydrolipoamide succinyltransferase [Nitrobacter hamburgensis X14]
 gi|91799056|gb|ABE61431.1| 2-oxoglutarate dehydrogenase E2 component [Nitrobacter hamburgensis
           X14]
          Length = 413

 Score =  303 bits (775), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 95/421 (22%), Positives = 183/421 (43%), Gaps = 10/421 (2%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I +P+L  ++TE  + KW K+ GD ++  + L E+ETDK  +E  +   G + EI+ 
Sbjct: 1   MTEIRVPTLGESVTEATIGKWFKKAGDAVAVDEPLVELETDKVTIEVPAPSAGTLSEIVA 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G E +AV + +  I  +      +   + +         +  SPV  ++    + P+A
Sbjct: 61  KDG-ETVAVGALLGQI-SEGAAPVKATAPAAQPAAAAPASAAAVSPVPAQKSPPPDAPLA 118

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
             + +  A       +               +  +    +     +   +   V     A
Sbjct: 119 PSVRKLSAESGVDASTVPGSGKDGRVTKGDMLAAIEKAASTATPVNQPAAAVQVRAPSPA 178

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
           +          E +    +R+TIA RL++ + T        + ++  +++LR       +
Sbjct: 179 DDAA-----REERVKMTRLRQTIARRLKEVQNTAAMLTTFNEVDMTGVMTLRTHYKEVFE 233

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                   K+       KA   A+  +P AN       +I   +  I +AV    G+V P
Sbjct: 234 KK---HGVKLGFMGFFTKACVQALKDIPAANAEIDGTDLIYKNYYHIGIAVGTDKGLVVP 290

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R  D+KSI +I   +    +RA+  +LK +E QGGT +I+N G+ G      ++N PQ
Sbjct: 291 VVRDCDRKSIAEIEKSIADYGRRARDGQLKIDEMQGGTFTITNGGIYGSLMSTPILNAPQ 350

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           + IL +   +++ +    ++++  +M   LS DHR +DG  A   L + KE +E+P  ++
Sbjct: 351 AGILGMHKIQERPMAIAGKVEIRPMMYLALSYDHRVIDGKDAVTFLVRVKESLEDPARLV 410

Query: 423 M 423
           +
Sbjct: 411 L 411


>gi|209551251|ref|YP_002283168.1| dihydrolipoamide succinyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537007|gb|ACI56942.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 421

 Score =  303 bits (775), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 97/423 (22%), Positives = 178/423 (42%), Gaps = 5/423 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  +  W K+ GD I   + + E+ETDK  +E  +   G + EI+
Sbjct: 1   MATEIRVPTLGESVSEATVGTWFKKVGDAIKADEPILELETDKVTIEVPAPASGTLSEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V AG E + + + +  I   +         +           + + P  V    + +   
Sbjct: 61  VAAG-ETVGLGALLGQIAEGAVAAAAPAAAAPAAAPAQPAAAAPAQPAPVAAAAASSSSA 119

Query: 122 ASPLARR-LAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           +        A    +  S+LS     G   +  +          K  S   +      + 
Sbjct: 120 SVSTMPPAPAASKMLAESNLSADQVDGSGKRGQVLKGDVIAAVAKGISAPAAAPAAAPAA 179

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                 +      E +    +R+TIA RL+ ++ T        + ++  ++ LR +    
Sbjct: 180 ARGPSTVEDASREERVKMTRLRQTIAKRLKDAQNTAAMLTTYNEVDMKAVMDLRNKYKDI 239

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        K+       KA   A+ ++P  N       +I   +  + +AV    G+V
Sbjct: 240 FEKK---HGVKLGFMGFFTKAVTHALKELPAVNAEIDGTDVIYKNYCHVGMAVGTDKGLV 296

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            P+IR ADQ SI ++  E+ +LA+ A+   L   + QGGT +I+N G+ G      ++N 
Sbjct: 297 VPVIRDADQMSIAEVEKELGRLAKAARDGSLSMADMQGGTFTITNGGVYGSLMSSPILNA 356

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL +   +++ V    ++ +  +M   LS DHR VDG  A   L + KE +E+P  
Sbjct: 357 PQSGILGMHKIQERPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPER 416

Query: 421 MLM 423
           +++
Sbjct: 417 LVL 419


>gi|218529904|ref|YP_002420720.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Methylobacterium chloromethanicum
           CM4]
 gi|240138208|ref|YP_002962680.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Methylobacterium extorquens AM1]
 gi|22652789|gb|AAN03816.1|AF497852_2 dihydrolipoamide succinyltransferase [Methylobacterium extorquens
           AM1]
 gi|218522207|gb|ACK82792.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Methylobacterium chloromethanicum
           CM4]
 gi|240008177|gb|ACS39403.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Methylobacterium extorquens AM1]
          Length = 442

 Score =  303 bits (775), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 115/446 (25%), Positives = 198/446 (44%), Gaps = 30/446 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  + +W K+ GD ++  + L E+ETDK  +E  +   G + EIL
Sbjct: 1   MATDILVPTLGESVSEATIGRWFKKPGDTVAADEPLVELETDKVTLEVNAPAAGELGEIL 60

Query: 62  VPAGTENIAVNSPILNILMDST------------------------EIPPSPPLSKENIV 97
           V  G E +   + + +I+                            E       +KE+  
Sbjct: 61  VKDG-ETVEPGAVLGSIVEGGKGSGKSDAKPAPKSAEPAETKTQSREEKGESKPAKEDAP 119

Query: 98  EVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETL 157
                 S+ S         +    + P   +LA E GID +SL+GSG  GR+ K D+   
Sbjct: 120 AQESSASYGSHGDAPPTDGRPADDSGPAVAKLARESGIDPASLNGSGKDGRVTKGDMLAA 179

Query: 158 ISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIP 217
           I            +S          +  +  A++  E +    +R+TIA RL+ +++T  
Sbjct: 180 IDRNGQKAPAQEARSETKAPPPRAPSAPDDAARE--ERVRMTKLRQTIAKRLKSAQETAA 237

Query: 218 HFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWT 277
                 D ++  ++++R Q     +        K+       KA   A+  VP  N    
Sbjct: 238 MLTTFNDVDMGAVMAMRSQYKDIFEKK---HGTKLGFMGFFTKAVIGALKDVPAVNAEID 294

Query: 278 TNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQ 337
              ++   +  I +AV    G+V P++R AD  SI  I  ++    ++A++ KL  +E Q
Sbjct: 295 GQDLVYKNYYHIGIAVGTDKGLVVPVVRDADDLSIAGIEKKISGFGKKAREGKLSIDEMQ 354

Query: 338 GGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHR 397
           GGT +I+N G+ G      ++N PQS IL +   E++ V +N +I+   +M   LS DHR
Sbjct: 355 GGTFTITNGGIYGSLMSTPILNAPQSGILGMHRIEERPVVRNGKIEARPMMYLALSYDHR 414

Query: 398 SVDGAIASKLLAKFKEYIENPVWMLM 423
            VDG  A   L + KE +E+P  +++
Sbjct: 415 IVDGKEAVTFLVRVKEALEDPARLVL 440


>gi|326388155|ref|ZP_08209758.1| 2-oxoglutarate dehydrogenase E2 component [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326207321|gb|EGD58135.1| 2-oxoglutarate dehydrogenase E2 component [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 416

 Score =  303 bits (774), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 95/422 (22%), Positives = 179/422 (42%), Gaps = 8/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P+L  +++E  + +W+K+ G+ ++  + +  +ETDK  ++  +   GI+ ++L
Sbjct: 1   MSIEVKVPTLGESVSEATVGQWLKKPGEAVALDEPIASLETDKVAVDVPAPAAGILGQLL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  G + ++V + I  I    +    +P  +           + +         +     
Sbjct: 61  VQEG-DTVSVGALIALIEEAGSAAAAAPAAAPAPAPAATPAPAAAPVAAAPAAAAPAAEG 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                        ++     G  P           L              +      S  
Sbjct: 120 DVAALSPAVRRAVLEY----GIDPATVKGTGAGGRLTKEDVIAAAAQAKAAAPAAVASAP 175

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A         + E +    +R+TIA RL+ +++         D ++  +++ R++   + 
Sbjct: 176 AVAAVAAPGRNEERVKMTRLRQTIAKRLKGAQENAALLTTFNDVDMSAVMAARDKFKDSF 235

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA  LA+  +P  N     + ++ H ++DISVAVS P G+V 
Sbjct: 236 EKK---HGIKLGFMSFFAKAACLALKDIPAVNARIEGDEIVYHDYVDISVAVSAPNGLVV 292

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S   I   +    ++A++  L  ++ +GGT +ISN G+ G      +INPP
Sbjct: 293 PVVRDCDKLSFAGIEQAIAGYGKKAREGTLTMDDMKGGTFTISNGGVFGGLMSTPIINPP 352

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS +L +   E + V +N EI +  +M   LS DHR +DG  A   L   KE IE P  +
Sbjct: 353 QSAVLGLHRIEDRPVVRNGEIVIRPMMYIALSYDHRLIDGREAVTALKTIKEAIEEPTRL 412

Query: 422 LM 423
           L+
Sbjct: 413 LI 414


>gi|319787383|ref|YP_004146858.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Pseudoxanthomonas suwonensis 11-1]
 gi|317465895|gb|ADV27627.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Pseudoxanthomonas suwonensis 11-1]
          Length = 401

 Score =  303 bits (774), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 103/421 (24%), Positives = 177/421 (42%), Gaps = 23/421 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++++  +A W K+ GD +   + L ++ETDK ++E  S  +G++ EI 
Sbjct: 1   MATEVKVPVLPESVSDATIASWHKKAGDSVKRDENLVDLETDKVVLEVPSPVDGVLKEIK 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + +     +  I   +          K    +     + +         +     
Sbjct: 61  FSEG-DTVTSQQVLAIIEEGAVAEAAPAEEKKAEAPKAEAPKAEAPAKAAAPAPAARTGG 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A       A      + +    G   R   +  + L                     +  
Sbjct: 120 AELPPGARATAAREGVDASQVEGTGRRGAVTKEDILNY-------------------ART 160

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                       E +P   IRK IA RL QSK +I       + N+  + + R+Q+    
Sbjct: 161 GGAGKAGGARPEERVPMTRIRKRIAERLMQSKDSIAMLTSFNEVNLAKVSAARKQLGEDF 220

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           Q        K+      +KA A A+ + P  N S   + +I H + DIS+AVS   G+VT
Sbjct: 221 QKT---HGIKLGFMSFFVKAAANALQRFPIINASVDGDDIIYHGYSDISIAVSTDKGLVT 277

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  ++    DI   +   A++A+  KL  ++ QGGT +I+N G  G      ++NPP
Sbjct: 278 PVLRNVERMGFADIEQGIADYAKKARDGKLGLDDLQGGTFTITNGGTFGSLMSTPIVNPP 337

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ + +N ++ +A +M   LS DHR +DG  A + L   K  +ENP  M
Sbjct: 338 QSAILGMHTIKERPIAENGQVVIAPMMYIALSYDHRIIDGKDAVQFLVDIKNQLENPNRM 397

Query: 422 L 422
           L
Sbjct: 398 L 398


>gi|116328748|ref|YP_798468.1| bifunctional dihydrolipoyllysine-residue
           acetyltransferase/dihydrolipoyllysine-residue
           succinyltransferase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116331659|ref|YP_801377.1| bifunctional dihydrolipoyllysine-residue
           acetyltransferase/dihydrolipoyllysine-residue
           succinyltransferase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116121492|gb|ABJ79535.1| Bifunctional dihydrolipoyllysine-residue
           acetyltransferase/dihydrolipoyllysine-residue
           succinyltransferase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116125348|gb|ABJ76619.1| Bifunctional dihydrolipoyllysine-residue
           acetyltransferase/dihydrolipoyllysine-residue
           succinyltransferase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 413

 Score =  303 bits (774), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 110/422 (26%), Positives = 176/422 (41%), Gaps = 11/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P +  ++TE  +A W+K+EGD +   +IL E+ETDKA ME  +   G++ +I 
Sbjct: 1   MSVEIKVPEMGESITEATIANWVKKEGDAVKQDEILLELETDKATMEVPAPSSGVLQKIH 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             AG + + V   +  I   +T   P+P  S   I     + S +         +  + I
Sbjct: 61  KKAG-DTVKVKEVVGLIDSAATVSAPAPSSSSPAITTQTNQTSGNDRFNDTLPPAVRKLI 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A         ++       I       + +        S             
Sbjct: 120 DDNGLNVTAISGSGKNGQITKEDVLKAIESKTSAGVGTATAAKAASSPEI-------PKA 172

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
             +           +P   +RK IA RL  ++          + ++  ++ LR +     
Sbjct: 173 VPVAKRTDLPRENAVPMTRLRKVIAERLVSAQHNAAILTTFNEVDMSAVMELRNRYKDRF 232

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +      +  +       KA   A+  +P  N     N ++     DI VAV  P G+V 
Sbjct: 233 KEA---HNVGLGFMSFFTKAAIHALKTIPAINAEIRGNDVVYKNFYDIGVAVGGPKGLVV 289

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI+R AD  S   +  E+ +LA R K  K++  E +GGT +ISN G+ G      ++NPP
Sbjct: 290 PIVRDADLLSFAGVEQEIVRLANRVKDGKIELSEMEGGTFTISNGGIYGSMMSTPILNPP 349

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +    K+ V  N++I +  +M   LS DHR VDG  A   L K KE IE+P  +
Sbjct: 350 QSGILGLHNIVKRAVVVNDQIVIRPMMYLALSYDHRIVDGKEAVTFLVKVKEAIEDPARL 409

Query: 422 LM 423
           L+
Sbjct: 410 LL 411


>gi|254498640|ref|ZP_05111358.1| dihydrolipoamide succinyltransferase [Legionella drancourtii
           LLAP12]
 gi|254352088|gb|EET10905.1| dihydrolipoamide succinyltransferase [Legionella drancourtii
           LLAP12]
          Length = 398

 Score =  303 bits (774), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 115/422 (27%), Positives = 186/422 (44%), Gaps = 26/422 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++ +  +A W K+ GDK++  + L ++ETDK ++E  +  +G++ EIL
Sbjct: 1   MSIEVKVPVLPESVADATVAAWHKKVGDKVTRDENLLDLETDKVVLEVPAPADGVLSEIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + +     +  I   S  + P     K       ++   +SPVV R         
Sbjct: 61  FQVG-DTVTSGQLLAKITEGSAAVAPVAQEEKTADAVSAKDDKSTSPVVRRM-------- 111

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                     EH +    + GSG  GRI K D+ T I T                 +   
Sbjct: 112 --------MAEHDLQPGQIPGSGKEGRITKEDVLTYIETNREKTAKPADA------KKEQ 157

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A             +P   +R  IA RL +++          + N+  ++ +R Q     
Sbjct: 158 AAAPAAMGPREERRVPMTRLRAKIAERLLEAQHNAAMLTTFNEVNLKAVMDMRSQYKDHF 217

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   ++ + P  N S     ++ H   DI +AVS   G+V 
Sbjct: 218 EKK---HGVKLGFMSFFTKAVIESLKRFPAVNASIDGQDVVYHGFYDIGIAVSTERGLVV 274

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ S+ +I + +   A RA+Q KL  EE QGGT +I+N G+ G      +INPP
Sbjct: 275 PVIRDADQMSMAEIEMAINDAATRARQGKLSMEEMQGGTFTITNGGVFGSLLATPIINPP 334

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   E + V +  EI +  +M   LS DHR +DG  + + L   KE +E+P  +
Sbjct: 335 QTGILGMHKIEDRPVVEKGEIVIRPMMYVALSYDHRLIDGKDSVQFLVSVKELLEDPARL 394

Query: 422 LM 423
           L+
Sbjct: 395 LL 396


>gi|256822757|ref|YP_003146720.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Kangiella koreensis DSM 16069]
 gi|256796296|gb|ACV26952.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Kangiella koreensis DSM 16069]
          Length = 416

 Score =  303 bits (774), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 103/422 (24%), Positives = 178/422 (42%), Gaps = 8/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W  + G+ +S    L +IETDK ++E  + D+G+I EI+
Sbjct: 1   MAIEIKVPVLPESVADATIATWHVKPGESVSRDQNLVDIETDKVVLEVVAPDDGVISEII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + +     I      ++    +    ++     +E           +K   +   
Sbjct: 61  KEEG-DTVLQEEAIAKFEAGASGDAKADSSDEKKDDSSKESKKDDKEEAKSDKEEAS--- 116

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            S     L+      ++  +                              +     +   
Sbjct: 117 -SADLDVLSPAVRRLVAEHNLDPKQIPASGKGGRLTKEDVEKFIKDGGASAKSSESKKDS 175

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            +          + +P   +RK IA RL +++QT        D N+  ++ LR +     
Sbjct: 176 GSAPVSAGLREEKRVPMTRLRKRIAERLVEAQQTAAILTTFNDINMKEVVELRSRYKEQF 235

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + P  N S   + ++ H   DI VAVS P G+V 
Sbjct: 236 EK---VHGTRLGFMSFFVKATVEALKRYPAVNASIDGDDIVYHGFYDIGVAVSSPRGLVV 292

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD  S+ +I  ++++   +A+  KL  E+  GGT +ISN G+ G      +INPP
Sbjct: 293 PVLRDADTLSLAEIEAKIREFGVKARDNKLTVEDMTGGTFTISNGGVFGSLMATPIINPP 352

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   E + V  N EI +  +MN  LS DHR +DG  +   L   KE+IE+P  M
Sbjct: 353 QSAILGMNRMEDRPVVINGEIVIRPMMNVALSYDHRIIDGRESVGFLKTIKEFIEDPARM 412

Query: 422 LM 423
           L+
Sbjct: 413 LL 414


>gi|300024730|ref|YP_003757341.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526551|gb|ADJ25020.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 444

 Score =  303 bits (774), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 113/446 (25%), Positives = 200/446 (44%), Gaps = 28/446 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW KQ GD ++  + L E+ETDK  +E  +   G++ +IL
Sbjct: 1   MSIEIRVPALGESVTEATVGKWFKQTGDAVNVDEPLVELETDKVTVEVPAPAAGVLGDIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLS------KENIVEVREEHSHSSPVVVREKH 115
           V +GT  +AV S +  +   + +       +      K +    + +  H +        
Sbjct: 61  VKSGT-TVAVGSLLAALKDGAAKSSAGNSQTTAPQAAKPSAPPSQPKPEHVAAKAPESAP 119

Query: 116 SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGL 175
           + + P   P A +   E G++ S + G+G  G+I+K D+   ++        S       
Sbjct: 120 AADAPRPPPAALKALTEAGLEPSDVRGTGRRGQILKEDVINAVAATAAKPAASPPPLREP 179

Query: 176 VDESIDAN------------------ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIP 217
               +  N                            E +    +R+TIA RL++++    
Sbjct: 180 TAAPVSPNAVTIQEAPATIVMRDVRLPSPANDATREERVRMSKLRQTIARRLKEAQNAAA 239

Query: 218 HFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWT 277
                 D ++  +++LR Q     +        K+    + +KA   A+  VP  N    
Sbjct: 240 MLTTFNDVDMSAIMALRAQYKDVFEKR---HGVKLGFMGLFVKAAIQALRDVPSVNAEID 296

Query: 278 TNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQ 337
            + ++   +  I VAV    G+V P++R+AD+ S+ +I  ++ +  +RA+  KL  E+ Q
Sbjct: 297 HDEIVYKNYYHIGVAVGTEKGLVVPVVREADRLSLAEIEQKITEFGKRARDGKLSIEDMQ 356

Query: 338 GGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHR 397
           GGT +ISN G+ G      ++N PQS IL +   E++ V +N +I    +M   LS DHR
Sbjct: 357 GGTFTISNGGVYGSLMSTPILNAPQSGILGMHRIEERPVVRNGQIVARPMMYLALSYDHR 416

Query: 398 SVDGAIASKLLAKFKEYIENPVWMLM 423
            VDG  A   L + KE +E+P   ++
Sbjct: 417 IVDGKEAVTFLVRIKECLEDPQRFIL 442


>gi|209883735|ref|YP_002287592.1| dihydrolipoyllysine-residue succinyltransferase [Oligotropha
           carboxidovorans OM5]
 gi|209871931|gb|ACI91727.1| dihydrolipoyllysine-residue succinyltransferase [Oligotropha
           carboxidovorans OM5]
          Length = 413

 Score =  303 bits (774), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 98/422 (23%), Positives = 187/422 (44%), Gaps = 11/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + +W K+ GD ++  + L E+ETDK  +E  S   G + EI+
Sbjct: 1   MA-EIRVPTLGESVTEATIGRWFKKTGDAVAVDEPLVELETDKVTIEVPSPSAGTLGEIV 59

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  G E +AV + +  I  +    P +   ++    +     + ++P   ++    + P 
Sbjct: 60  VKDG-ETVAVGALLGQI-TEGAAKPAAAKPAEAAPAKPAAAAAAAAPAPSQKSPPADAPQ 117

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A  + +  A       +               +  +     +    +   +   V     
Sbjct: 118 APSVRKLSAESGIDAGTVAGSGKDGRVTKGDMLAAIEKAAASPTPINQPAASLQVRAPSP 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            +          E +    +R+TIA RL+  + T        + ++ N+++LR Q     
Sbjct: 178 PDDAA-----REERVRMTRLRQTIARRLKDVQNTAAMLTTFNEVDMSNVMALRGQYKEMF 232

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+      +KA   A+ ++P  N       ++   +  + VAV    G+V 
Sbjct: 233 EKKHH---AKLGFMGFFVKACVQALKEIPAVNAEIDGTDIVYKNYYHVGVAVGTDKGLVV 289

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+KSI +I   +  L +RA+  +LK +E QGGT +++N G+ G      ++N P
Sbjct: 290 PVVRDCDRKSIAEIETTIADLGKRARDGQLKIDEMQGGTFTLTNGGIYGSLMSTPILNAP 349

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ V    +++V  +M   LS DHR +DG  A   L + KE +E+P  +
Sbjct: 350 QSAILGMHKIQERPVAIGGKVEVRPMMYLALSYDHRVIDGKEAVTFLVRVKENLEDPARL 409

Query: 422 LM 423
           ++
Sbjct: 410 VL 411


>gi|58581666|ref|YP_200682.1| dihydrolipoamide succinyltransferase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84623581|ref|YP_450953.1| dihydrolipoamide acetyltransferase [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|188577096|ref|YP_001914025.1| dihydrolipoamide succinyltransferase [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|58426260|gb|AAW75297.1| dihydrolipoamide S-succinyltransferase [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|84367521|dbj|BAE68679.1| dihydrolipoamide S-succinyltransferase [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|188521548|gb|ACD59493.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 400

 Score =  302 bits (773), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 111/422 (26%), Positives = 191/422 (45%), Gaps = 26/422 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++++  +A W K+ G+ +   + L ++ETDK ++E  S  +G++ EI 
Sbjct: 1   MATEVKVPVLPESVSDATIASWHKKPGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             AG+  +  N  +  I   +          K          +  +        SK+   
Sbjct: 61  FEAGS-TVTSNQILAIIEEGAVAAAAPADEKKAAAPAAAAPAAAPAAAAAPAPASKSAAD 119

Query: 122 A-SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           +  P AR  A   G+D S + G+G  G + K DI                        + 
Sbjct: 120 SLPPGARFSAITQGVDPSQVEGTGRRGAVTKEDIVNF---------------------AK 158

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
              +         E +P   +RKTIA RL +SK +        + N+  + + R+++   
Sbjct: 159 AGGVGKASGARPEERVPMTRVRKTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKELQDE 218

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            Q        K+      +KA A A+ + P  N S   + +I H + DIS+AVS   G+V
Sbjct: 219 FQKA---HGIKLGFMSFFVKAAANALQRFPLVNASIDGDDIIYHGYSDISIAVSTDKGLV 275

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  +++S  D+   +   A +A+  KL  ++ QGGT +I+N G  G      +INP
Sbjct: 276 TPVLRNVERQSFADVEQGIADYAAKARAGKLGLDDLQGGTFTITNGGTFGSLLSTPIINP 335

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL +   +++ + +N ++ +A +M   LS DHR +DG  + + L   K  +ENP  
Sbjct: 336 PQSAILGMHTIKERPIAENGQVVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGR 395

Query: 421 ML 422
           ML
Sbjct: 396 ML 397


>gi|298293255|ref|YP_003695194.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Starkeya novella DSM 506]
 gi|296929766|gb|ADH90575.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Starkeya novella DSM 506]
          Length = 417

 Score =  302 bits (773), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 100/422 (23%), Positives = 178/422 (42%), Gaps = 7/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ ++  + + E+ETDK  +E  +   G++ EI+
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKAGEAVAADEPIVELETDKVTIEVPAPAAGVLSEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E + V + + +I   S     +P  +         +     P       +     
Sbjct: 61  AKDG-ETVGVGALLGSIGEGSGAAKAAPAAAPAPAKAEAPKAEAPKPAAAPVPAAPAAAP 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A      +A        + +     G+  +     +++                V     
Sbjct: 120 AGANGPAVAKLASESGINPAMLAGTGKDARVTKGDMLAAIATGVSAPAAAPSAPVVARAP 179

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           +   +   +   E +    +R TIA RL++++          D ++  ++SLR Q     
Sbjct: 180 SAPDDASRE---ERVKMTKLRVTIARRLKEAQNAAAMLTTFNDVDMSAVMSLRAQYKDVF 236

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+  VPE N       ++   +  I +AV    G+V 
Sbjct: 237 EKK---HGVKLGFMGFFTKAVIQALKDVPEVNAEIDGQDLVYKNYYHIGIAVGTDKGLVV 293

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ SI +I   +  L ++A+  KL  E+ QGGT +I+N G+ G      ++N P
Sbjct: 294 PVVRDADQMSIAEIEKTIAGLGRKARDGKLGIEDMQGGTFTITNGGIYGSLMSTPILNAP 353

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   E++ V    +I    +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 354 QSGILGMHRIEERPVVVKGQIVARPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPTRL 413

Query: 422 LM 423
           ++
Sbjct: 414 VL 415


>gi|157827552|ref|YP_001496616.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           bellii OSU 85-389]
 gi|157802856|gb|ABV79579.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           bellii OSU 85-389]
          Length = 418

 Score =  302 bits (773), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 174/422 (41%), Positives = 267/422 (63%), Gaps = 7/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + MP+LSPTMTEG LA+W+K+EGDKI+PG+++ EIETDKA ME E+VDEG + +I+
Sbjct: 1   MPIKLLMPALSPTMTEGNLARWLKKEGDKINPGEVIAEIETDKATMEVEAVDEGTLAKII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +P G++N+ VNS I  ++ +  E        +E I +          +    +    + +
Sbjct: 61  IPQGSQNVPVNSLIAVLIEEGEE----LSGIEEFIAKNNSNSPKKEEISKPAETIAPQNV 116

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   + ++ I + +   +    +I    IE +  +  + +                
Sbjct: 117 KEENITTASDQNNIKVFASPLAKRLAKIQNVRIEEIKGSGPHGRIIKQDVLSHKGGSKAL 176

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           +N +     + Y + P++NIRK IA RL +SKQT+PHFY+SI+CN+D LL +RE +N++ 
Sbjct: 177 SNKIVSRNPEEYRLAPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKSF 236

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
               ++ S KISVND I+ A A A+ +VP AN SW  +A+  + ++DISVAV+I  G+VT
Sbjct: 237 ---GDDKSAKISVNDFIILAVAKALQEVPNANASWGDDAIRYYNNVDISVAVAIENGLVT 293

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PIIR ADQK+I+D+S E+K L ++A++ KL  EE+QGG  +ISN+GM GI +F A+INPP
Sbjct: 294 PIIRNADQKNIVDLSSEMKGLIKKARENKLTSEEFQGGGFTISNLGMYGIKNFNAIINPP 353

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS I+ +G+  K+ + +N++I +ATIM+ TLSADHR VDGA+ ++ LA FK +IE+P  M
Sbjct: 354 QSCIMGVGSSSKRAIVKNDQISIATIMDVTLSADHRVVDGAVGAEFLAAFKRFIESPALM 413

Query: 422 LM 423
           L+
Sbjct: 414 LL 415


>gi|163851074|ref|YP_001639117.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Methylobacterium extorquens PA1]
 gi|163662679|gb|ABY30046.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Methylobacterium extorquens PA1]
          Length = 442

 Score =  302 bits (773), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 103/444 (23%), Positives = 184/444 (41%), Gaps = 26/444 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  + +W K+ GD ++  + L E+ETDK  +E  +   G + EIL
Sbjct: 1   MATDILVPTLGESVSEATIGRWFKKPGDTVAADEPLVELETDKVTLEVNAPAAGELGEIL 60

Query: 62  VPAGTENIAVNSPILNILMDS-------TEIPPSPPLSKENIVEVREEHSHSSPVVVREK 114
           V  G E +   + + +I+           +  P      E+  + REE   S P      
Sbjct: 61  VKDG-ETVEPGAVLGSIVEGGKGSGKSDAKPAPKSAEPAESRTQSREEKGESKPAKDDAP 119

Query: 115 HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFG 174
             ++             +      S        R    D  +L  +  + +         
Sbjct: 120 AQESSASYGSHGDAPPTDGRPADDSGPAVAKLARESGIDPASLNGSGKDGRVTKGDMLAA 179

Query: 175 LVDESIDANILNLFAK---------------DSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
           +      A      ++                  E +    +R+TIA RL+ +++T    
Sbjct: 180 IDRNGQKAPAQEARSETKAPPPRAPSAPDDAAREERVRMTKLRQTIAKRLKSAQETAAML 239

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN 279
               D ++  ++++R Q     +        K+       KA   A+  VP  N      
Sbjct: 240 TTFNDVDMGAVMAMRSQYKDIFEKK---HGTKLGFMGFFTKAVIGALKDVPAVNAEIDGQ 296

Query: 280 AMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
            ++   +  I +AV    G+V P++R AD  SI  I  ++    ++A++ KL  +E QGG
Sbjct: 297 DLVYKNYYHIGIAVGTDKGLVVPVVRDADDLSIAGIEKKISGFGKKAREGKLSIDEMQGG 356

Query: 340 TTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSV 399
           T +I+N G+ G      ++N PQS IL +   E++ V +N +I+   +M   LS DHR V
Sbjct: 357 TFTITNGGIYGSLMSTPILNAPQSGILGMHRIEERPVVRNGKIEARPMMYLALSYDHRIV 416

Query: 400 DGAIASKLLAKFKEYIENPVWMLM 423
           DG  A   L + KE +E+P  +++
Sbjct: 417 DGKEAVTFLVRVKEALEDPARLVL 440


>gi|114327849|ref|YP_745006.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316023|gb|ABI62083.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex [Granulibacter bethesdensis
           CGDNIH1]
          Length = 416

 Score =  302 bits (772), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 170/422 (40%), Positives = 257/422 (60%), Gaps = 6/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M  TI MP+LSPTMTEG LA+W+K+EGD I+ GD++ EIETDKA ME E+VDEG++  IL
Sbjct: 1   MATTILMPALSPTMTEGTLARWLKKEGDTITAGDVIAEIETDKATMEVEAVDEGVLGRIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           VP GTE +AVN+PI  ++ +   IP    +              S P  +  K   +   
Sbjct: 61  VPDGTEGVAVNAPIAILVEEGEAIPDQGDIPAPAKASAIPAAESSVPAKLEPKAIASSGP 120

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                R  A      ++  +G              ++         +  +       +  
Sbjct: 121 DRTENRIFASPLARRIAKEAGIDLTSLTGSGPSGRILRADVEKAKGTGGK------PASA 174

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           +         +++++PH  +R+TIA RL ++KQTIPHFYV++D  +D LL LR  +N   
Sbjct: 175 STAAPAATGATHKLVPHSGMRRTIARRLTEAKQTIPHFYVTMDVALDALLKLRADLNARS 234

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
               +E + K+SVND+I+KA  LA+ +VP  N +W+ + ++  + +DISVAVSIP G++T
Sbjct: 235 PAEGQEGAFKLSVNDLIIKAAGLALRRVPGVNAAWSEDGILLFEDVDISVAVSIPDGLIT 294

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PIIRQAD+K ++ IS E+K+LA RA++  L+P +YQGG  SISN+GM G+  F A+INPP
Sbjct: 295 PIIRQADRKGVVSISTEMKELAARARKGGLQPSDYQGGGFSISNLGMYGVRDFAAIINPP 354

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ ILA+GAGE++ V ++  + VAT+M+ TLS DHR VDGA+ ++ L  F++ +E+P+ +
Sbjct: 355 QAAILAVGAGEQRPVVRDGALAVATVMSCTLSVDHRVVDGALGAQWLGAFRQIVEDPLSL 414

Query: 422 LM 423
           L+
Sbjct: 415 LL 416


>gi|257464762|ref|ZP_05629133.1| dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex (E2)
           [Actinobacillus minor 202]
 gi|257450422|gb|EEV24465.1| dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex (E2)
           [Actinobacillus minor 202]
          Length = 409

 Score =  302 bits (772), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 111/422 (26%), Positives = 200/422 (47%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I  P L  ++ +  +A W K+ GD +   ++L E+ETDK ++E  S  +GI+ EIL
Sbjct: 1   MTTEILTPVLPESVADATVATWHKKAGDSVKRDEVLVEVETDKVVLEVPSPVDGILSEIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             +G+  +  +  +  I         +    +       E           E    +   
Sbjct: 61  QESGS-TVVSSQVLGKIST-----TQAGDFIQNVATNSVEATPADRKTSAIEHDHSDADS 114

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
             P  RRL  EHGI+ + + G+G  GR+ + DI   ++ +   +  S + +      ++ 
Sbjct: 115 QGPAIRRLLAEHGIEANQVQGTGVGGRLTREDINAYLAKREAQQAKSAMATEQNTVSTVA 174

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            +        S + +P   +RK IA RL ++K +        + ++  +++LR+      
Sbjct: 175 YSS------RSEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMQPIMTLRKTYGEKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---HGVRLGFMSFYIKAVVEALKRYPEINASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR  D+ S+ +I   +K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVIRNCDKLSMAEIEKTIKTLAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A + + V  + ++ +  +M   LS DHR +DG  +   L   K+ +E+P  +
Sbjct: 346 QSAILGMHAIKDRPVAVDGQVVIRPMMYLALSYDHRLIDGRESVGFLVAVKDLLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|260169349|ref|ZP_05756160.1| dihydrolipoamide succinyltransferase [Brucella sp. F5/99]
 gi|261758865|ref|ZP_06002574.1| dihydrolipoamide acetyltransferase [Brucella sp. F5/99]
 gi|261738849|gb|EEY26845.1| dihydrolipoamide acetyltransferase [Brucella sp. F5/99]
          Length = 408

 Score =  302 bits (772), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 94/422 (22%), Positives = 171/422 (40%), Gaps = 16/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ I+  + L E+ETDK  +E  +   G++ EI 
Sbjct: 1   MATEIRVPTLGESVTEVTIGKWFKKAGEAIAVDEPLVELETDKVTVEVAAPAAGVLAEIT 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + +  I  D   +  +P   KE         + +               
Sbjct: 61  AKEG-DTVEVGALLGQISSDGAAVAAAPAQKKEEAKPAAAAPAAAPVASA---------- 109

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                  +                  ++  S     +     +   +   S         
Sbjct: 110 --SSGPAMQPAPAAAKLLAESGLSADQVEGSGKRGQVLKGDVLDAITKGVSAAPAAPVAA 167

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
               +       E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 168 RPASSADDASREERVKMTRLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMELRNKYKDVF 227

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++      + +AV    G+V 
Sbjct: 228 EKK---HGVKLGFMGFFTKAVTHALKEIPAVNAEIDGTDIVYKNFCHVGMAVGTDKGLVV 284

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI ++  E+ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 285 PVIRDADQMSIAEVEKELARLARAARDGSLSMADMQGGTFTITNGGVYGSLMSTPILNAP 344

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +    +I V  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 345 QSGILGMHKIQERPMVVGGQIVVRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 404

Query: 422 LM 423
           ++
Sbjct: 405 VL 406


>gi|1814069|gb|AAC45482.1| dihydrolipoamide transsuccinylase [Rhodobacter capsulatus]
          Length = 412

 Score =  302 bits (772), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 100/421 (23%), Positives = 176/421 (41%), Gaps = 11/421 (2%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  + +P+L  ++ E  ++ W K+ GD ++  +ILCE+ETDK  +E  +   G++ EIL 
Sbjct: 1   MTDVMVPALGESVAEATVSTWFKKPGDAVAQDEILCELETDKVSVEVPAPAAGVLSEILA 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
           P G  ++A    +  +   S  + P    +                    +K      + 
Sbjct: 61  PEGA-SVAAGGRLAILAAGSARLQPPAAAAAAPAPAPAAPAKDVEHAPAAKKAMAEAGLT 119

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
                    +  I    ++ +        +           V              ++  
Sbjct: 120 PDQVTGTGRDGRIMKEDVAAAAAAPAAAPAPAAPAPVATAQVSIAPPP-------ATVPR 172

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
             +        E +    +R TIA RL+ ++ T        + ++  ++ LR       +
Sbjct: 173 APVPAEDAAREERVKMTRLRATIARRLKDAQNTAAMLTTYNEVDMSGVMDLRNVYKDQFE 232

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                   K+      +KA   A+ ++PE N       +I   ++ + VAV  P G+V P
Sbjct: 233 KK---HGVKLGFMGFFVKACCHALKEIPEVNAEIDGGDIIYKNYVHMGVAVGTPSGLVVP 289

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R ADQK    I  E+ +L +R +  KL  +E QGG+ +ISN G+ G      ++NPPQ
Sbjct: 290 VVRDADQKGFAHIEREIAELGKRGRDGKLTMQEMQGGSFTISNGGVYGSLMSSPILNPPQ 349

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL +   + + V  N +I +  +M   LS DHR VDG  A   L + KE +E+P  +L
Sbjct: 350 SGILGMHKIQDRPVVVNGQIVIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRLL 409

Query: 423 M 423
           M
Sbjct: 410 M 410


>gi|165933281|ref|YP_001650070.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           rickettsii str. Iowa]
 gi|165908368|gb|ABY72664.1| dihydrolipoamide acetyltransferase component of pyruvate
           dehydrogenase complex [Rickettsia rickettsii str. Iowa]
          Length = 412

 Score =  302 bits (772), Expect = 9e-80,   Method: Composition-based stats.
 Identities = 175/422 (41%), Positives = 262/422 (62%), Gaps = 10/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEG LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I+
Sbjct: 1   MPIKILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +P  ++N+ VNS I  +  +  E         +N        + ++ +   E  +     
Sbjct: 61  IPQNSQNVPVNSLIAVLSEEGEEKTDIDAFIAKNNSVSPSPKTDANLLKPHENITNVEEQ 120

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            + +    +      L+       + R                   S          S  
Sbjct: 121 VTVIKHDASKIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQDILS-------YTPSTA 173

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            N +     + Y ++P++NIRK IA RL +SKQT+PHFY+SI+CN+D LL +RE +N++ 
Sbjct: 174 HNKIVSRNPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKSF 233

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
               E+ S +ISVND I+ A A A+ +VP AN SW  +A+  + ++DISVAV+I  G+VT
Sbjct: 234 ---SEDKSTRISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISVAVAIENGLVT 290

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI++ A+QK+IL++S E+K L ++AK  KL PEE+QGG  +ISN+GM GI +F A+INPP
Sbjct: 291 PIVKNANQKNILELSREMKALIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPP 350

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS I+ +GA  K+ + +N++I +ATIM+ TLSADHR VDGA+ ++ LA FK++IE+PV M
Sbjct: 351 QSCIMGVGAIAKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLAAFKKFIESPVLM 410

Query: 422 LM 423
           L+
Sbjct: 411 LI 412


>gi|16273548|ref|NP_439803.1| 2-oxoglutarate dehydrogenase E2 component dihydrolipoamide
           succinyltransferase [Haemophilus influenzae Rd KW20]
 gi|260581256|ref|ZP_05849074.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Haemophilus influenzae RdAW]
 gi|1171887|sp|P45302|ODO2_HAEIN RecName: Full=Dihydrolipoyllysine-residue succinyltransferase
           component of 2-oxoglutarate dehydrogenase complex;
           AltName: Full=2-oxoglutarate dehydrogenase complex
           component E2; Short=OGDC-E2; AltName:
           Full=Dihydrolipoamide succinyltransferase component of
           2-oxoglutarate dehydrogenase complex
 gi|1574511|gb|AAC23307.1| 2-oxoglutarate dehydrogenase E2 component, dihydrolipoamide
           succinyltransferase(sucB) [Haemophilus influenzae Rd
           KW20]
 gi|260092083|gb|EEW76028.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Haemophilus influenzae RdAW]
          Length = 409

 Score =  302 bits (772), Expect = 9e-80,   Method: Composition-based stats.
 Identities = 102/422 (24%), Positives = 188/422 (44%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD +   +++ EIETDK ++E  ++ +G++ E++
Sbjct: 1   MAIEILVPDLPESVADATVATWHKKLGDTVKRDEVIVEIETDKVVLEVPALSDGVLAEVV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +     +  I         S  L   N     +  + +          ++  I
Sbjct: 61  QAEG-ETVVSKQLLGKISTAQEGDVSSATLKATNEPTPSDRQNAAIENSHNHNADQSPVI 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              LA        I  S + G      I +   +                   +   +  
Sbjct: 120 RRLLAEHDLQADQIQGSGVGGRLTREDIEREIAKRQAQQVKQEAATEQNTISTVAYSA-- 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                     S + +P   +RK IA RL ++K +        + ++  +++LR+      
Sbjct: 178 ---------RSEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMQPIMTLRKTYGEKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +      S ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---HSVRLGFMSFYIKAVVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ +I  ++K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVLRDCDKLSMAEIEKQIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +  N ++ +  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 346 QSAILGMHAIKERPIALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|332969914|gb|EGK08916.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Desmospora sp. 8437]
          Length = 424

 Score =  301 bits (771), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 117/426 (27%), Positives = 201/426 (47%), Gaps = 9/426 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M +   +P +   + EG++ K+  QEGD +   D+L E++TDKA++E      G + ++ 
Sbjct: 1   MAYEFKLPDVGEGIHEGEIVKFHVQEGDTVKEDDVLAEVQTDKAVVEIPVPVNGTVTKLN 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E + V S +             P    E       E + ++    R    K+   
Sbjct: 61  AKEG-EILEVGSVLAVFDTGDGVAAEQPESQPEEKAAPPAESATTAAKPARSGDGKSGKQ 119

Query: 122 --ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDES 179
             A P  R+ A E GID++ + G+G +GR+  +D+E   S      +     +    +++
Sbjct: 120 VLAMPSVRKKARELGIDITQVEGTGKNGRVTFADLEAFQSGGAKPTEEPAAVAAPQAEQA 179

Query: 180 IDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
            +     +  +   E IP   +R+TIA R+ QS  T PH  V  + +   L+ +R+    
Sbjct: 180 EEKKAAPVSREGDEERIPLRGMRRTIAKRMAQSMYTAPHVTVMDEVDASELIEMRKWAKP 239

Query: 240 TLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH--KHIDISVAVSIPG 297
             +        K++    I+KA   A+ + P  N S           K+  + +A +   
Sbjct: 240 MAEQRE----IKLTYLPFIIKALTAALREFPYLNASLDEENEQIIIKKYYHMGIATATED 295

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G+V P+IR  D+KSI  ++ E+K +  R + RK   EE +G T +I+N+G  G   F  +
Sbjct: 296 GLVVPVIRDVDRKSIFQLAGEIKDVTTRTRDRKAGVEELKGSTFTITNIGSFGGQFFTPI 355

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           IN P+  I  +G    + V  + E+ V  IMN +LS DHR +DG +A++ L + KE +EN
Sbjct: 356 INYPEVAIFGMGKMADRPVAVDGEVVVRPIMNVSLSIDHRLIDGDVAARFLNRVKELLEN 415

Query: 418 PVWMLM 423
           P  ++M
Sbjct: 416 PKLLMM 421


>gi|157828567|ref|YP_001494809.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|157801048|gb|ABV76301.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           rickettsii str. 'Sheila Smith']
          Length = 412

 Score =  301 bits (771), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 175/422 (41%), Positives = 262/422 (62%), Gaps = 10/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEG LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I+
Sbjct: 1   MPIKILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +P  ++N+ VNS I  +  +  E         +N        + ++ +   E  +     
Sbjct: 61  IPQNSQNVPVNSLIAVLSEEGEEKTDIDAFIAKNNSVSPSPKTDANLLKPHESITNVEEQ 120

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            + +    +      L+       + R                   S          S  
Sbjct: 121 VTVIKHDASKIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQDILS-------YTPSTA 173

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            N +     + Y ++P++NIRK IA RL +SKQT+PHFY+SI+CN+D LL +RE +N++ 
Sbjct: 174 HNKIVSRNPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKSF 233

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
               E+ S +ISVND I+ A A A+ +VP AN SW  +A+  + ++DISVAV+I  G+VT
Sbjct: 234 ---SEDKSTRISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISVAVAIENGLVT 290

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI++ A+QK+IL++S E+K L ++AK  KL PEE+QGG  +ISN+GM GI +F A+INPP
Sbjct: 291 PIVKNANQKNILELSREMKALIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPP 350

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS I+ +GA  K+ + +N++I +ATIM+ TLSADHR VDGA+ ++ LA FK++IE+PV M
Sbjct: 351 QSCIMGVGAIAKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLAAFKKFIESPVLM 410

Query: 422 LM 423
           L+
Sbjct: 411 LI 412


>gi|145637689|ref|ZP_01793342.1| 2-oxoglutarate dehydrogenase E2 component dihydrolipoamide
           succinyltransferase [Haemophilus influenzae PittHH]
 gi|145269091|gb|EDK09041.1| 2-oxoglutarate dehydrogenase E2 component dihydrolipoamide
           succinyltransferase [Haemophilus influenzae PittHH]
          Length = 409

 Score =  301 bits (771), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 102/422 (24%), Positives = 188/422 (44%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD +   +++ EIETDK ++E  ++ +G++ E++
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKLGDTVKRDEVIVEIETDKVVLEVPALSDGVLAEVV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +     +  I         S  L   N     +  + +          ++  I
Sbjct: 61  QAEG-ETVVSKQLLGKISTAQEGDVSSATLKATNEPTPSDRQNAAIENSHNHNADQSPAI 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              LA        I  S + G      I +   +                   +   +  
Sbjct: 120 RRLLAEHDLQADQIQGSGVGGRLTREDIEREIAKRQAQQLKQEAATEQNTISTVAYSA-- 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                     S + +P   +RK IA RL ++K +        + ++  +++LR+      
Sbjct: 178 ---------RSEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMQPIMTLRKTYGEKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +      S ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---HSVRLGFMSFYIKAVVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ +I  ++K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVLRDCDKLSMAEIEKQIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +  N ++ +  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 346 QSAILGMHAIKERPIALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|270157992|ref|ZP_06186649.1| dihydrolipoyllysine-residue succinyltransferase E2 component
           [Legionella longbeachae D-4968]
 gi|289163742|ref|YP_003453880.1| dihydrolipoamide succinyltransferase, E2 subunit [Legionella
           longbeachae NSW150]
 gi|269990017|gb|EEZ96271.1| dihydrolipoyllysine-residue succinyltransferase E2 component
           [Legionella longbeachae D-4968]
 gi|288856915|emb|CBJ10729.1| dihydrolipoamide succinyltransferase, E2 subunit [Legionella
           longbeachae NSW150]
          Length = 409

 Score =  301 bits (771), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 102/422 (24%), Positives = 182/422 (43%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++ +  +A W K+ GDK+S  + L ++ETDK ++E  +  +GI+ EI+
Sbjct: 1   MSIEVKVPVLPESVADATIAAWHKKVGDKVSRDENLLDLETDKVVLEVPAPVDGILSEIM 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + +     +  I       P     +     +  E+   +   V  ++     P+
Sbjct: 61  FQEG-DTVHSGQLLAKIKEGDAAEPKEEKKAGSKEEKKAEQADSTKENVSAKEDKSTSPV 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              +      + G    S          V + IE+     +   +    Q+  +      
Sbjct: 120 VRRMMAEHDLQPGQIQGSGKDGRITKEDVLAYIESSREKSSKPAESPKEQTTQVQMGV-- 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                         +P   +R  IA RL  ++          + N+  ++ +R Q   + 
Sbjct: 178 ---------REERRVPMTRLRAKIAERLLAAQHNAAMLTTFNEVNLKAVMDMRAQYKDSF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   ++ + P  N S     ++ H   DI +AVS   G+V 
Sbjct: 229 EKK---HGVKLGFMSFFTKAVVESLKRFPAVNASIDGQDVVYHGFYDIGIAVSTDRGLVV 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ S+ +I L +   A +A+Q KL  E+ QGGT +I+N G+ G      +INPP
Sbjct: 286 PVIRDADQMSMANIELAINDAATKARQGKLAMEDMQGGTFTITNGGVFGSLLATPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   E++ V +  +I +  +M   LS DHR +DG  + + L   KE +E+P  +
Sbjct: 346 QTGILGMHKIEERPVVEKGQIVIRPMMYVALSYDHRLIDGKDSVQFLVSVKELLEDPARL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|319896900|ref|YP_004135095.1| dihydrolipoyltranssuccinase [Haemophilus influenzae F3031]
 gi|317432404|emb|CBY80759.1| dihydrolipoyltranssuccinase [Haemophilus influenzae F3031]
          Length = 409

 Score =  301 bits (771), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 102/422 (24%), Positives = 188/422 (44%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD +   +++ EIETDK ++E  ++ +G++ E++
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKLGDTVKRDEVIVEIETDKVVLEVPALSDGVLAEVV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +     +  I         S  L   N     +  + +          ++  I
Sbjct: 61  QAEG-ETVVSKQLLGKISTAQEGDVSSATLKATNEPTPSDRQNAAIENSHNHNADQSPAI 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              LA        I  S + G      I +   +                   +   +  
Sbjct: 120 RRLLAEHDLQADQIQGSGVGGRLTREDIEREIAKRQAQQVKQEAATEQNTISTVAYSA-- 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                     S + +P   +RK IA RL ++K +        + ++  +++LR+      
Sbjct: 178 ---------RSEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMQPIMTLRKTYGDKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +      S ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---HSVRLGFMSFYIKAVVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ +I  ++K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVLRDCDKLSMAEIEKQIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +  N ++ +  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 346 QSAILGMHAIKERPIALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|229586781|ref|YP_002845282.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           africae ESF-5]
 gi|228021831|gb|ACP53539.1| Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rickettsia africae ESF-5]
          Length = 412

 Score =  301 bits (771), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 176/422 (41%), Positives = 261/422 (61%), Gaps = 10/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEG LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I+
Sbjct: 1   MPIKILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +P  ++N+ VNS I  +  +  E         +N        + ++     E  +     
Sbjct: 61  IPQNSQNVPVNSLIAVLSEEGEEKTDIDAFIAKNNSVSPSPKTDANLPKPHENIANVEEQ 120

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            + +    +      L+       + R                   S          S  
Sbjct: 121 VTVIKHDASKIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQDILS-------YTPSTA 173

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            N +     + Y ++P++NIRK IA RL +SKQT+PHFY+SI+CN+D LL +RE +N   
Sbjct: 174 HNKIVSRNPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDIN--- 230

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +F  E+ S +ISVND I+ A A A+ +VP AN SW  +A+  + ++DISVAV+I  G+VT
Sbjct: 231 KFFSEDKSTRISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISVAVAIENGLVT 290

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI++ A+QK+IL++S E+K L ++AK  KL PEE+QGG  +ISN+GM GI +F A+INPP
Sbjct: 291 PIVKNANQKNILELSREMKALIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPP 350

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS I+ +GA  K+ + +N++I +ATIM+ TLSADHR VDGA+ ++ LA FK++IE+PV M
Sbjct: 351 QSCIMGVGASAKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLAAFKKFIESPVLM 410

Query: 422 LM 423
           L+
Sbjct: 411 LI 412


>gi|34580402|ref|ZP_00141882.1| dihydrolipoamide acetyltransferase component [Rickettsia sibirica
           246]
 gi|28261787|gb|EAA25291.1| dihydrolipoamide acetyltransferase component [Rickettsia sibirica
           246]
          Length = 412

 Score =  301 bits (771), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 176/422 (41%), Positives = 263/422 (62%), Gaps = 10/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEG LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I+
Sbjct: 1   MPIKILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +P  ++N+ VNS I  +  +  E         +N        + ++ +  +E  +     
Sbjct: 61  IPQNSQNVPVNSLIAVLSEEGEEKTDIDAFIAKNNSVSPSPKTDANLLKPQENIANVEEQ 120

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            + +    +      L+       + R                   S          S  
Sbjct: 121 VTVIKHDASKIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQDILS-------YTPSTA 173

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            N +     + Y ++P++NIRK IA RL +SKQT+PHFY+SI+CN+D LL +RE +N   
Sbjct: 174 HNKIVSRNPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDIN--- 230

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +F  E+ S +ISVND I+ A A A+ +VP AN SW  +A+  + ++DISVAV+I  G+VT
Sbjct: 231 KFFSEDKSTRISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISVAVAIENGLVT 290

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI++ A+QK+IL++S E+K L ++AK  KL PEE+QGG  +ISN+GM GI +F A+INPP
Sbjct: 291 PIVKNANQKNILELSREMKALIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPP 350

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS I+ +GA  K+ + +N++I +ATIM+ TLSADHR VDGA+ ++ LA FK++IE+PV M
Sbjct: 351 QSCIMGVGASAKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLAAFKKFIESPVLM 410

Query: 422 LM 423
           L+
Sbjct: 411 LI 412


>gi|319776091|ref|YP_004138579.1| dihydrolipoyltranssuccinase [Haemophilus influenzae F3047]
 gi|329123255|ref|ZP_08251823.1| 2-oxoglutarate dehydrogenase E2, dihydrolipoamide acetyltransferase
           [Haemophilus aegyptius ATCC 11116]
 gi|317450682|emb|CBY86902.1| dihydrolipoyltranssuccinase [Haemophilus influenzae F3047]
 gi|327471464|gb|EGF16912.1| 2-oxoglutarate dehydrogenase E2, dihydrolipoamide acetyltransferase
           [Haemophilus aegyptius ATCC 11116]
          Length = 409

 Score =  301 bits (771), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 102/422 (24%), Positives = 188/422 (44%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD +   +++ EIETDK ++E  ++ +G++ E++
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKLGDTVKRDEVIVEIETDKVVLEVPALSDGVLAEVV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +     +  I         S  L   N     +  + +          ++  I
Sbjct: 61  QAEG-ETVVSKQLLGKISTAQEGDVSSATLKATNEPTPSDRQNAAIENSHNHNADQSPAI 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              LA        I  S + G      I +   +                   +   +  
Sbjct: 120 RRLLAEHDLQADQIQGSGVGGRLTREDIEREIAKRQAQQVKQEAATEQNTISTVAYSA-- 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                     S + +P   +RK IA RL ++K +        + ++  +++LR+      
Sbjct: 178 ---------RSEKRVPMTRLRKRIAERLLEAKNSTAILTTFNEVDMQPIMTLRKTYGEKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +      S ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---HSVRLGFMSFYIKAVVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ +I  ++K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVLRDCDKLSMAEIEKQIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +  N ++ +  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 346 QSAILGMHAIKERPIALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|319404896|emb|CBI78497.1| dihydrolipoamide succinyltransferase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 405

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 97/422 (22%), Positives = 177/422 (41%), Gaps = 19/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ ++  + L E+ETDK  +E  S   G + EI+
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKIGEAVAMDEPLVELETDKVTVEVPSPVAGKLSEII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + VN+ +  +   +  +  S        V      S  +  V         P 
Sbjct: 61  AKEG-DTVEVNALLGMVEAGADGVSVSSAPPASPSVISTPTSSPMAASVSTSSLGGTMPP 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A   A+ +A  +               +    +  L                     S  
Sbjct: 120 APSAAKLMAENNIEKSDLSGSGKRGQILKGDVLNVL---------------AQGTKTSAS 164

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            +          E +    +R+TIA RL+ ++ T        + ++  ++ LR++     
Sbjct: 165 VSSAIFVDTVHEERVRMTKLRQTIARRLKDAQNTAAMLTTFNEVDMSTVMDLRKRYKDLF 224

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++   +++  +AV    G+V 
Sbjct: 225 EKK---HGVKLGFMGFFTKAVCHALKELPAVNAEIDGTDIVYKNYVNAGIAVGTDKGLVV 281

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ SI +I  E+ +L + A+  KL   +  GGT +I+N G+ G      ++N P
Sbjct: 282 PVVRNADQMSIAEIEKEIGRLGRLARDGKLAVADMLGGTFTITNGGVYGSLMSTPILNAP 341

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +    +I +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 342 QSGILGMHAIKERAMVVGGQIVIRPMMYLALSYDHRIVDGQEAVTFLVRVKESLEDPERL 401

Query: 422 LM 423
           ++
Sbjct: 402 VL 403


>gi|27375562|ref|NP_767091.1| dihydrolipoamide succinyltransferase [Bradyrhizobium japonicum USDA
           110]
 gi|27348699|dbj|BAC45716.1| dihydrolipoamide S-succinyltransferase [Bradyrhizobium japonicum
           USDA 110]
          Length = 414

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 96/421 (22%), Positives = 178/421 (42%), Gaps = 9/421 (2%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I +P+L  ++TE  + +W K+ GD ++  + L E+ETDK  +E  +   G + EI+ 
Sbjct: 1   MTEIRVPTLGESVTEATIGRWFKKAGDPVAVDEPLVELETDKVTIEVPAPSAGTLSEIIA 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G   +AV + +  I   +           +         + ++P    +    + P+A
Sbjct: 61  ADGA-TVAVGALLGQITEGAAGAAKPAAAPAKPAAAPAAAAAAAAPAPAAKAPPADAPLA 119

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
             + +  A       +               +  +    +     +   +   V     A
Sbjct: 120 PSVRKLSAETGIDASTVPGSGKDGRVTKGDMLAAIERAASAPTPVNQPAAAVQVRALSPA 179

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
           +          E +    +R+TIA RL+  + T        + ++ N+++LR       +
Sbjct: 180 DDAA-----REERVKMTRLRQTIARRLKDVQNTAAMLTTFNEVDMTNVMALRAHYKDAFE 234

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                  +K+       KA   A+  +P  N       +I   +  I VAV    G+V P
Sbjct: 235 KK---HGSKLGFMGFFTKAVVQALKDIPAVNAEIDGTDLIYKNYYHIGVAVGTDKGLVVP 291

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R  D KSI DI   +    +RA+  +LK +E QGGT +I+N G+ G      ++N PQ
Sbjct: 292 VVRDCDHKSIADIEKGIADFGRRARDGQLKIDEMQGGTFTITNGGIYGSLMSTPILNAPQ 351

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL +   +++ +    +I+V  +M   LS DHR +DG  A   L + KE +E+P  ++
Sbjct: 352 SGILGMHKIQERPMVVAGKIEVRPMMYLALSYDHRVIDGKEAVTFLVRVKESLEDPARLV 411

Query: 423 M 423
           +
Sbjct: 412 L 412


>gi|145631489|ref|ZP_01787258.1| carboxy-terminal protease [Haemophilus influenzae R3021]
 gi|145639183|ref|ZP_01794790.1| carboxy-terminal protease [Haemophilus influenzae PittII]
 gi|260582633|ref|ZP_05850422.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Haemophilus influenzae NT127]
 gi|144982919|gb|EDJ90432.1| carboxy-terminal protease [Haemophilus influenzae R3021]
 gi|145271745|gb|EDK11655.1| carboxy-terminal protease [Haemophilus influenzae PittII]
 gi|260094305|gb|EEW78204.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Haemophilus influenzae NT127]
 gi|309750761|gb|ADO80745.1| 2-oxoglutarate dehydrogenase E2 component dihydrolipoamide
           succinyltransferase [Haemophilus influenzae R2866]
          Length = 409

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 102/422 (24%), Positives = 188/422 (44%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD +   +++ EIETDK ++E  ++ +G++ E++
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKLGDTVKRDEVIVEIETDKVVLEVPALSDGVLAEVV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +     +  I         S  L   N     +  + +          ++  I
Sbjct: 61  QAEG-ETVVSKQLLGKISTAQEGDVSSATLKATNEPTPSDRQNAAIENSHNHNADQSPAI 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              LA        I  S + G      I +   +                   +   +  
Sbjct: 120 RRLLAEHDLQADQIQGSGVGGRLTREDIEREIAKRQAQQVKQEAATEQNTISTVAYSA-- 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                     S + +P   +RK IA RL ++K +        + ++  +++LR+      
Sbjct: 178 ---------RSEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMQPIMTLRKTYGEKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +      S ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---HSVRLGFMSFYIKAVVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ +I  ++K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVLRDCDKLSMAEIEKQIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +  N ++ +  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 346 QSAILGMHAIKERPIALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|303250246|ref|ZP_07336446.1| dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex (E2)
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|307252011|ref|ZP_07533911.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|302650862|gb|EFL81018.1| dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex (E2)
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306860480|gb|EFM92493.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 409

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 116/422 (27%), Positives = 199/422 (47%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I  P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  + ++G++ EI 
Sbjct: 1   MTIEILTPVLPESVADATVATWHKKVGDTVKRDEVLVEIETDKVVLEVPAPNDGVLAEIS 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  I         +   ++E I +  E           E    +   
Sbjct: 61  QEQGA-TVTSKQLLGKIST-----VQAGDFTQETIKQTNEATPADRKSAAIEYDHSDANS 114

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
             P  RRL  EH I+   + G+G  GRI + DIE  ++ +   +    + S      ++ 
Sbjct: 115 QGPAIRRLLAEHNIEAHLVKGTGVGGRITREDIEHYLAQRQVQETKQAMASEHNTVSTVA 174

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            +        S + +P   +RK IA RL ++K T        + ++  ++SLR+      
Sbjct: 175 YSA------RSEKRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMSLRKTYGEKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---HGVRLGFMSFYIKAVVEALKRYPEINASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR  D+ S+ DI   +K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVIRNCDKLSMADIEKTIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A + + V  N ++ +  +M   LS DHR +DG  +   L   K+ +E+P  +
Sbjct: 346 QSAILGMHAIKDRPVAVNGQVVIRPMMYLALSYDHRLIDGRESVGFLVAVKDLLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|254486431|ref|ZP_05099636.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Roseobacter sp. GAI101]
 gi|214043300|gb|EEB83938.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Roseobacter sp. GAI101]
          Length = 435

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 183/438 (41%), Positives = 267/438 (60%), Gaps = 21/438 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +S GD++CEIETDKA MEFE+ DEG+I +IL
Sbjct: 1   MPIEILMPALSPTMEEGTLAKWLVKEGDTVSSGDVMCEIETDKATMEFEATDEGVIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPP---------SPPLSKENIVEVREEHSHSSPVVVR 112
           +  GTE + VN+PI  +L +               + P             +        
Sbjct: 61  IADGTEGVKVNTPIAVLLEEGESADDIGAASAPAETAPTPAPQEEAPVAASASPDTPAAP 120

Query: 113 EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQS 172
           +     R  A+PLARR+A + G+DLS + GSGPHGRI+K+D+E L  ++      +   +
Sbjct: 121 KSADGKRIFATPLARRIAADKGLDLSQIKGSGPHGRIIKADVEGLSESEAPKAAAAAAPT 180

Query: 173 FGLVDE-------SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
                             ++ ++    +E I  + +RKTIA RL ++KQ+IPHFY+  D 
Sbjct: 181 ATEAAAKPALAAGPSADAVMKMYEGREFEEISLNGMRKTIASRLTEAKQSIPHFYLRRDI 240

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
            +D L+  R  +N+ L+        K+SVND I+KA ALA+  VP+AN  W  + +++ K
Sbjct: 241 QLDALMKFRGDLNKQLEAR----GVKLSVNDFIIKACALALQAVPDANAVWAGDRILKLK 296

Query: 286 HIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
             D++VAV+I GG+ TP+++ ++ KS+  +S E+K LA RA+ RKL P EYQGG+ +ISN
Sbjct: 297 PSDVAVAVAIDGGLFTPVLKDSEMKSLSALSAEMKDLATRARDRKLAPHEYQGGSFAISN 356

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHRSVDGAIA 404
           +GM GI++F AVINPP   ILA+GAG KK V  ++ E+ VAT+M+ TLS DHR +DGA+ 
Sbjct: 357 LGMFGIDNFDAVINPPHGAILAVGAGVKKPVVGKDGELAVATVMSVTLSVDHRVIDGALG 416

Query: 405 SKLLAKFKEYIENPVWML 422
           ++LL   K+ +ENP+ ML
Sbjct: 417 AQLLTAIKDNLENPITML 434


>gi|262198168|ref|YP_003269377.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Haliangium ochraceum DSM 14365]
 gi|262081515|gb|ACY17484.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Haliangium ochraceum DSM 14365]
          Length = 416

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 104/422 (24%), Positives = 189/422 (44%), Gaps = 8/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +PS   ++TE  +  W+K EGD ++  + L E+ETDKA ME  +   G +  +L
Sbjct: 1   MTVEIKVPSAGESITEVFIGTWLKNEGDSVTKDETLVEVETDKATMEVPAPVSGTLVNVL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             +G ++ +V   I +I                +  +  ++   ++      +       
Sbjct: 61  KKSG-DSASVGEVIAHIEEGEVSADAGAASKSADKADTGDKGDKAADGSSEGEPRVMPAA 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              L         ++ +   G      + +  +  L S   + K      +         
Sbjct: 120 QRLLDENGLDAGAVEATGPGGRL----LKEDVLRHLESAGASAKAKGDAGTSARPASEGK 175

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A+          EV+    +R+TIA RL +++Q         + ++  +++LR +     
Sbjct: 176 ASANGGGGGREEEVVAMSPLRRTIARRLVEAQQNAALLTTFNEVDMSAVMALRAEHKERF 235

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ Q P+ N      +++   + DI+VAVS P G+VT
Sbjct: 236 EKR---YGVRLGFMSFFVKAAVDALKQFPQINAEVREQSIVYKNYYDIAVAVSGPKGLVT 292

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  ++ S  D+   +    QRA++ KL P+E +GGT +ISN G+ G      +INPP
Sbjct: 293 PVLRNTERMSFADVEKTIGDFGQRAQKNKLTPDELRGGTFTISNGGVFGSLLSTPIINPP 352

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS +L + A +++ V  + ++ +  +M   LS DHR VDG  A   L + KE +E+P  M
Sbjct: 353 QSGVLGMHAIQERPVAIDGQVVIRPMMYLALSYDHRIVDGREAVTFLKRIKEAVESPARM 412

Query: 422 LM 423
           L+
Sbjct: 413 LL 414


>gi|89068137|ref|ZP_01155554.1| dihydrolipoamide acetyltransferase [Oceanicola granulosus HTCC2516]
 gi|89046376|gb|EAR52433.1| dihydrolipoamide acetyltransferase [Oceanicola granulosus HTCC2516]
          Length = 540

 Score =  301 bits (770), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 88/420 (20%), Positives = 165/420 (39%), Gaps = 7/420 (1%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
             IT+P+L  ++TE  ++ W K+ GD     ++LCE+ETDK  +E  +   G + ++L  
Sbjct: 126 IEITVPALGESVTEATVSTWFKKPGDSFEADEMLCELETDKVSVEVPAPAAGTLSKLLAE 185

Query: 64  AGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIAS 123
            G   +     +  +             +         E             +     + 
Sbjct: 186 EGA-TVEAGGKLALMTTGKAAASAKAEGTPATTTSQTPEGDRGGYGDRGTPDTPPTTESR 244

Query: 124 PLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDAN 183
                              +     +  +     I  +  +   +  Q            
Sbjct: 245 GDIE---DAPSAKKMMAEKNLSADAVTGTGKGGRIMKEDVLNALNKPQQAEAPKPQAARA 301

Query: 184 ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQF 243
                  D  E +    +R+TIA RL++++          + ++  ++ LR +       
Sbjct: 302 PSTPADADREERVKMTRLRQTIARRLKEAQNNAAMLTTYNEVDMGGIMDLRNEYKDLFLK 361

Query: 244 HREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPI 303
                  K+      +KA   A+ +VP+ N       ++   ++++ +AV  P G+V P+
Sbjct: 362 K---HGVKLGFMSFFVKACCHALNEVPDVNAEIDGTDVVYKNYVNMGIAVGTPNGLVVPV 418

Query: 304 IRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQS 363
           +R A +K    I  E+ +L  + +  KL   + QGG+ +ISN G+ G      ++NPPQS
Sbjct: 419 VRDAHEKGFAQIEKEIAELGAKGRDGKLSMADMQGGSFTISNGGVYGSLMSSPILNPPQS 478

Query: 364 TILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            IL +   +++ +    +I    +M   LS DHR VDG  A   L + KE +E+P  +LM
Sbjct: 479 GILGMHKIQERPMVVKGQIVARPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRLLM 538



 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 49/93 (52%), Gaps = 1/93 (1%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   + +P+L  ++TE  +A W K+ GD +   ++LCE+ETDK  +E  S   G +DEI+
Sbjct: 1  MSVEVRVPALGESVTEATVATWFKKPGDAVEADEMLCELETDKVTVEVPSPAAGKLDEIV 60

Query: 62 VPAGTENIAVNSPILNILMDSTEIPPSPPLSKE 94
             G E + V++ + NI         +    +E
Sbjct: 61 AAEG-ETVGVDALLANIAEAGHAGSSTDIKPRE 92


>gi|182680506|ref|YP_001834652.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636389|gb|ACB97163.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 405

 Score =  301 bits (770), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 102/422 (24%), Positives = 184/422 (43%), Gaps = 19/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ GD +   + L E+ETDK  +E  +   G++ EI+
Sbjct: 1   MTTEIRVPTLGESVTEATIGKWFKKAGDAVKADEPLVELETDKVTLEVNAPAAGVLGEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + +  I+       P+               + +               
Sbjct: 61  AKDG-DTVGVGALLGQIVESGAGAAPAAAKPAALAPAPTPAAAPAPAPSAGLP------- 112

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            SP A ++A +  +D  ++ GSG  G+++K D+   ++                     D
Sbjct: 113 PSPAAAKVAADAHVDTQAIDGSGKRGQVLKGDVLDYVAKGAAPAAAPAPVIARAPAPQED 172

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                       E +    +R+TIA RL+ ++ T        + ++  +++LR +     
Sbjct: 173 GA--------REERVRMTKLRQTIARRLKDAQNTAAMLTTFNEVDMTEVMALRAKYKDIF 224

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+      +KA   A+  +P  N       +I   +  + +AV    G+V 
Sbjct: 225 EKK---HGTKLGFMGFFVKACVAALKDIPAVNAEIDGTDLIYKNYYHLGIAVGTDKGLVV 281

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ SI  I   +    +RA+  +LK EE QGGT +I+N G+ G      ++N P
Sbjct: 282 PVVRDADQLSIAGIEKTIAGYGKRARDGQLKIEEMQGGTFTITNGGIYGSLMSTPILNAP 341

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   + + +    +I++  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 342 QSGILGMHKIQDRPMVVGGKIEIRPMMYLALSYDHRIVDGKEAVTFLVRVKEELEDPARL 401

Query: 422 LM 423
           ++
Sbjct: 402 VL 403


>gi|301170419|emb|CBW30025.1| dihydrolipoyltranssuccinase [Haemophilus influenzae 10810]
          Length = 409

 Score =  301 bits (770), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 102/422 (24%), Positives = 188/422 (44%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD +   +++ EIETDK ++E  ++ +G++ E++
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKLGDTVKRDEVIVEIETDKVVLEVPALSDGVLAEVV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +     +  I         S  L   N     +  + +          ++  I
Sbjct: 61  QAEG-ETVVSKQLLGKISTAQEGDVSSATLKATNEPTPSDRQNAAIENSHNHNVDQSPAI 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              LA        I  S + G      I +   +                   +   +  
Sbjct: 120 RRLLAEHDLQADQIQGSGVGGRLTREDIEREIAKRQAQQVKQEAATEQNTISTVAYSA-- 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                     S + +P   +RK IA RL ++K +        + ++  +++LR+      
Sbjct: 178 ---------RSEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMQPIMTLRKTYGEKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +      S ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---HSVRLGFMSFYIKAVVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ +I  ++K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVLRDCDKLSMAEIEKQIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +  N ++ +  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 346 QSAILGMHAIKERPIALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|289663042|ref|ZP_06484623.1| dihydrolipoamide succinyltransferase [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 403

 Score =  301 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 111/425 (26%), Positives = 190/425 (44%), Gaps = 29/425 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++++  +A W K+ G+ +   + L ++ETDK ++E  S  +G++ EI 
Sbjct: 1   MATEVKVPVLPESVSDATIASWHKKAGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             AG+  +  N  +  I   +          K          + +         +     
Sbjct: 61  FEAGS-TVTSNQILAIIEEGAVAAAAPAEEKKAAAPAAAAAPAAAPAPAAAAAPAAASKS 119

Query: 122 A----SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
           A     P AR  A   G+D S + G+G  G + K DI                       
Sbjct: 120 AADALPPGARFSAITQGVDPSQVEGTGRRGAVTKEDIVNF-------------------- 159

Query: 178 ESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
            +    +         E +P   +RKTIA RL +SK +        + N+  + + R+++
Sbjct: 160 -AKAGGVGKASGARPEERVPMTRVRKTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKEL 218

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
               Q        K+      +KA A A+ + P  N S   + +I H + DIS+AVS   
Sbjct: 219 QDEFQKA---HGIKLGFMSFFVKAAANALQRFPLVNASIDGDDIIYHGYSDISIAVSTDK 275

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G+VTP++R  +++S  D+   +   A +A+  KL  ++ QGGT +I+N G  G      +
Sbjct: 276 GLVTPVLRNVERQSFADVEQGIADYAAKARAGKLGLDDLQGGTFTITNGGTFGSLLSTPI 335

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           INPPQS IL + A +++ + +N ++ +A +M   LS DHR +DG  + + L   K  +EN
Sbjct: 336 INPPQSAILGMHAIKERPIAENGQVVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLEN 395

Query: 418 PVWML 422
           P  ML
Sbjct: 396 PGRML 400


>gi|240949073|ref|ZP_04753424.1| dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex (E2)
           [Actinobacillus minor NM305]
 gi|240296546|gb|EER47171.1| dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex (E2)
           [Actinobacillus minor NM305]
          Length = 409

 Score =  301 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 111/422 (26%), Positives = 200/422 (47%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I  P L  ++ +  +A W K+ GD +   ++L E+ETDK ++E  S  +GI+ EIL
Sbjct: 1   MTTEILTPVLPESVADATVATWHKKAGDSVKRDEVLVEVETDKVVLEVPSPVDGILSEIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             +G+  +  +  +  I         +    +       E           E    +   
Sbjct: 61  QESGS-TVISSQVLGKIST-----TQAGDFIQNVATNSVEATPADRKTSAIEHDHSDADS 114

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
             P  RRL  EHGI+ + + G+G  GR+ + DI   ++ +   +  S + +      ++ 
Sbjct: 115 QGPAIRRLLAEHGIEANQVQGTGVGGRLTREDINAYLAKREAQQAKSAMATEQNTVSTVA 174

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            +        S + +P   +RK IA RL ++K +        + ++  +++LR+      
Sbjct: 175 YSS------RSEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMQPIMTLRKTYGEKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---HGVRLGFMSFYIKAVVEALKRYPEINASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR  D+ S+ +I   +K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVIRNCDKLSMAEIEKTIKTLAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A + + V  + ++ +  +M   LS DHR +DG  +   L   K+ +E+P  +
Sbjct: 346 QSAILGMHAIKDRPVAVDGQVVIRPMMYLALSYDHRLIDGRESVGFLVAVKDLLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|145633338|ref|ZP_01789069.1| 2-oxoglutarate dehydrogenase E2 component dihydrolipoamide
           succinyltransferase [Haemophilus influenzae 3655]
 gi|144986184|gb|EDJ92774.1| 2-oxoglutarate dehydrogenase E2 component dihydrolipoamide
           succinyltransferase [Haemophilus influenzae 3655]
          Length = 409

 Score =  301 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 102/422 (24%), Positives = 188/422 (44%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD +   +++ EIETDK ++E  ++ +G++ E++
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKLGDTVKRDEVIVEIETDKVVLEVPALSDGVLAEVV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +     +  I         S  L   N     +  + +          ++  I
Sbjct: 61  QAEG-ETVVSKQLLGKISTAQEGDVSSATLKATNEPTPSDRQNAAIENSHNHNADQSPAI 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              LA        I  S + G      I +   +                   +   +  
Sbjct: 120 RRLLAEHDLQADQIQGSGVGGRLTREDIEREIAKRQAQQVKQEAATEQNTISTVAYSA-- 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                     S + +P   +RK IA RL ++K +        + ++  +++LR+      
Sbjct: 178 ---------RSEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMQPIMTLRKTYGEKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +      S ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---HSVRLGFMSFYIKAVVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ +I  ++K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVLRDCDKLSMAEIEKQIKVLAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +  N ++ +  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 346 QSAILGMHAIKERPIALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|330991143|ref|ZP_08315097.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Gluconacetobacter
           sp. SXCC-1]
 gi|329761964|gb|EGG78454.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Gluconacetobacter
           sp. SXCC-1]
          Length = 419

 Score =  301 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 98/422 (23%), Positives = 173/422 (40%), Gaps = 5/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++T   +AKW+K  GD ++  D L E+ETDK  +E  +   G++  +L
Sbjct: 1   MSAEIKVPTLGESVTTATVAKWLKHPGDAVNEDDPLVELETDKVSVEVPAPQAGVLGPLL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           VP G E + V + +  I   S   P +                                 
Sbjct: 61  VPEGEE-VEVGTVLSTIEAGSGAAPKAAAAPAPKKEAAPTGVQAQPVASGPVARPATPAS 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A         ++  G     V +        +    D  +  +     +   
Sbjct: 120 DIAAQGAAAVAFPSARKIMAEQGVSPAQVGTGTGK--DGRITKGDVQSFLAQPRAAQPAA 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A           E +    +R+TIA RL+ ++ T        + ++  ++ +R +     
Sbjct: 178 APRPPRQDDPREERVKMTRLRRTIARRLKDAQNTAALLTTFNEVDMSGVMQMRAEYKDLF 237

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
                    K+    I  +A   A+ + P  N     + +I  + +++ +AV  P G+V 
Sbjct: 238 IKKHN--GVKLGFMSIFSRAAIAALQEFPAINAEIDGDDVIYREFVNLGIAVGGPNGLVV 295

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR AD+ S   I   +    ++A++  LK +E  GGT SI+N G+ G      +IN P
Sbjct: 296 PVIRDADKMSFAQIEGAIAGFGRKAREGTLKIDELSGGTFSITNGGIYGSLMSTPIINAP 355

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A + + V  N ++ +  +M   L+ DHR VDG  A   L + K+ +E+P  +
Sbjct: 356 QSAILGMHAIQDRPVAVNGQVVIRPMMYIALTYDHRIVDGKEAVSFLVRVKQNVEDPRRL 415

Query: 422 LM 423
           L+
Sbjct: 416 LL 417


>gi|229845069|ref|ZP_04465205.1| alpha-ketoglutarate decarboxylase [Haemophilus influenzae 6P18H1]
 gi|229846893|ref|ZP_04467000.1| alpha-ketoglutarate decarboxylase [Haemophilus influenzae 7P49H1]
 gi|229810382|gb|EEP46101.1| alpha-ketoglutarate decarboxylase [Haemophilus influenzae 7P49H1]
 gi|229812041|gb|EEP47734.1| alpha-ketoglutarate decarboxylase [Haemophilus influenzae 6P18H1]
          Length = 409

 Score =  301 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 102/422 (24%), Positives = 188/422 (44%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD +   +++ EIETDK ++E  ++ +G++ E++
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKLGDTVKRDEVIVEIETDKVVLEVPALSDGVLAEVV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +     +  I         S  L   N     +  + +          ++  I
Sbjct: 61  QAEG-ETVVSKQLLGKISTAQEGDVSSATLKATNEPTPSDRQNAAIENSHNHNADQSPAI 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              LA        I  S + G      I +   +                   +   +  
Sbjct: 120 RRLLAEHDLQADQIQGSGVGGRLTREDIEREIAKRQAQQVKQEVATEQNTISTVAYSA-- 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                     S + +P   +RK IA RL ++K +        + ++  +++LR+      
Sbjct: 178 ---------RSEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMQPIMTLRKTYGEKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +      S ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---HSVRLGFMSFYIKAVVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ +I  ++K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVLRDCDKLSMAEIEKQIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +  N ++ +  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 346 QSAILGMHAIKERPIALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|327188910|gb|EGE56102.1| dihydrolipoamide S-succinyltransferase protein [Rhizobium etli
           CNPAF512]
          Length = 421

 Score =  301 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 95/423 (22%), Positives = 176/423 (41%), Gaps = 5/423 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  +  W K+ GD I   + + E+ETDK  +E  +   G + EI+
Sbjct: 1   MATEIRVPTLGESVSEATVGTWFKKVGDAIKADEPILELETDKVTIEVPAPVSGTLSEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             AG E + + + +  I   +                     + + P  V    + +   
Sbjct: 61  AAAG-ETVGLGALLGQIAEGAVAAAAPAAAQPAAAPAQAAPAAPAQPTPVAAAAASSSSA 119

Query: 122 ASPLARR-LAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           +        A    +  S+LS     G   +  +          +  S   +      + 
Sbjct: 120 SVSTMPPAPAAAKMLAESNLSADQVDGSGKRGQVLKGDVIAAVARGISAPAAAPAAAPAA 179

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                 +      E +    +R+TIA RL+ ++ T        + ++  ++ LR +    
Sbjct: 180 ARGPSTVEDASREERVKMTRLRQTIAKRLKDAQNTAAMLTTYNEVDMKAVMDLRNKYKDI 239

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        K+       KA   A+ ++P  N       +I   +  + +AV    G+V
Sbjct: 240 FEKK---HGVKLGFMGFFTKAVTHALKELPAVNAEIDGTDVIYKNYCHVGMAVGTDKGLV 296

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            P+IR ADQ SI +I  ++ +LA+ A+   L   + QGGT +I+N G+ G      ++N 
Sbjct: 297 VPVIRDADQMSIAEIEKDLGRLAKAARDGSLSMADMQGGTFTITNGGVYGSLMSSPILNA 356

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL +   +++ V    ++ +  +M   LS DHR VDG  A   L + KE +E+P  
Sbjct: 357 PQSGILGMHKIQERPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPER 416

Query: 421 MLM 423
           +++
Sbjct: 417 LVL 419


>gi|166711495|ref|ZP_02242702.1| dihydrolipoamide acetyltransferase [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 400

 Score =  301 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 110/422 (26%), Positives = 190/422 (45%), Gaps = 26/422 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++++  +A W K+ G+ +   + L ++ETDK ++E  S  +G++ EI 
Sbjct: 1   MATEVKVPVLPESVSDATIASWHKKAGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             AG+  +  N  +  I   +          K          +  +        S +   
Sbjct: 61  FEAGS-TVTSNQILAIIEEGAVAAAAPADEKKAAAPAAAAPAAAPAAAAAPAPASTSAAD 119

Query: 122 A-SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           +  P AR  A   G+D S + G+G  G + K DI                        + 
Sbjct: 120 SLPPGARFSAITQGVDPSQVEGTGRRGAVTKEDIVNF---------------------AK 158

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
              +         E +P   +RKTIA RL +SK +        + N+  + + R+++   
Sbjct: 159 AGGVGKASGARPEERVPMTRVRKTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKELQDE 218

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            Q        K+      +KA A A+ + P  N S   + +I H + DIS+AVS   G+V
Sbjct: 219 FQKA---HGIKLGFMSFFVKAAANALQRFPLVNASIDGDDIIYHGYSDISIAVSTDKGLV 275

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  +++S  D+   +   A +A+  KL  ++ QGGT +I+N G  G      +INP
Sbjct: 276 TPVLRNVERQSFADVEQGIADYAAKARAGKLGLDDLQGGTFTITNGGTFGSLLSTPIINP 335

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL +   +++ + +N ++ +A +M   LS DHR +DG  + + L   K  +ENP  
Sbjct: 336 PQSAILGMHTIKERPIAENGQVVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGR 395

Query: 421 ML 422
           ML
Sbjct: 396 ML 397


>gi|190893733|ref|YP_001980275.1| dihydrolipoamide S-succinyltransferase [Rhizobium etli CIAT 652]
 gi|190699012|gb|ACE93097.1| dihydrolipoamide S-succinyltransferase protein [Rhizobium etli CIAT
           652]
          Length = 421

 Score =  301 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 95/423 (22%), Positives = 175/423 (41%), Gaps = 5/423 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  +  W K+ GD I   + + E+ETDK  +E  +   G + EI+
Sbjct: 1   MATEIRVPTLGESVSEATVGTWFKKVGDAIKADEPILELETDKVTIEVPAPVSGTLSEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             AG E + + + +  I   +                     + + P  V    + +   
Sbjct: 61  AAAG-ETVGLGALLGQIAEGAVAAAAPAAAQPAAAPAQSAPAAPAQPAPVAAAAASSSSA 119

Query: 122 ASPLARR-LAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           +        A    +  S LS     G   +  +          +  S   +      + 
Sbjct: 120 SVSTMPPAPAAAKMLAESKLSADQVDGSGKRGQVLKGDVIAAVARGISAPAAAPAAAPAA 179

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                 +      E +    +R+TIA RL+ ++ T        + ++  ++ LR +    
Sbjct: 180 ARGPSTVEDASREERVKMTRLRQTIAKRLKDAQNTAAMLTTYNEVDMKAVMDLRNKYKDI 239

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        K+       KA   A+ ++P  N       +I   +  + +AV    G+V
Sbjct: 240 FEKK---HGVKLGFMGFFTKAVTHALKELPAVNAEIDGTDVIYKNYCHVGMAVGTDKGLV 296

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            P+IR ADQ SI +I  ++ +LA+ A+   L   + QGGT +I+N G+ G      ++N 
Sbjct: 297 VPVIRDADQMSIAEIEKDLGRLAKAARDGSLSMADMQGGTFTITNGGVYGSLMSSPILNA 356

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL +   +++ V    ++ +  +M   LS DHR VDG  A   L + KE +E+P  
Sbjct: 357 PQSGILGMHKIQERPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPER 416

Query: 421 MLM 423
           +++
Sbjct: 417 LVL 419


>gi|32034768|ref|ZP_00134893.1| COG0508: Pyruvate/2-oxoglutarate dehydrogenase complex,
           dihydrolipoamide acyltransferase (E2) component, and
           related enzymes [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|126207938|ref|YP_001053163.1| dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex (E2)
           [Actinobacillus pleuropneumoniae L20]
 gi|190149800|ref|YP_001968325.1| dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex (E2)
           [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|307256508|ref|ZP_07538289.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307263120|ref|ZP_07544741.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|126096730|gb|ABN73558.1| dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex (E2)
           [Actinobacillus pleuropneumoniae serovar 5b str. L20]
 gi|189914931|gb|ACE61183.1| dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex (E2)
           [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|306864918|gb|EFM96820.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306871482|gb|EFN03205.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 409

 Score =  301 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 116/422 (27%), Positives = 199/422 (47%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I  P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  + ++G++ EI 
Sbjct: 1   MTIEILTPVLPESVADATVATWHKKVGDTVKRDEVLVEIETDKVVLEVPAPNDGVLAEIS 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  I         +   ++E I +  E           E    +   
Sbjct: 61  QEQGA-TVTSKQLLGKIST-----VQAGDFTQETIKQTNEATPADRKSAAIEYDHSDADS 114

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
             P  RRL  EH I+   + G+G  GRI + DIE  ++ +   +    + S      ++ 
Sbjct: 115 QGPAIRRLLAEHNIEAHLVKGTGVGGRITREDIEHYLAQRQVQETKQAMASEHNTVSTVA 174

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            +        S + +P   +RK IA RL ++K T        + ++  ++SLR+      
Sbjct: 175 YSA------RSEKRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMSLRKTYGEKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---HGVRLGFMSFYIKAVVEALKRYPEINASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR  D+ S+ DI   +K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVIRNCDKLSMADIEKTIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A + + V  N ++ +  +M   LS DHR +DG  +   L   K+ +E+P  +
Sbjct: 346 QSAILGMHAIKDRPVAVNGQVVIRPMMYLALSYDHRLIDGRESVGFLVAVKDLLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|307293434|ref|ZP_07573280.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Sphingobium chlorophenolicum L-1]
 gi|306881500|gb|EFN12716.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Sphingobium chlorophenolicum L-1]
          Length = 410

 Score =  301 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 90/422 (21%), Positives = 173/422 (40%), Gaps = 14/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P+L  ++TE  + +W+K+ GD +   + +  +ETDK  ++  +   G++ +I+
Sbjct: 1   MATEVKVPTLGESVTEATVGQWLKKPGDAVKADEPIVSLETDKVAVDVPAPAAGVLGDIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + +  +   +                     + S+P             
Sbjct: 61  AKEG-DTVEVGALLAYVNEGAAASAAPAAAPAAKAEAAAPAPAASAPAEDE--------- 110

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                  L+      +          +    D               T ++      +  
Sbjct: 111 -EGGNLTLSPAVRRLVLEHGLDPSKIKGSGKDGRLTKDDVVAAAAAGTAKAAASAPAAAP 169

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A         + E +    +R+T+A RL++++          D ++ N++  R +     
Sbjct: 170 AAAPAAGPSRAQERVKMTRLRQTVAKRLKEAQNNAALLTTYNDVDMTNVIEARAKYKDLF 229

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++       KA  +A+  VP  N     + ++ +   DISVAVS P G+V 
Sbjct: 230 EKK---HGVRLGFMGFFAKAVCMALRDVPGVNAQIEGDEIVYNDFADISVAVSAPNGLVV 286

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR A+  S+ +I   +    ++AK   L  ++ +GGT +ISN G+ G      +INPP
Sbjct: 287 PVIRNAESLSVAEIEKTIGSFGKKAKDGTLTMDDMKGGTFTISNGGVFGSLLSSPIINPP 346

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS +L +   E + V ++ +I +  +M   LS DHR +DG  A   L   K  IE+P  +
Sbjct: 347 QSAVLGLHRIEDRPVVRDGQIVIRPMMYLALSYDHRLIDGREAVTFLVAVKNAIEDPTRL 406

Query: 422 LM 423
           L+
Sbjct: 407 LI 408


>gi|254560768|ref|YP_003067863.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Methylobacterium extorquens DM4]
 gi|254268046|emb|CAX23917.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Methylobacterium extorquens DM4]
          Length = 446

 Score =  301 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 100/448 (22%), Positives = 180/448 (40%), Gaps = 30/448 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  + +W K+ GD ++  + L E+ETDK  +E  +   G + EIL
Sbjct: 1   MATDILVPTLGESVSEATIGRWFKKPGDTVAADEPLVELETDKVTLEVNAPAAGELGEIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  G E +   + + +I+        S         E  E  + S     + +       
Sbjct: 61  VKDG-ETVEPGAVLGSIVEGGKGSGKSDAKPAPKSAEPAETKTQSREEKGKGEGDSKPAK 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKS--------------------------DIE 155
               A+  +  +G    +    G                                    +
Sbjct: 120 EDAPAQESSASYGSHGDAPPTDGRPADDSGPAVAKLARESGIDPASLNGSGKDGRVTKGD 179

Query: 156 TLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQT 215
            L +   N +     ++                     E +    +R+TIA RL+ +++T
Sbjct: 180 MLAAIDRNGQKAPAQEARSETKAPPPRAPSAPDDAAREERVRMTKLRQTIAKRLKSAQET 239

Query: 216 IPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVS 275
                   D ++  ++++R Q     +        K+       KA   A+  VP  N  
Sbjct: 240 AAMLTTFNDVDMGAVMAMRSQYKDIFEKK---HGTKLGFMGFFTKAVIGALKDVPAVNAE 296

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
                ++   +  I +AV    G+V P++R AD  SI  I  ++    ++A++ KL  +E
Sbjct: 297 IDGQDLVYKNYYHIGIAVGTDKGLVVPVVRDADDLSIAGIEKKISGFGKKAREGKLSIDE 356

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSAD 395
            QGGT +I+N G+ G      ++N PQS IL +   E++ V +N +I+   +M   LS D
Sbjct: 357 MQGGTFTITNGGIYGSLMSTPILNAPQSGILGMHRIEERPVVRNGKIEARPMMYLALSYD 416

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR VDG  A   L + KE +E+P  +++
Sbjct: 417 HRIVDGKEAVTFLVRVKEALEDPARLVL 444


>gi|45658318|ref|YP_002404.1| dihydrolipoamide succinyltransferase [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
 gi|45601560|gb|AAS71041.1| dihydrolipoamide succinyltransferase [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
          Length = 421

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 113/423 (26%), Positives = 187/423 (44%), Gaps = 5/423 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P +  ++TE  +A W+K+EG+ +   +IL E+ETDKA ME  +   G++ +I 
Sbjct: 1   MSVEIKVPEMGESITEATIANWVKKEGESVKQDEILLELETDKATMEVPAPSSGVLQKIH 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             AG E + V   I  I   +T   PSP  S         + S +  +      +  + I
Sbjct: 61  KKAG-ETVKVKEIIGLIDSSATASSPSPSASAPTNSAQTTQTSGNGTINETLPPAVRKLI 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   +         ++       I      ++ +   NV   + +++   + E   
Sbjct: 120 EDNGLNPASITGSGKNGQITKEDVLKAIETKATSSVSNASVNVGTPAAVKATLTLPEIPK 179

Query: 182 ANILNLFAKDSYE-VIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
           A           E V+P   +RK IA RL  ++          + ++  ++ LR +    
Sbjct: 180 AVPAARRTDLPRENVVPMTRLRKVIAERLVSAQHNAAILTTFNEVDMSAVMELRNRYKDK 239

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +      +  +       KA   A+  +P  N     + ++   + DI VAV  P G+V
Sbjct: 240 FKEA---HNVSLGFMSFFTKAAIHALKTIPAINAEIRGSDIVYKNYYDIGVAVGGPKGLV 296

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            P++R AD  S   +  E+ +LA R K  K++  E +GGT +ISN G+ G      ++NP
Sbjct: 297 VPVVRDADLLSFAGVEQEIIRLANRVKDGKIELAEMEGGTFTISNGGIYGSMMSTPILNP 356

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL +    K+ V  N++I +  +M   LS DHR VDG  A   L K KE IE+P  
Sbjct: 357 PQSGILGLHNIVKRAVVVNDQIVIRPMMYLALSYDHRIVDGKEAVTFLVKVKEAIEDPSR 416

Query: 421 MLM 423
           +L+
Sbjct: 417 LLL 419


>gi|24213922|ref|NP_711403.1| dihydrolipoamide acetyltransferase [Leptospira interrogans serovar
           Lai str. 56601]
 gi|24194776|gb|AAN48421.1| dihydrolipoamide acetyltransferase [Leptospira interrogans serovar
           Lai str. 56601]
          Length = 419

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 106/422 (25%), Positives = 173/422 (40%), Gaps = 5/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P +  ++TE  +A W+K+EG+ +   +IL E+ETDKA ME  +   G++ +I 
Sbjct: 1   MSVEIKVPEMGESITEATIANWVKKEGESVKQDEILLELETDKATMEVPAPSSGVLQKIH 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             AG E + V   I  I   +T   PS      +    +   + +    +     K    
Sbjct: 61  KKAG-ETVKVKEIIGLIDSSATASSPSTSAPTNSAQTTQTSGNGTINETLPPAVRKLIED 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                  + G       +            +   +  S                      
Sbjct: 120 NGLNPASITGSGKNGQITKEDVLKAIETKATSSVSNASVNVGTPAAVKATLTLPEIPKAV 179

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                        V+P   +RK IA RL  ++          + ++  ++ LR +     
Sbjct: 180 PAARRTDLPREN-VVPMTRLRKVIAERLVSAQHNAAILTTFNEVDMSAVMELRNRYKDKF 238

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +      +  +       KA   A+  +P  N     + ++   + DI VAV  P G+V 
Sbjct: 239 KEA---HNVSLGFMSFFTKAAIHALKTIPAINAEIRGSDIVYKNYYDIGVAVGGPKGLVV 295

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD  S   +  E+ +LA R K  K++  E +GGT +ISN G+ G      ++NPP
Sbjct: 296 PVVRDADLLSFAGVEQEIIRLANRVKDGKIELAEMEGGTFTISNGGIYGSMMSTPILNPP 355

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +    K+ V  N++I +  +M   LS DHR VDG  A   L K KE IE+P  +
Sbjct: 356 QSGILGLHNIVKRAVVVNDQIVIRPMMYLALSYDHRIVDGKEAVTFLVKVKEAIEDPSRL 415

Query: 422 LM 423
           L+
Sbjct: 416 LL 417


>gi|227823641|ref|YP_002827614.1| dihydrolipoamide succinyltransferase [Sinorhizobium fredii NGR234]
 gi|227342643|gb|ACP26861.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Sinorhizobium fredii NGR234]
          Length = 413

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 104/422 (24%), Positives = 189/422 (44%), Gaps = 11/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  +  W K+ GD I   + L E+ETDK  +E  +   G + EI+
Sbjct: 1   MATEIRVPTLGESVSEATVGTWFKKVGDAIKADEPLLELETDKVTIEVPAPAAGTLSEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             AG E + + + +  I   +     +P  +++         +     V   +   + P 
Sbjct: 61  AQAG-ETVGLGALLGQIAEGAGAAAAAPAAAEKKPEPAAAAPAAQPAAVGTPQAQSSMPP 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A   A+ LA  +      + GSG  G+++K D+   ++   +    +          +  
Sbjct: 120 APAAAKLLAENNLSAD-QVDGSGKRGQVLKGDVLAAVAKGISAPAAAEPAKVQARAPATA 178

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            + +        E +    +R+TIA RL+ ++ T        + ++  ++SLR +     
Sbjct: 179 EDAV------REERVKMTRLRQTIARRLKDAQNTAAMLTTYNEVDMSAVMSLRNKYKDIF 232

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N     + +I   +  I VAV    G+V 
Sbjct: 233 EKK---HGVKLGFMGFFTKAVTHALKELPAVNAEIDGSDIIYKNYCHIGVAVGTDKGLVV 289

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI+R ADQ SI +I  ++ +L + A+   L   + QGGT +ISN G+ G      ++N P
Sbjct: 290 PIVRDADQMSIAEIEKDIGRLGKAARDGALSMADMQGGTFTISNGGVYGSLMSSPILNAP 349

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   + + V    ++ +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 350 QSGILGMHKIQDRPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 409

Query: 422 LM 423
           ++
Sbjct: 410 VL 411


>gi|165975913|ref|YP_001651506.1| dihydrolipoamide succinyltransferase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|303252124|ref|ZP_07338292.1| dihydrolipoamide succinyltransferase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307247460|ref|ZP_07529505.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307260936|ref|ZP_07542620.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|165876014|gb|ABY69062.1| dihydrolipoamide succinyltransferase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|302648907|gb|EFL79095.1| dihydrolipoamide succinyltransferase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|306855963|gb|EFM88121.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306869375|gb|EFN01168.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 409

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 116/422 (27%), Positives = 199/422 (47%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I  P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  + ++G++ EI 
Sbjct: 1   MTIEILTPVLPESVADATVATWHKKVGDTVKRDEVLVEIETDKVVLEVPAPNDGVLAEIS 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  I         +   ++E I +  E           E    +   
Sbjct: 61  QEQGA-TVTSKQLLGKIST-----VQAGDFTQETIKQANEATPADRKSAAIEYDHSDADS 114

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
             P  RRL  EH I+   + G+G  GRI + DIE  ++ +   +    + S      ++ 
Sbjct: 115 QGPAIRRLLAEHNIEAHLVKGTGVGGRITREDIEHYLAQRQVQETKQAMASEHNTVSTVA 174

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            +        S + +P   +RK IA RL ++K T        + ++  ++SLR+      
Sbjct: 175 YSA------RSEKRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMSLRKTYGEKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---HGVRLGFMSFYIKAVVEALKRYPEINASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR  D+ S+ DI   +K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVIRNCDKLSMADIEKTIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A + + V  N ++ +  +M   LS DHR +DG  +   L   K+ +E+P  +
Sbjct: 346 QSAILGMHAIKDRPVAVNGQVVIRPMMYLALSYDHRLIDGRESVGFLVAVKDLLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|15892687|ref|NP_360401.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           conorii str. Malish 7]
 gi|32129820|sp|Q92HK7|ODP2_RICCN RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component of pyruvate dehydrogenase complex; AltName:
           Full=Dihydrolipoamide acetyltransferase component of
           pyruvate dehydrogenase complex; AltName: Full=E2
 gi|15619860|gb|AAL03302.1| dihydrolipoamide acetyltransferase component [Rickettsia conorii
           str. Malish 7]
          Length = 412

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 175/422 (41%), Positives = 261/422 (61%), Gaps = 10/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEG LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I+
Sbjct: 1   MPIKILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +P  ++N+ VNS I  +  +  E         +N        + ++     E  +     
Sbjct: 61  IPQNSQNVPVNSLIAVLSEEGEEKTDIDAFIAKNNSVSPSPKTDANLPKPHENIANVEEQ 120

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            + +   ++      L+       + R                   S          S  
Sbjct: 121 VTVIKHDVSRIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQDILS-------YTPSTA 173

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            N +     + Y ++P++NIRK IA RL +SKQT+PHFY+SI+CN+D LL +RE +N   
Sbjct: 174 HNKIVSRNPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDIN--- 230

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +F  E+ S +ISVND I+ A A A+ +VP AN SW  +A+  + ++DISVAV+I  G+VT
Sbjct: 231 KFFSEDKSTRISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISVAVAIENGLVT 290

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI++ A+QK+IL++S E+K L ++AK  KL PEE+QGG  +ISN+GM GI +F A+INPP
Sbjct: 291 PIVKNANQKNILELSREMKALIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPP 350

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS I+ +GA  K+ + +N++I +ATIM+ TLSADHR VDGA+ ++ L  FK++IE+PV M
Sbjct: 351 QSCIMGVGASAKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLVAFKKFIESPVLM 410

Query: 422 LM 423
           L+
Sbjct: 411 LI 412


>gi|145634466|ref|ZP_01790176.1| 2-oxoglutarate dehydrogenase E2 component dihydrolipoamide
           succinyltransferase [Haemophilus influenzae PittAA]
 gi|145268446|gb|EDK08440.1| 2-oxoglutarate dehydrogenase E2 component dihydrolipoamide
           succinyltransferase [Haemophilus influenzae PittAA]
          Length = 409

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 102/422 (24%), Positives = 189/422 (44%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD +   +++ EIETDK ++E  ++ +G++ E++
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKLGDTVKRDEVIVEIETDKVVLEVPALSDGVLAEVV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +     +  I         S  L   N     +  + +      +   ++  I
Sbjct: 61  QAEG-ETVVSKQLLGKISTAQEGDVSSATLKATNEPTPSDRQNAAIENSHNDNADQSPAI 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              LA        I  S + G      I +   +                   +   +  
Sbjct: 120 RRLLAEHDLQADQIQGSGVGGRLTREDIEREIAKRQAQQVKQEVATEQNTISTVAYSA-- 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                     S + +P   +RK IA RL ++K +        + ++  +++LR+      
Sbjct: 178 ---------RSEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMQPIMTLRKTYGEKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +      S ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---HSVRLGFMSFYIKAVVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ +I  ++K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVLRDCDKLSMAEIEKQIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +  N ++ +  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 346 QSAILGMHAIKERPIALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|90421714|ref|YP_530084.1| dihydrolipoamide succinyltransferase [Rhodopseudomonas palustris
           BisB18]
 gi|90103728|gb|ABD85765.1| 2-oxoglutarate dehydrogenase E2 component [Rhodopseudomonas
           palustris BisB18]
          Length = 434

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 93/436 (21%), Positives = 177/436 (40%), Gaps = 19/436 (4%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I +P+L  ++TE  + +W K+ GD ++  + L E+ETDK  +E  +   G + EI+ 
Sbjct: 1   MTEIRVPTLGESVTEATIGRWFKKAGDAVAVDEPLVELETDKVTIEVPAPSAGTLGEIVA 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G E +AV + +  I   + +  P        +                +  +      
Sbjct: 61  KDG-ETVAVGALLGQITDGAAKAAPKDAAKASGVAPETTTGRPDLKTDGTKPINAGPEEP 119

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
                  A    +   +           ++ ++      +      T        E   +
Sbjct: 120 RLRPEAKAEAKSLPADTPQAPSVRRLSAENGVDAATVPGSGKDGRVTKGDMLAAIEKAAS 179

Query: 183 NILNLFAKD---------------SYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNI 227
               +                     E +    +R+TIA RL++ + T        + ++
Sbjct: 180 APTPVDQPAAAVQVRSPSPADDAAREERVKMTRLRQTIARRLKEVQNTAAMLTTFNEVDM 239

Query: 228 DNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI 287
            ++++LR Q     +       +K+      ++A   A+  +P AN       +I   + 
Sbjct: 240 SHIMALRAQYKEVFEKRHH---SKLGFMGFFVRACVQALKDIPAANAEIDGTDLIYKNYY 296

Query: 288 DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMG 347
            I VAV    G+V P++R  D KSI  I   +    +RA+  +LK +E QGGT +I+N G
Sbjct: 297 HIGVAVGTDKGLVVPVVRDCDHKSIAQIEKSIADFGKRARDGQLKIDEMQGGTFTITNGG 356

Query: 348 MLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKL 407
           + G      ++N PQS IL +   +++ V    ++++  +M   LS DHR +DG  A   
Sbjct: 357 IYGSLMSTPILNAPQSGILGMHKIQERPVAIAGKVEIRPMMYLALSYDHRVIDGKDAVTF 416

Query: 408 LAKFKEYIENPVWMLM 423
           L + KE +E+P  +++
Sbjct: 417 LVRVKESLEDPTRLVL 432


>gi|307245293|ref|ZP_07527381.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307254242|ref|ZP_07536083.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307258704|ref|ZP_07540436.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306853634|gb|EFM85851.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306862789|gb|EFM94742.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306867055|gb|EFM98911.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 409

 Score =  300 bits (768), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 115/422 (27%), Positives = 199/422 (47%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I  P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  + ++G++ EI 
Sbjct: 1   MTIEILTPVLPESVADATVATWHKKVGDTVKRDEVLVEIETDKVVLEVPAPNDGVLAEIS 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  I         +   ++E I +  E           E    +   
Sbjct: 61  QEQGA-TVTSKQLLGKIST-----VQAGDFTQETIKQANEATPADRKSAAIEYDHSDAES 114

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
             P  RRL  EH I+   + G+G  GRI + DIE  ++ +   +    + S      ++ 
Sbjct: 115 QGPAIRRLLAEHNIEAHLVKGTGVGGRITREDIEHYLAQRQAQETKQAMASEHNTVSTVA 174

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            +        S + +P   +RK IA RL ++K T        + ++  +++LR+      
Sbjct: 175 YSA------RSEKRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMTLRKTYGEKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---HGVRLGFMSFYIKAVVEALKRYPEINASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR  D+ S+ DI   +K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVIRNCDKLSMADIEKTIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A + + V  N ++ +  +M   LS DHR +DG  +   L   K+ +E+P  +
Sbjct: 346 QSAILGMHAIKDRPVAVNGQVVIRPMMYLALSYDHRLIDGRESVGFLVAVKDLLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|170747357|ref|YP_001753617.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Methylobacterium radiotolerans JCM
           2831]
 gi|170653879|gb|ACB22934.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Methylobacterium radiotolerans JCM
           2831]
          Length = 439

 Score =  300 bits (768), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 98/441 (22%), Positives = 176/441 (39%), Gaps = 23/441 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  + +W K+ GD ++  + + E+ETDK  +E  +   G + EIL
Sbjct: 1   MATDILVPTLGESVSEATIGRWFKKPGDTVAADEPIVELETDKVTLEVNAPAAGQLGEIL 60

Query: 62  VPAGTENIAVNSPILNI-------------------LMDSTEIPPSPPLSKENIVEVREE 102
           V  G E +   + + +I                      +     +P  +     E   +
Sbjct: 61  VKDG-ETVEPGALLGSIVEAGAGAGAGKKAAPKEAAETKAESRSEAPKAAAPARAEAPAQ 119

Query: 103 HSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKT 162
            S +      +  +             A       S +  S  +G      +        
Sbjct: 120 ESSAGYGNHGDAAAPAAQQRPVSDNGPAVAKLARESGVDPSSVNGSGKDGRVTKGDMLGA 179

Query: 163 NVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVS 222
             K  +          ++             E +    +R+TIA RL+ ++ T       
Sbjct: 180 IAKGPAPSAPAKEARPTLPRAPSAPDDAAREERVRMTKLRQTIARRLKDAQDTAAMLTTF 239

Query: 223 IDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMI 282
            D ++  ++++R Q     +        K+       KA   A+  VP  N       ++
Sbjct: 240 NDVDMSAVMAMRSQYKDIFEKK---HGTKLGFMGFFTKAVIGALKDVPAVNAEIDGQDLV 296

Query: 283 RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTS 342
              +  I +AV    G+V P++R AD  SI  I  ++    ++A+  KL  EE QGGT +
Sbjct: 297 YKNYYHIGIAVGTDKGLVVPVVRDADDLSIAGIEKKIAGFGKKARDGKLSIEEMQGGTFT 356

Query: 343 ISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGA 402
           I+N G+ G      ++N PQS IL +   E++ V +  +I+   +M   LS DHR VDG 
Sbjct: 357 ITNGGIYGSLMSTPILNAPQSGILGMHRIEERPVVRAGKIEARPMMYLALSYDHRIVDGK 416

Query: 403 IASKLLAKFKEYIENPVWMLM 423
            A   L + KE +E+P  +++
Sbjct: 417 EAVTFLVRVKEALEDPARLVL 437


>gi|325294004|ref|YP_004279868.1| dihydrolipoamide succinyltransferase [Agrobacterium sp. H13-3]
 gi|325061857|gb|ADY65548.1| dihydrolipoamide succinyltransferase [Agrobacterium sp. H13-3]
          Length = 410

 Score =  300 bits (768), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 100/422 (23%), Positives = 190/422 (45%), Gaps = 14/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  +  W K+ GD +   + L E+ETDK  +E  +   G++ EI+
Sbjct: 1   MATEIRVPTLGESVSEATVGTWFKKVGDTVKADEPLVELETDKVTVEVPAPASGVLTEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  G E + +++ +  I             S           + +    V    + +   
Sbjct: 61  VQNG-ETVGLDALLGQIAE----GAAGAATSAPAAKSAAPAAAPAPAAAVAAAPAGSAMP 115

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +P A +L  E+ +    + GSG  G+++K D+   ++   +    + + +      S +
Sbjct: 116 PAPAAGKLLAENNLSADQVDGSGKRGQVLKGDVLAAVAKGVSAPAAAPVAAAAPRPVSAE 175

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            + +        E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 176 QDQV------REERVKMTRLRQTIARRLKDAQNTAAMLTTYNEVDMSAVMDLRNRYKDVF 229

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       +I   +  + +AV    G+V 
Sbjct: 230 EKK---HGVKLGFMGFFTKAVTHALKELPAVNAEIDGTDIIYKNYCHVGMAVGTDKGLVV 286

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI  +  E+ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 287 PVIRDADQLSIAGVEKELGRLAKAARDGSLGMADMQGGTFTITNGGVYGSLMSSPILNAP 346

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ V    ++ +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 347 QSGILGMHKIQERPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 406

Query: 422 LM 423
           ++
Sbjct: 407 VL 408


>gi|299135442|ref|ZP_07028632.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Afipia sp. 1NLS2]
 gi|298589850|gb|EFI50055.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Afipia sp. 1NLS2]
          Length = 411

 Score =  300 bits (768), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 101/422 (23%), Positives = 184/422 (43%), Gaps = 13/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + +W K+ GD ++  + L E+ETDK  +E  +   G + EI+
Sbjct: 1   MA-EIRVPTLGESVTEATIGRWFKKTGDAVAVDEPLVELETDKVTIEVPAPSAGTLGEIV 59

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +AV + +  I   + +   + P        V    + +         +   P 
Sbjct: 60  AKDG-ETVAVGALLGQITEGAGKPAAAKPAEAVPAKPVAAAAAPAPAQKSPPADAPQAPS 118

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              L+     + G    S          + + IE   ++ T +   +          + D
Sbjct: 119 VRKLSAESGIDAGTVPGSGKDGRVTKGDMMAAIEKAAASPTPINQPAASLQVRAPSPADD 178

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A           E +    +R+TIA RL+  + T        + ++ N+++LR       
Sbjct: 179 AA--------REERVKMTRLRQTIARRLKDVQNTAAMLTTFNEVDMTNVMALRAHYKDLF 230

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+      +KA   A+ +VP  N       ++   +  + VAV    G+V 
Sbjct: 231 EKKHH---AKLGFMGFFVKACVQALKEVPAVNAEIDGTDLVYKNYYHVGVAVGTDKGLVV 287

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R+ D KSI +I   +    +RA+  +LK +E QGGT +I+N G+ G      ++N P
Sbjct: 288 PVVRECDHKSIAEIETTIADFGRRARDGQLKIDEMQGGTFTITNGGIYGSLMSTPILNAP 347

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   +++ V    +I+V  +M   LS DHR +DG  A   L + KE +E+P  +
Sbjct: 348 QAGILGMHKIQERPVVVGGKIEVRPMMYLALSYDHRVIDGKEAVTFLVRVKENLEDPARL 407

Query: 422 LM 423
           ++
Sbjct: 408 VL 409


>gi|110680209|ref|YP_683216.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Roseobacter denitrificans OCh 114]
 gi|109456325|gb|ABG32530.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Roseobacter denitrificans OCh 114]
          Length = 431

 Score =  300 bits (768), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 192/434 (44%), Positives = 276/434 (63%), Gaps = 17/434 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD ++ GDI+ EIETDKA MEFE+VDEG I +IL
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWLVKEGDTVASGDIMAEIETDKATMEFEAVDEGTIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPP-------SPPLSKENIVEVREEHSHSSPVVVREK 114
           V  GTE + VN+PI  +L D             +   +KE+      E + +      + 
Sbjct: 61  VEEGTEGVKVNTPIAVLLEDGESADDISAEPEPAAAATKEDAPAPTPEPTATPAPAAPQS 120

Query: 115 HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFG 174
              +R  ASPLARR+A  +G+DL+++ GSGPHGRIVK+D+E L ++       +   +  
Sbjct: 121 SDGSRIFASPLARRIAASNGVDLATVKGSGPHGRIVKADVEGLSASAAAPAPAAPGPAAP 180

Query: 175 LVDE-----SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
                         ++ ++   +Y+ I  + +RKTIA RL ++KQ+IPHFY+  D  +D 
Sbjct: 181 APSAPVASGPAAEAVMAMYEGRAYDEISLNGMRKTIAARLTEAKQSIPHFYLRRDIELDA 240

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDI 289
           LL+ R Q+N+ L+        K+SVND I+KA ALA+  VP+AN  W  + M++    D+
Sbjct: 241 LLAFRGQLNKQLESR----GVKLSVNDFIIKACALALQTVPDANAVWAGDRMLKLTPSDV 296

Query: 290 SVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGML 349
           +VAV+I GG+ TP++R A+ KS+  +S E+K LA RA+ RKL P EYQGG+ +ISN+GM 
Sbjct: 297 AVAVAIEGGLFTPVLRDAEMKSLSALSAEMKDLAARARDRKLAPHEYQGGSFAISNLGMF 356

Query: 350 GINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHRSVDGAIASKLL 408
           GI++F AVINPP   ILA+GAG KK V  ++ E+ VAT+M+ TLS DHR +DGA+ ++L+
Sbjct: 357 GIDNFDAVINPPHGAILAVGAGVKKPVVGKDGELAVATVMSVTLSVDHRVIDGALGAQLI 416

Query: 409 AKFKEYIENPVWML 422
           +  KE +ENP+ ML
Sbjct: 417 SAIKENLENPMTML 430


>gi|238650228|ref|YP_002916079.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           peacockii str. Rustic]
 gi|238624326|gb|ACR47032.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           peacockii str. Rustic]
          Length = 412

 Score =  300 bits (767), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 174/422 (41%), Positives = 261/422 (61%), Gaps = 10/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEG LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I+
Sbjct: 1   MPIKILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +P  ++N+ VNS I  +  +  E         +N        + ++     E  +     
Sbjct: 61  IPQNSQNVPVNSLIAVLSEEGEEKTDIDAFIAKNNSVSPSPKTDANLPKPHENITNVEEQ 120

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            + +    +      L+       + R                   S          +  
Sbjct: 121 VTVIKHDASKIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQDILS-------YTPNTA 173

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            N +     + Y ++P++NIRK IA RL +SKQT+PHFY+SI+CN+D LL +RE +N++ 
Sbjct: 174 HNKIVSRNPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKSF 233

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
               E+ S +ISVND I+ A A A+ +VP AN SW  +A+  + ++DISVAV+I  G+VT
Sbjct: 234 ---SEDKSTRISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISVAVAIENGLVT 290

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI++ A+QK+IL++S E+K L ++AK  KL PEE+QGG  +ISN+GM GI +F A+INPP
Sbjct: 291 PIVKNANQKNILELSREMKALIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPP 350

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS I+ +GA  K+ + +N++I +ATIM+ TLSADHR VDGA+ ++ LA FK++IE+PV M
Sbjct: 351 QSCIMGVGASAKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLAAFKKFIESPVLM 410

Query: 422 LM 423
           L+
Sbjct: 411 LI 412


>gi|86359468|ref|YP_471360.1| dihydrolipoamide acetyltransferase [Rhizobium etli CFN 42]
 gi|86283570|gb|ABC92633.1| dihydrolipoamide succinyltransferase subunit of 2-oxoglutarate
           dehydrogenase complex protein [Rhizobium etli CFN 42]
          Length = 418

 Score =  300 bits (767), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 95/422 (22%), Positives = 178/422 (42%), Gaps = 6/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  +  W K+ GD I   + + E+ETDK  +E  +   G + EI+
Sbjct: 1   MATEIRVPTLGESVSEATVGTWFKKVGDAIKADEPILELETDKVTIEVPAPVSGTLSEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             AG E +   + +  I   +     +P  +       +   + ++        S     
Sbjct: 61  AAAG-ETVGPGALLGQIAEGAGAAAAAPAAAAPAAAPSQAVPAAAAQPAAAASSSSASVS 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
             P A   A        S       G+  +     +I+                   +  
Sbjct: 120 TMPPAPAAAKMLAESNLSADQVDGSGKRGQVLKGDVIAAVAKGISAPAAAPAAAPAAARG 179

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            + +   +++  E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 180 PSTVEDASRE--ERVKMTRLRQTIAKRLKDAQNTAAMLTTYNEVDMKAVMDLRNKYKDIF 237

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       +I   +  + +AV    G+V 
Sbjct: 238 EKK---HGVKLGFMGFFTKAVTHALKELPAVNAEIDGTDVIYKNYCHVGMAVGTDKGLVV 294

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI +I  ++ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 295 PVIRDADQMSIAEIEKDLGRLAKAARDGSLSMADMQGGTFTITNGGVYGSLMSSPILNAP 354

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ V    ++ +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 355 QSGILGMHKIQERPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 414

Query: 422 LM 423
           ++
Sbjct: 415 VL 416


>gi|148825798|ref|YP_001290551.1| alpha-ketoglutarate decarboxylase [Haemophilus influenzae PittEE]
 gi|148715958|gb|ABQ98168.1| alpha-ketoglutarate decarboxylase [Haemophilus influenzae PittEE]
          Length = 409

 Score =  300 bits (767), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 101/422 (23%), Positives = 188/422 (44%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD +   +++ EIETDK ++E  ++ +G++ E++
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKLGDTVKRDEVIVEIETDKVVLEVPALSDGVLAEVV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + +     +  I         S  L   N     +  + +          ++  I
Sbjct: 61  QAEG-KTVVSKQLLGKISTAQEGDVSSATLKATNEPTPSDRQNAAIENSHNHNADQSPAI 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              LA        I  S + G      I +   +                   +   +  
Sbjct: 120 RRLLAEHDLQADQIQGSGVGGRLTREDIEREIAKRQAQQVKQEAATEQNTISTVAYSA-- 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                     S + +P   +RK IA RL ++K +        + ++  +++LR+      
Sbjct: 178 ---------RSEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMQPIMTLRKTYGEKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +      S ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---HSVRLGFMSFYIKAVVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ +I  ++K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVLRDCDKLSMAEIEKQIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +  N ++ +  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 346 QSAILGMHAIKERPIALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|163736627|ref|ZP_02144046.1| Dihydrolipoamide acetyltransferase, long form [Phaeobacter
           gallaeciensis BS107]
 gi|161390497|gb|EDQ14847.1| Dihydrolipoamide acetyltransferase, long form [Phaeobacter
           gallaeciensis BS107]
          Length = 441

 Score =  300 bits (767), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 185/444 (41%), Positives = 270/444 (60%), Gaps = 27/444 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD ++ GD+L EIETDKA MEFE+VDEG+I +IL
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWLVKEGDTVASGDLLAEIETDKATMEFEAVDEGVIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPP----------------SPPLSKENIVEVREEHSH 105
           +P G+E + VNSPI  +L D                           +      +   + 
Sbjct: 61  IPEGSEGVKVNSPIAVLLEDGESADDIGATPAAPAAAANKAAPAASEEAASAPAQATTAA 120

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           +      +    NR  ASPLARR+A + G+DLS L+GSGP GRIVK+D+E          
Sbjct: 121 TPAPAAPQGADGNRIFASPLARRIAADKGLDLSQLNGSGPRGRIVKADVENAKPQAAAAP 180

Query: 166 DYSTIQSFGLVDESIDA------NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
             +   +      +          +  ++   +YE +  D +RKTIA RL ++KQT+PHF
Sbjct: 181 AAAAPATAAASAAAAAPTGPSADQVARMYEGRTYEEVKLDGMRKTIAARLTEAKQTVPHF 240

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN 279
           Y+  D  +D LL  R ++N+ L+        K+SVND I+KA ALA+  VP+AN  W  +
Sbjct: 241 YLRRDIQLDALLKFRGELNKQLEAR----GVKLSVNDFIIKACALALQAVPDANAVWAGD 296

Query: 280 AMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
            +++ +  D++VAV+I GG+ TP+++ +D KS+  +S E+K LA+RA+ RKL P EYQGG
Sbjct: 297 RVLKMEASDVAVAVAIEGGLFTPVLQNSDTKSLSTLSTEMKDLAKRARDRKLAPHEYQGG 356

Query: 340 TTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHRS 398
           + +ISN+GM GI++F A++NPP + ILA+GAG KK V   + E+ VAT+M+ T+S DHR 
Sbjct: 357 SFAISNLGMFGIDNFDAIVNPPHAGILAVGAGVKKPVVGADGELAVATVMSVTMSVDHRV 416

Query: 399 VDGAIASKLLAKFKEYIENPVWML 422
           +DGA+ ++LL   K+ +ENP+ ML
Sbjct: 417 IDGALGAELLNAIKDNLENPMMML 440


>gi|294012417|ref|YP_003545877.1| 2-oxoglutarate dehydrogenase E2 component [Sphingobium japonicum
           UT26S]
 gi|292675747|dbj|BAI97265.1| 2-oxoglutarate dehydrogenase E2 component [Sphingobium japonicum
           UT26S]
          Length = 412

 Score =  300 bits (767), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 89/422 (21%), Positives = 175/422 (41%), Gaps = 12/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P+L  ++TE  + +W+K+ G+ +   + +  +ETDK  ++  +   G++ +I+
Sbjct: 1   MATEVKVPTLGESVTEATVGQWLKKPGEAVKADEPIVSLETDKVAVDVPAPVAGVLGDIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + +  +   +                     + ++     ++       
Sbjct: 61  AKEG-DTVEVGALLAYVNEGAAAAAAPAAAPAPAAKAEAAAPAPAASAPADDE------- 112

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                  L+      +          +    D               T ++      +  
Sbjct: 113 -EGGNLTLSPAVRRLVLEHGLDPSKIKGTGKDGRLTKDDVVAAAAAGTAKAAASAPAAAP 171

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A         + E +    +R+T+A RL++++          D ++ N++  R +     
Sbjct: 172 AAAPAAGPSRAQERVKMTRLRQTVAKRLKEAQNNAALLTTYNDVDMTNVIEARAKYKDLF 231

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++       KA  +A+  +P  N     + ++ +   DISVAVS P G+V 
Sbjct: 232 EKK---HGVRLGFMGFFTKAVCMALRDIPGVNAQIEGDEIVYNDFADISVAVSAPNGLVV 288

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR A+  S+ DI   +    ++AK+  L  E+ +GGT +ISN G+ G      +INPP
Sbjct: 289 PVIRNAESLSVADIEKTIGNFGKKAKEGTLTMEDMKGGTFTISNGGVFGSLLSSPIINPP 348

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS +L +   E + V +N +I +  +M   LS DHR +DG  A   L   K  IE+P  +
Sbjct: 349 QSAVLGLHRIEDRPVVRNGQIVIRPMMYLALSYDHRLIDGREAVTFLVAVKNAIEDPTRL 408

Query: 422 LM 423
           L+
Sbjct: 409 LI 410


>gi|68250263|ref|YP_249375.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Haemophilus influenzae 86-028NP]
 gi|68058462|gb|AAX88715.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Haemophilus influenzae 86-028NP]
 gi|309972944|gb|ADO96145.1| 2-oxoglutarate dehydrogenase E2 component dihydrolipoamide
           succinyltransferase [Haemophilus influenzae R2846]
          Length = 409

 Score =  299 bits (766), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 101/422 (23%), Positives = 187/422 (44%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD +   +++ EIETDK ++E  ++ +G++ E++
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKLGDTVKRDEVIVEIETDKVVLEVPALSDGVLAEVV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +     +  I         S  L   N     +  + +          ++  I
Sbjct: 61  QAEG-ETVVSKQLLGKISTAQEGDVSSATLKATNEPTPSDRQNAAIENSHNHNADQSPAI 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              LA        I  S + G      I +   +                   +   +  
Sbjct: 120 RRLLAEHDLQADQIQGSGVGGRLTREDIEREIAKRQAQQVKQEAATEQNTISTVAYSA-- 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                     S + +P   +RK IA RL ++K +        + ++  +++LR+      
Sbjct: 178 ---------RSEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMQPIMTLRKTYGEKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---YGVRLGFMSFYIKAVVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ +I  ++K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVLRDCDKLSMAEIEKQIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +  N ++ +  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 346 QSAILGMHAIKERPIALNGQVVIHPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|84515871|ref|ZP_01003232.1| dihydrolipoamide acetyltransferase [Loktanella vestfoldensis SKA53]
 gi|84510313|gb|EAQ06769.1| dihydrolipoamide acetyltransferase [Loktanella vestfoldensis SKA53]
          Length = 403

 Score =  299 bits (766), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 98/422 (23%), Positives = 173/422 (40%), Gaps = 21/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P+L  ++TE  +A W K+ GD ++  ++LCE+ETDK  +E  S   G + EI+
Sbjct: 1   MSTEVRVPTLGESVTEATVATWFKKPGDAVAVDEMLCELETDKVTVEVPSPVAGTLSEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E + V++ +  I   ++      P +         + + +               
Sbjct: 61  AAEG-ETVGVDALLAQIAEGASAPVKEAPKAAPAPDAAATQTNAAPEETKPRDPEDAPSA 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              +A     +                   +      +  +                   
Sbjct: 120 KKLMADSGISDVTGTGKDGRVMKEDVLKALTAKSDAAAPASA-----------------P 162

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
              +    +   E +    +R+TIA RL+ S+ T        + ++  +++LR+      
Sbjct: 163 RAPVAASDEAREERVKMTRLRQTIAKRLKDSQNTAAMLTTYNEVDMTEVMALRDAYKDLF 222

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
                    K+       KA   A+ +VPE N       ++   ++ + +A   P G+V 
Sbjct: 223 FKK---HGVKLGFMSFFTKACIHALHEVPEVNAEIDGTDVVYKNYVHMGIAAGTPTGLVV 279

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ S  DI   +  +  +A+  KL   E QGGT +ISN G+ G      ++NPP
Sbjct: 280 PVIRDADQMSFADIEKAIAAMGAKARDGKLSMAEMQGGTFTISNGGVYGSLMSSPILNPP 339

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   + + +  N ++ +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 340 QSGILGMHKIQDRPMAINGQVVIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRL 399

Query: 422 LM 423
           LM
Sbjct: 400 LM 401


>gi|262277901|ref|ZP_06055694.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [alpha proteobacterium HIMB114]
 gi|262225004|gb|EEY75463.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [alpha proteobacterium HIMB114]
          Length = 418

 Score =  299 bits (766), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 101/422 (23%), Positives = 185/422 (43%), Gaps = 6/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  +AKWIK+ GD ++  + + E+ETDK  +E  S   G++ EI 
Sbjct: 1   MSTPILVPTLGESVTEATVAKWIKKSGDNVNEDEPIVELETDKVSVEVTSPTSGVLSEIS 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +  G E + V + +  I    +       + KE       +    S +  +E+    +  
Sbjct: 61  IKEG-ETVGVGTKLGEIGEVGS--VSIAQVKKEENKVKEIKKEEISDISKKEELILEKEA 117

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
               A ++   +    S          IV+++++      T  +          +     
Sbjct: 118 PQKEAAKVVPINLEKKSVDPSPAAKRVIVENNLDVSSIQGTGKRGQILKSDLIGLMGVNP 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                   K   E +    +R TIA RL++++ T        + ++  ++ +R+      
Sbjct: 178 GLDKKFQDKGPEERVKMTRLRATIAKRLKEAQNTAAMLTTFNEVDMSMIMQIRKDNKEEF 237

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+      +KA   A+   P  N       ++   + +I VAV    G+V 
Sbjct: 238 EK---IYGVKLGFMSFFVKACVSALQTFPAVNAEIQGEEIVYKNYYNIGVAVGTDKGLVV 294

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ S  DI  E+  L  +++  +L  EE QGGT +I+N G+ G      ++NPP
Sbjct: 295 PVVRSADQMSFADIEKEIINLGGKSRDGQLSIEELQGGTFTITNGGIYGSMLSTPILNPP 354

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS +L +    ++ +  N +I++  +M   LS DHR +DG  A   L + KE +E+P  +
Sbjct: 355 QSGVLGMHNIVQRPIVINGKIEIRPMMYLALSYDHRIIDGKEAVSFLVRVKEILEDPRRL 414

Query: 422 LM 423
            +
Sbjct: 415 FL 416


>gi|126730344|ref|ZP_01746155.1| dihydrolipoamide acetyltransferase [Sagittula stellata E-37]
 gi|126709077|gb|EBA08132.1| dihydrolipoamide acetyltransferase [Sagittula stellata E-37]
          Length = 510

 Score =  299 bits (766), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 96/421 (22%), Positives = 171/421 (40%), Gaps = 18/421 (4%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
              + +P+L  ++TE  ++ W K+ GD ++  ++LCE+ETDK  +E  +   G + EI+ 
Sbjct: 106 SVDVVVPTLGESVTEATVSTWFKKVGDSVTQDEMLCELETDKVSVEVPAPASGTLTEIVA 165

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G E +  N+ +  I             +     +     +                  
Sbjct: 166 QEG-ETVEANAKLAVIASGEGVSAAPKAETAPKDTQYSTPPAGDG--------------G 210

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
                +        ++    S    +    D     +        +          S   
Sbjct: 211 PGKDIKDGPAAEKAMAEAGVSRDQVKGTGKDGRATKADVAAAVAAANASPATSAPASAPR 270

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
             +    +   E +    +R+TIA RL+ ++ T        + ++  +++LR +     +
Sbjct: 271 APVAAQDEAREERVKMTRLRQTIARRLKDAQNTAAILTTYNEVDMTEVMALRSEYKDLFE 330

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                   ++       KA   A+ +VPE N       ++    + + +A   P G+V P
Sbjct: 331 KK---HGVRLGFMSFFTKACCHALKEVPEVNAEIDGTDIVYKNFVHMGIAAGTPQGLVVP 387

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           +IR AD  S  +I   + +  +RA+  KL   E QGGT +ISN G+ G      ++NPPQ
Sbjct: 388 VIRDADSMSFAEIEKAINEKGKRARDGKLSMAEMQGGTFTISNGGVYGSLMSSPILNPPQ 447

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL +   + + +  N EIK+  +M   LS DHR VDG  A   L + KE +E+P  +L
Sbjct: 448 SGILGMHKIQDRPMVINGEIKIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRLL 507

Query: 423 M 423
           M
Sbjct: 508 M 508



 Score =  131 bits (330), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 49/92 (53%), Gaps = 1/92 (1%)

Query: 3  IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
          +  + +P+L  ++TE  +A W K+ GD ++  ++LCE+ETDK  +E  S   G + +I+ 
Sbjct: 1  MTEVRVPTLGESVTEATVATWFKKPGDSVAVDEMLCELETDKVTVEVPSPVAGTLSDIVA 60

Query: 63 PAGTENIAVNSPILNILMDSTEIPPSPPLSKE 94
            G + + V++ + NI    +  P      + 
Sbjct: 61 KEG-DTVGVDALLANIAESGSAGPEETKPREN 91


>gi|90421036|ref|ZP_01228939.1| 2-oxoglutarate dehydrogenase, E2 dihydrolipoamide
           succinyltransferase component [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90334671|gb|EAS48448.1| 2-oxoglutarate dehydrogenase, E2 dihydrolipoamide
           succinyltransferase component [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 428

 Score =  299 bits (766), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 101/430 (23%), Positives = 177/430 (41%), Gaps = 12/430 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + +W K+ GD++   + L E+ETDK  +E  +   G++ +I 
Sbjct: 1   MSTEIKVPTLGESVTEATIGQWFKKPGDRVEMDETLAELETDKVTVEVPAPAAGVLQDIA 60

Query: 62  VPAGTENIAVNSPILNIL------MDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKH 115
           VP G E +AV + I +I         +T     P   +       E  +        +  
Sbjct: 61  VPEG-ETVAVGTVIGSIGEGSGSSAGTTAPTEKPKSQEAKADAGGETKADYGGGAKGDAA 119

Query: 116 SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGL 175
           S  +          A      +    G              ++             S   
Sbjct: 120 SPAQEAGKGSGEMPAAPSARKMMEEKGLSDGDVAGSGKRGQVLKGDVLETIARGAPSSPQ 179

Query: 176 VDESIDANILNLFAKDS--YEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSL 233
               + A        D    E +    +R+TIA RL+ ++ T        + ++  ++ +
Sbjct: 180 EKPQVPAARAPSAGDDESREERVKMTRLRQTIARRLKDAQDTAAMLTTFNEVDMTAVMEM 239

Query: 234 REQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAV 293
           R++     +        K+       KA   A+ +VP  N       +I   +  I VAV
Sbjct: 240 RKKYKDLFEKK---HGVKLGFMGFFTKAVCHALKEVPAVNAEIDGTDLIYKNYAHIGVAV 296

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
               G+V P++R ADQ SI ++  E+ +L   A+  KL   + QGGT +ISN G+ G   
Sbjct: 297 GTAKGLVVPVVRDADQMSIAEVEKEIGRLGLMARDGKLGVSDMQGGTFTISNGGVYGSLM 356

Query: 354 FCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKE 413
              ++N PQS IL +   +++ +    ++ +  +M   LS DHR VDG  A   L + KE
Sbjct: 357 STPILNAPQSGILGMHKIQERPMAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKE 416

Query: 414 YIENPVWMLM 423
            +E+P  +++
Sbjct: 417 SLEDPERLVL 426


>gi|255263686|ref|ZP_05343028.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Thalassiobium sp. R2A62]
 gi|255106021|gb|EET48695.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Thalassiobium sp. R2A62]
          Length = 431

 Score =  299 bits (766), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 166/434 (38%), Positives = 237/434 (54%), Gaps = 17/434 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+VDEG I +IL
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWLVKEGDTVSSGDLLAEIETDKATMEFEAVDEGTIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPP------------SPPLSKENIVEVREEHSHSSPV 109
           +  GTE +AVN+ I  +L D                      S +           +   
Sbjct: 61  IAEGTEGVAVNTAIAVLLEDGESADDIGSAPAAAAAPAPAAKSDDAPGAPVAAAPSAPAA 120

Query: 110 VVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYST 169
                +      +    R  A +                +                    
Sbjct: 121 APVANNGTRIFASPLARRIAADKGLDLSQMAGSGPKGRIVKADVQGAAAQPAKPAASAPA 180

Query: 170 IQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
             +  +        ++ ++   S+E +P   +RK +A RL ++KQTIPHFY+  D  IDN
Sbjct: 181 ATTAPMASGPSSDAVIKMYEGRSFEEVPLSGMRKVVATRLTEAKQTIPHFYLRRDIQIDN 240

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDI 289
           LLS R Q+N+ L+        K+SVND I+KA ALA+   PEAN  W  +  ++ +  D+
Sbjct: 241 LLSFRAQLNKQLEAR----GVKLSVNDFIIKACALALQSNPEANAVWAGDRTLKMEASDV 296

Query: 290 SVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGML 349
           +VAV+I GG+ TP+++ A+ +S+  +S E+K LA RA+ RKL P EYQGG+ +ISN+GM 
Sbjct: 297 AVAVAIEGGLFTPVLQDAENRSLSALSAEMKDLASRARDRKLAPHEYQGGSFAISNLGMF 356

Query: 350 GINSFCAVINPPQSTILAIGAGEKKV-VFQNEEIKVATIMNATLSADHRSVDGAIASKLL 408
           GI++F AVINPP   ILA+GAG+K+  V  + E+ VATIM+ TLS DHR +DGA+ ++LL
Sbjct: 357 GIDNFDAVINPPHGAILAVGAGKKRPHVGADGELGVATIMSCTLSVDHRVIDGALGAELL 416

Query: 409 AKFKEYIENPVWML 422
               + +ENP+ ML
Sbjct: 417 QSIVDNLENPMGML 430


>gi|15889890|ref|NP_355571.1| dihydrolipoamide acetyltransferase [Agrobacterium tumefaciens str.
           C58]
 gi|15157839|gb|AAK88356.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Agrobacterium tumefaciens str.
           C58]
          Length = 410

 Score =  299 bits (766), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 99/422 (23%), Positives = 186/422 (44%), Gaps = 14/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  +  W K+ GD +   + L E+ETDK  +E  +   G++ EI+
Sbjct: 1   MATEIRVPTLGESVSEATVGTWFKKVGDTVKADEPLVELETDKVTVEVPAPASGVLTEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E + +++ +  I             S           + +    V      +   
Sbjct: 61  AQNG-ETVGLDALLGQIAE----GAAGAATSAPAAKPAAPAAAPAPAAAVAAAPGGSAMP 115

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +P A +L  E+ +    + GSG  G+++K D+   ++   +    +          S +
Sbjct: 116 PAPAAGKLLAENNLSADQVDGSGKRGQVLKGDVLAAVAKGVSAPAAAPAPVAAPRPVSAE 175

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            + +        E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 176 QDQV------REERVKMTRLRQTIARRLKDAQNTAAMLTTYNEVDMSAVMDLRNRYKDVF 229

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       +I   +  + +AV    G+V 
Sbjct: 230 EKK---HGVKLGFMGFFTKAVTHALKELPAVNAEIDGTDIIYKNYCHVGMAVGTDKGLVV 286

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI  +  E+ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 287 PVIRDADQLSIAGVEKELGRLAKAARDGSLGMADMQGGTFTITNGGVYGSLMSSPILNAP 346

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ V    ++ +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 347 QSGILGMHKIQERPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 406

Query: 422 LM 423
           ++
Sbjct: 407 VL 408


>gi|157964579|ref|YP_001499403.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           massiliae MTU5]
 gi|157844355|gb|ABV84856.1| Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rickettsia massiliae MTU5]
          Length = 412

 Score =  299 bits (765), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 173/422 (40%), Positives = 261/422 (61%), Gaps = 10/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEG LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I+
Sbjct: 1   MPIKILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +P  ++N+ VNS I  +  +  E         +N        + ++ +   E  +     
Sbjct: 61  IPQNSQNVPVNSLIAVLSEEGEEKTDIDAFIAKNNSVSPSPKTDANLLKPHENIANVEEQ 120

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            + +    +      L+       + R                   S          S  
Sbjct: 121 VTVIKHDASKIFASPLAKRLAKMGNIRFESVKGSGPHGRIVKQDILS-------YTPSTA 173

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            N +     + Y ++P++NIRK IA RL +SKQT+PHFY+SI+CN+D LL +RE +N++ 
Sbjct: 174 HNKIVSRNPEEYRLVPNNNIRKIIAKRLFESKQTVPHFYLSIECNVDKLLDIREDINKSF 233

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
               E+ S +ISVND I+ A A A+ +VP AN SW  +A+  + ++DISVAV+I  G+VT
Sbjct: 234 ---SEDKSTRISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISVAVAIENGLVT 290

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI++ A+QK+IL++S E+K+L ++AK  KL PEE+QGG  +ISN+GM GI +F A+INPP
Sbjct: 291 PIVKNANQKNILELSREMKELIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPP 350

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q  I+ +GA  K+ + +N++I +ATIM+ TLSADHR VDGA+ ++ LA FK++IE+P  M
Sbjct: 351 QGCIMGVGASAKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLAAFKKFIESPALM 410

Query: 422 LM 423
           L+
Sbjct: 411 LI 412


>gi|116254165|ref|YP_770003.1| dihydrolipoamide succinyltransferase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115258813|emb|CAK09919.1| putative dihydrolipoyllysine-residue succinyltransferase component
           of 2-oxoglutarate dehydrogenase [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 425

 Score =  299 bits (765), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 96/427 (22%), Positives = 178/427 (41%), Gaps = 9/427 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  +  W K+ GD I   + + E+ETDK  +E  +   G + EI+
Sbjct: 1   MATEIRVPTLGESVSEATVGTWFKKVGDAIKADEPILELETDKVTIEVPAPASGTLSEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V AG E + + + +  I   +         +             ++    +   +     
Sbjct: 61  VAAG-ETVGLGALLGQIAEGAAAAAAPAAAAPTAAPAAPAPAQPAAAAPAQPAVAAAAAS 119

Query: 122 ASP-----LARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLV 176
           +S      +    A    +  ++LS     G   +  +          K  S   +    
Sbjct: 120 SSSASVSTMPPAPAASKMLAENNLSADQVDGSGKRGQVLKGDVIAAVAKGISAPAAVPAA 179

Query: 177 DESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
             +       +      E +    +R+TIA RL+ ++ T        + ++  ++ LR +
Sbjct: 180 TPAAARGPSTVEDASREERVKMTRLRQTIAKRLKDAQNTAAMLTTYNEVDMKAVMDLRNK 239

Query: 237 MNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIP 296
                +        K+       KA   A+ ++P  N       +I   +  + +AV   
Sbjct: 240 YKDIFEKK---HGVKLGFMGFFTKAVTHALKELPAVNAEIDGTDVIYKNYCHVGMAVGTD 296

Query: 297 GGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCA 356
            G+V P+IR ADQ SI +I  E+ +LA+ A+   L   + QGGT +I+N G+ G      
Sbjct: 297 KGLVVPVIRDADQMSIAEIEKELGRLAKAARDGSLSMADMQGGTFTITNGGVYGSLMSSP 356

Query: 357 VINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIE 416
           ++N PQS IL +   +++ V    ++ +  +M   LS DHR VDG  A   L + KE +E
Sbjct: 357 ILNAPQSGILGMHKIQERPVAIGGQVVIRPMMYLALSYDHRMVDGKEAVTFLVRVKESLE 416

Query: 417 NPVWMLM 423
           +P  +++
Sbjct: 417 DPERLVL 423


>gi|217978645|ref|YP_002362792.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Methylocella silvestris BL2]
 gi|217504021|gb|ACK51430.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Methylocella silvestris BL2]
          Length = 428

 Score =  299 bits (765), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 91/430 (21%), Positives = 179/430 (41%), Gaps = 12/430 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  + +W K+ GD +   + L E+ETDK  +E  +   G++ EI+
Sbjct: 1   MTIEIRVPTLGESVSEATIGRWFKKAGDAVKADEPLLELETDKVTLEVNAPSAGVLAEII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  G + ++V + +  I         +     +   E  +  +         K    +P 
Sbjct: 61  VKDG-DTVSVGALLGQIADSGAAPAKAEAPKADAKAEAPKAEAKPEAAKADAKAPAVKPG 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIET--------LISTKTNVKDYSTIQSF 173
                  +         +       G I  S +            S        +   + 
Sbjct: 120 PDGSLPIMPPSPAAAKIAADKGLDVGAIEGSGVRGQVLKGDVLAKSASPAPAPVAAPAAA 179

Query: 174 GLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSL 233
                +           D  + +    +R+TIA RL+ ++ T        + ++  +++L
Sbjct: 180 TPPAPAQARAPSPAADADREQRVRMTRLRQTIARRLKDAQNTAAMLTTFNEVDMTEVMAL 239

Query: 234 REQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAV 293
           R +     +       +K+      +KA   A+ ++P  N     + ++   +  I +AV
Sbjct: 240 RSKYKDVFEKK---HGSKLGFMGFFVKACVGALKEIPSINAEIDGDDLVFKNYYHIGIAV 296

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
               G+V P++R AD   + +I   +    ++A+  +LK EE QGGT +I+N G+ G   
Sbjct: 297 GSEKGLVVPVVRDADGLGLAEIEKSIAAYGKKARDGQLKIEEMQGGTFTITNGGIYGSLM 356

Query: 354 FCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKE 413
              ++N PQS IL +   +++ +    +I++  +M   LS DHR VDG  A   L + KE
Sbjct: 357 STPILNAPQSGILGMHKIQERPMAVGGKIEIRPMMYLALSYDHRVVDGKEAVTFLVRVKE 416

Query: 414 YIENPVWMLM 423
            +E+P  +++
Sbjct: 417 ALEDPARLVL 426


>gi|89069564|ref|ZP_01156908.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Oceanicola granulosus
           HTCC2516]
 gi|89044899|gb|EAR50989.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Oceanicola granulosus
           HTCC2516]
          Length = 452

 Score =  299 bits (765), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 186/455 (40%), Positives = 262/455 (57%), Gaps = 38/455 (8%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+VDEG++ +IL
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWLVKEGDTVSSGDLLAEIETDKATMEFEAVDEGVVGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKN--- 118
           V AGTE + VN PI  +L +                +       ++     E        
Sbjct: 61  VEAGTEGVKVNQPIAVLLEEGESADDISDTPATPSGDADSHAEPAAASEATEPQKGYGRG 120

Query: 119 ---------------------RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETL 157
                                R  ASPLARR+A + G+DL+ L GSGP GRIVK+D+E  
Sbjct: 121 DAPAPAPAPSGGGEAAQEKGERIFASPLARRIAKDKGLDLAQLKGSGPKGRIVKADVEKA 180

Query: 158 ISTKTNVKDYSTIQSFGLVDESIDANILN---------LFAKDSYEVIPHDNIRKTIACR 208
              +      +               +           ++    +E +  D +RKTI  R
Sbjct: 181 EPGQQQAAPKAEAPKAAATAGGEKPPMPAGMGADAVLKMYEGREFEEVKLDGMRKTIGAR 240

Query: 209 LQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQ 268
           L ++KQTIPHFY+  D  +D LL  R Q+N+ L+        K+SVND I+KA ALA+ +
Sbjct: 241 LTEAKQTIPHFYLRRDIRLDALLKFRSQLNKQLEAK----GVKLSVNDFIIKAGALALQE 296

Query: 269 VPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQ 328
           VP+AN  W  + +++ K  D++VAV+I GG+ TP+++ A QKS+  +S E+K LA+RA+ 
Sbjct: 297 VPDANAVWAGDRILKLKPSDVAVAVAIEGGLFTPVLKDAHQKSLSALSAEMKDLAKRARD 356

Query: 329 RKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATI 387
           RKL P EYQGG+ +ISN+GM G+ +F AVINPP  +ILA+GAG KK V  ++ E+ VAT+
Sbjct: 357 RKLAPHEYQGGSFAISNLGMFGVENFDAVINPPHGSILAVGAGVKKPVVGEDGELAVATV 416

Query: 388 MNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           M+ TLS DHR +DGA+ ++ L+  K  +E P+ ML
Sbjct: 417 MSVTLSVDHRVIDGALGAQFLSALKANLEAPMTML 451


>gi|54293528|ref|YP_125943.1| dihydrolipoamide succinyltransferase, E2 subunit [Legionella
           pneumophila str. Lens]
 gi|53753360|emb|CAH14810.1| dihydrolipoamide succinyltransferase, E2 subunit [Legionella
           pneumophila str. Lens]
          Length = 409

 Score =  299 bits (764), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 110/422 (26%), Positives = 192/422 (45%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++ +  +A W K+ GDK+S  + L ++ETDK ++E  S  +G++ +IL
Sbjct: 1   MSIEVKVPVLPESVADATVAAWHKKVGDKVSRDENLVDLETDKVVLEVPSPVDGVLSDIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + +     +  I         S    K    E   +             +K    
Sbjct: 61  FNTG-DTVGSGDLLAKI-----SQSVSVESQKTEKEEKPVKKEEIKISESESVSTKEDKS 114

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            SP+ RR+  E+ +    + G+G  GRI K D+ + I +     + +         +++ 
Sbjct: 115 TSPVVRRMMAENDLKAGQIQGTGKDGRITKEDVLSYIESNREKSNQTAEVQKESSMKALS 174

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                 F     + +P   +R  IA RL Q++          + N+  ++ +R Q   + 
Sbjct: 175 ------FGGREEKRVPMTRLRAKIAERLLQAQHNAAMLTTFNEVNLKAVMDMRSQYKDSF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   ++ + P  N S     ++ H   DI +AVS   G+V 
Sbjct: 229 EKK---HGVKLGFMSFFTKAVVESLKRFPAVNASIDGQDIVYHGFYDIGIAVSTERGLVV 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ S+ +I L +   A +A+  KL  EE QGGT +I+N G+ G      +INPP
Sbjct: 286 PVIRDADQLSMAEIELAINDAASKARTGKLSMEEMQGGTFTITNGGVFGSLLATPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   E++ + +  +I +  +M   LS DHR +DG  + + L   KE +E+P  +
Sbjct: 346 QTGILGMHKIEERPIVEKGQIVIRPMMYVALSYDHRLIDGKDSVQFLVSVKELLEDPSRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|167855520|ref|ZP_02478283.1| dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex (E2) [Haemophilus
           parasuis 29755]
 gi|167853386|gb|EDS24637.1| dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex (E2) [Haemophilus
           parasuis 29755]
          Length = 405

 Score =  299 bits (764), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 99/422 (23%), Positives = 185/422 (43%), Gaps = 19/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD +   +++ EIETDK ++E  +  +G+I EI 
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKVGDSVKRDEVIVEIETDKVVLEVPATSDGVITEIQ 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  ++           +   N     +  + S         +    +
Sbjct: 61  KGEGA-TVVSKQVLGILVTQQAGDVSLATIKPVNEATPSDRQTASLEPDNSSADALGPSV 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              LA        +  S + G      I     +                +  + ++  +
Sbjct: 120 RRLLAEHGLEASEVKGSGVGGRITREDIEAVVAKR---------------NAKVAEKVEN 164

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                 ++  S + +P   +RK IA RL ++K T        + ++  ++ LR+Q     
Sbjct: 165 TISTVAYSARSEKRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMKPIMDLRKQYGEKF 224

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+VT
Sbjct: 225 EKQ---HGVRLGFMSFYIKAVVEALKRYPEVNASIDGDDVVYHNYFDVSIAVSTPRGLVT 281

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ DI   +K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 282 PVLRDCDKLSMADIEKAIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 341

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A + + V  + ++ +  +M   LS DHR +DG  +   L   K+ +E+P  +
Sbjct: 342 QSAILGMHAIKDRPVAVDGQVVIRPMMYLALSYDHRLIDGRESVGFLVAIKDLLEDPTRL 401

Query: 422 LM 423
           L+
Sbjct: 402 LL 403


>gi|148360811|ref|YP_001252018.1| dihydrolipoamide succinyltransferase [Legionella pneumophila str.
           Corby]
 gi|296106125|ref|YP_003617825.1| 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide
           succinyltransferase) [Legionella pneumophila 2300/99
           Alcoy]
 gi|148282584|gb|ABQ56672.1| dihydrolipoamide succinyltransferase [Legionella pneumophila str.
           Corby]
 gi|295648026|gb|ADG23873.1| 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide
           succinyltransferase) [Legionella pneumophila 2300/99
           Alcoy]
 gi|307609340|emb|CBW98825.1| dihydrolipoamide succinyltransferase, E2 subunit [Legionella
           pneumophila 130b]
          Length = 409

 Score =  299 bits (764), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 110/422 (26%), Positives = 191/422 (45%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++ +  +A W K+ GDK+S  + L ++ETDK ++E  S  +G++ +IL
Sbjct: 1   MSIEVKVPVLPESVADATVAAWHKKVGDKVSRDENLVDLETDKVVLEVPSPVDGVLSDIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + +     +  I         S    K    E   +             +K    
Sbjct: 61  FNTG-DTVGSGDLLAKI-----SQSVSVESQKTEKEEKPVKKEEIKISESESVSTKEDKS 114

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            SP+ RR+  E+ +    + G+G  GRI K D+ + I +     + +          ++ 
Sbjct: 115 TSPVVRRMMAENDLKAGQIQGTGKDGRITKEDVLSYIESNREKSNQTAEVQKESSMRALS 174

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                 F     + +P   +R  IA RL Q++          + N+  ++ +R Q   + 
Sbjct: 175 ------FGGREEKRVPMTRLRAKIAERLLQAQHNAAMLTTFNEVNLKAVMDMRSQYKDSF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   ++ + P  N S     ++ H   DI +AVS   G+V 
Sbjct: 229 EKK---HGVKLGFMSFFTKAVVESLKRFPAVNASIDGQDIVYHGFYDIGIAVSTERGLVV 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ S+ +I L +   A +A+  KL  EE QGGT +I+N G+ G      +INPP
Sbjct: 286 PVIRDADQLSMAEIELAINDAASKARTGKLSMEEMQGGTFTITNGGVFGSLLATPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   E++ + +  +I +  +M   LS DHR +DG  + + L   KE +E+P  +
Sbjct: 346 QTGILGMHKIEERPIVEKGQIVIRPMMYVALSYDHRLIDGKDSVQFLVSVKELLEDPSRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|222150037|ref|YP_002550994.1| dihydrolipoamide succinyltransferase [Agrobacterium vitis S4]
 gi|221737019|gb|ACM37982.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Agrobacterium vitis S4]
          Length = 410

 Score =  299 bits (764), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 90/422 (21%), Positives = 170/422 (40%), Gaps = 14/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  +  W K+ GD +   + L E+ETDK  +E      G++ EI+
Sbjct: 1   MATEIRVPTLGESVSEATVGTWFKKVGDVVKADEPLVELETDKVTVEVPCPASGVLTEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E + + + +  I   ++    +P  +         + + ++P       +     
Sbjct: 61  AQNG-ETVGLGALLGQIAEGASAGAAAPAAAAPAPAATPAQAAPAAPAAGSAMPAAPAAA 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                  ++ +                I                                
Sbjct: 120 KMLAENNISADQVDGSGKRGQVLKGDVIAAVAKGASAPAAAPAPAPVAAPRP-------- 171

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
             + +       E +    +R+TIA RL+ ++ T        + ++  ++SLR +     
Sbjct: 172 --VSSADDASREERVKMTRLRQTIAKRLKDAQNTAAMLTTYNEVDMSAVMSLRNKYKDIF 229

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       +I   +  + +AV    G+V 
Sbjct: 230 EKK---HGVKLGFMGFFTKAVTHALKELPAVNAEIDGTDIIYKNYCHVGMAVGTDKGLVV 286

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI ++  ++ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 287 PVIRDADQMSISEVEKDLGRLAKAARDGSLSMADMQGGTFTITNGGVYGSLMSSPILNAP 346

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   + + V    +I +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 347 QSGILGMHKIQDRPVVVGGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL 406

Query: 422 LM 423
           ++
Sbjct: 407 VL 408


>gi|254462094|ref|ZP_05075510.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodobacterales bacterium HTCC2083]
 gi|206678683|gb|EDZ43170.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 422

 Score =  299 bits (764), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 191/425 (44%), Positives = 269/425 (63%), Gaps = 8/425 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM +G LAKW+ +EGD +S GD+L EIETDKA MEFE+VDEG+I +IL
Sbjct: 1   MAIEILMPALSPTMEDGTLAKWLVKEGDTVSSGDLLAEIETDKATMEFEAVDEGVIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDST---EIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKN 118
           V AGT  + VNSPI  +L D     E+  S   +   I         ++    +   + +
Sbjct: 61  VEAGTAGVLVNSPIALLLEDGEDSAEVVASSQTAPAPIAPEVLSTPVATAPAPKLTQTGD 120

Query: 119 RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDE 178
           R  ASPLARR+A + GIDL++++GSGP GRIVK+D+E   S                  +
Sbjct: 121 RVFASPLARRIAADKGIDLATITGSGPRGRIVKADVENAQSAPAAQPAAIPTPQTAKAPD 180

Query: 179 SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMN 238
           +  + I  ++    +  +P D +RKTIA RL ++KQ IPHFY+  D ++D LL  R Q+N
Sbjct: 181 TNPSQIAKMYEGREFTELPLDGMRKTIAARLTEAKQNIPHFYLRRDIHLDALLKFRSQLN 240

Query: 239 RTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGG 298
           + L         K+SVND I+KA ALA+ QVP AN  W  + +++ K  D++VAV+I GG
Sbjct: 241 KQLAAR----DIKLSVNDFIIKACALALQQVPAANAVWAGDRVLQMKASDVAVAVAIEGG 296

Query: 299 IVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVI 358
           + TP+++ AD KS+  +S ++K LA RA+ RKL P EY GG+ +ISN+GM+GI +F AVI
Sbjct: 297 LFTPVLQDADSKSLSALSAQMKDLANRARDRKLAPHEYMGGSFAISNLGMMGIENFDAVI 356

Query: 359 NPPQSTILAIGAGEKKVVFQ-NEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           NPP   ILA+GAG KK +   + ++ +AT+M+ TLS DHR +DGA+ + LLA  K  +EN
Sbjct: 357 NPPHGAILAVGAGAKKPIVNSDGDLDIATVMSVTLSVDHRVIDGALGADLLAAIKANLEN 416

Query: 418 PVWML 422
           P+ ML
Sbjct: 417 PIAML 421


>gi|254361863|ref|ZP_04977997.1| oxoglutarate dehydrogenase (succinyl-transferring) [Mannheimia
           haemolytica PHL213]
 gi|261492656|ref|ZP_05989209.1| ribonucleotide-diphosphate reductase subunit beta [Mannheimia
           haemolytica serotype A2 str. BOVINE]
 gi|261494595|ref|ZP_05991076.1| ribonucleotide-diphosphate reductase subunit beta [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|153093402|gb|EDN74393.1| oxoglutarate dehydrogenase (succinyl-transferring) [Mannheimia
           haemolytica PHL213]
 gi|261309707|gb|EEY10929.1| ribonucleotide-diphosphate reductase subunit beta [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|261311815|gb|EEY12965.1| ribonucleotide-diphosphate reductase subunit beta [Mannheimia
           haemolytica serotype A2 str. BOVINE]
          Length = 409

 Score =  299 bits (764), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 109/422 (25%), Positives = 189/422 (44%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I  P L  ++ +  +A W K+ GD +   +IL EIETDK ++E  +  +GI+ EI 
Sbjct: 1   MTIEILTPDLPESVADATVATWHKKVGDNVKRDEILVEIETDKVVLEVPASSDGILAEIT 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   ++  S    ++  + +I  +    K        +H+                 
Sbjct: 61  QEQGATVVSKQSLGKLVVAKAGDISSATIEQKTESTPSDRKHAA-----------IENSH 109

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A+   +  A    +    L  +   G  V   I      K   K     Q  G       
Sbjct: 110 ANADDQGPAIRRLLAEHDLQAADIQGSGVGGRITREDIEKEIAKRVQINQVKGSATSQNT 169

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            + +      S + +P   +RK IA RL ++K T        + ++  +++LR+      
Sbjct: 170 VSTVAF-NSRSEKRVPMTRLRKRIAERLLEAKNTTAMLTTFNELDMQPIMNLRKTYGEKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---HGVRLGFMSFYIKAVVEALKRYPEINASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ DI  ++K+LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVLRDCDKMSMADIEKKIKELAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A + + V  + ++ +  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 346 QSAILGMHAIKDRPVAIDGQVVIRPMMYLALSYDHRLIDGKESVGFLVAVKELLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|94496913|ref|ZP_01303487.1| dihydrolipoamide succinyl transferase [Sphingomonas sp. SKA58]
 gi|94423589|gb|EAT08616.1| dihydrolipoamide succinyl transferase [Sphingomonas sp. SKA58]
          Length = 418

 Score =  298 bits (763), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 91/422 (21%), Positives = 174/422 (41%), Gaps = 6/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P+L  ++TE  + +W+K+ G+ +   + +  +ETDK  ++  +   G + +I+
Sbjct: 1   MATEVKVPTLGESVTEATVGQWLKKPGEAVKADEPIVSLETDKVAVDVPAPAAGTMGDIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + +  +   +       P             S S+P        +    
Sbjct: 61  AKEG-DTVEVGALLAYVNEGAAAASSPAPAPAAKAEAATPAPSASTPAPAPAAADEEGEG 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +           ++              K    T       V   +   +    + +  
Sbjct: 120 GNLTLSPAVRRLVLEH--GLDPSKIKGSGKDGRLTKDDVMAAVDAGTARAASTGAEAAPT 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                       E +    +R+T+A RL++++          D ++ N++  R +     
Sbjct: 178 EAAPAAGPSRKQERVKMTRLRQTVAKRLKEAQNNAALLTTFNDVDMTNVIEARTKYKDLF 237

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++       KA  +A+  +P  N     + ++ +   DISVAVS P G+V 
Sbjct: 238 EKK---HGVRLGFMGFFTKAVCMALKDIPGVNGQIEGDEIVYNDFADISVAVSAPTGLVV 294

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR A+  S+  I   +    ++AK+ KL  E+ +GGT +ISN G+ G      +INPP
Sbjct: 295 PVIRNAESMSVAQIERTIGDFGKKAKEGKLTMEDMKGGTFTISNGGVFGSLMSTPIINPP 354

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS +L +   E + V ++ ++ V  +M   LS DHR +DG  A   L   K  IE+P  +
Sbjct: 355 QSAVLGLHRIEDRPVVRDGQVVVRPMMYLALSYDHRLIDGREAVTFLVAVKNAIEDPTRL 414

Query: 422 LM 423
           L+
Sbjct: 415 LI 416


>gi|81322120|sp|Q8GCY1|ODO2_BARVB RecName: Full=Dihydrolipoyllysine-residue succinyltransferase
           component of 2-oxoglutarate dehydrogenase complex;
           AltName: Full=2-oxoglutarate dehydrogenase complex
           component E2; Short=OGDC-E2; AltName:
           Full=Dihydrolipoamide succinyltransferase component of
           2-oxoglutarate dehydrogenase complex
 gi|26418585|gb|AAN78227.1| dihydrolipoamide succinyltransferase [Bartonella vinsonii subsp.
           berkhoffii]
          Length = 411

 Score =  298 bits (763), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 100/422 (23%), Positives = 188/422 (44%), Gaps = 13/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ ++  + L E+ETDK  +E  S   G + EI+
Sbjct: 1   MTTEIRVPTLGESVTEATVGKWFKKLGEAVAIDEPLVELETDKVTVEVPSPVAGKLFEII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + VN+ +  +   +  +        ++        S +   + +   S   P 
Sbjct: 61  AKEG-DTVEVNALLGAVEAGAASV-------AKSPSSSETSVSAAPSELEQSSSSNTMPP 112

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A   A+ +A  +      L        + +  +  L           +  S   V  S  
Sbjct: 113 APSAAKLMAENNIAKSDILGSGKRGQILKEDVLNVLAQGVKTSPPAVSASSSTPVSVSSS 172

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A       ++  E +    +R+TIA RL+ ++ T        + ++  ++ LR++     
Sbjct: 173 AVAPVQEMRE--ERVRMTKLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMGLRKRYKDLF 230

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       +I   +++  +AV    G+V 
Sbjct: 231 EKK---HGVKLGFMGFFTKAVCHALKELPAVNAEIDGTDIIYKNYVNAGIAVGTDKGLVV 287

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ S+ +I  E+ +L + A+  KL   + QGGT +I+N G+ G      ++N P
Sbjct: 288 PVVRDADQMSLAEIEKEIGRLGRLARDGKLAVSDMQGGTFTITNGGVYGSLMSTPILNAP 347

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +  + +I +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 348 QSGILGMHAIKERAMVVDGQIAIRPMMYLALSYDHRIVDGQEAVTFLVRVKESLEDPERL 407

Query: 422 LM 423
           ++
Sbjct: 408 VL 409


>gi|163742725|ref|ZP_02150110.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Phaeobacter gallaeciensis 2.10]
 gi|161383980|gb|EDQ08364.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Phaeobacter gallaeciensis 2.10]
          Length = 444

 Score =  298 bits (763), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 183/447 (40%), Positives = 267/447 (59%), Gaps = 30/447 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD ++ GD+L EIETDKA MEFE+VDEG+I +IL
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWLVKEGDTVASGDLLAEIETDKATMEFEAVDEGVIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPP--------------------SPPLSKENIVEVRE 101
           +P G+E + VNSPI  +L +                                        
Sbjct: 61  IPEGSEGVKVNSPIAVLLEEGESADDIGTTPSAPAAAADEAAPVAPEEAAPASFPAPAEA 120

Query: 102 EHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTK 161
             + +      +    NR  ASPLARR+A + G+DL+ L+GSGP GRIVK+D+E      
Sbjct: 121 PAAATPAPAAPQGADGNRIFASPLARRIAADKGLDLAQLNGSGPRGRIVKADVENAKPQV 180

Query: 162 TNVKDYSTIQSFGLVDE-----SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTI 216
                 +   +                +  ++   +YE +  D +RKTIA RL ++KQT+
Sbjct: 181 AAAPAAAAPATAAAPAAAVSTGPSTDQVARMYEGRTYEEVKLDGMRKTIAARLTEAKQTV 240

Query: 217 PHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSW 276
           PHFY+  D  +D LL  R ++N+ L+        K+SVND I+KA ALA+  VP+AN  W
Sbjct: 241 PHFYLRRDIQLDALLKFRGELNKQLEAR----GVKLSVNDFIIKACALALQAVPDANAVW 296

Query: 277 TTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEY 336
             + +++ +  D++VAV+I GG+ TP+++ +D KS+  +S E+K LA+RA+ RKL P EY
Sbjct: 297 AGDRVLKMEASDVAVAVAIEGGLFTPVLQNSDTKSLSTLSTEMKDLAKRARDRKLAPHEY 356

Query: 337 QGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSAD 395
           QGG+ +ISN+GM GI++F A++NPP + ILA+GAG KK V   + E+ VAT+M+ T+S D
Sbjct: 357 QGGSFAISNLGMFGIDNFDAIVNPPHAGILAVGAGVKKPVVGADGELAVATVMSVTMSVD 416

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWML 422
           HR +DGA+ ++LL   K+ +ENP+ ML
Sbjct: 417 HRVIDGALGAELLNAIKDNLENPMMML 443


>gi|330813456|ref|YP_004357695.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486551|gb|AEA80956.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 401

 Score =  298 bits (763), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 106/422 (25%), Positives = 189/422 (44%), Gaps = 23/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   IT+P+L  ++TE  +AKW+K+ GD +   + +  +ETDK  ++  +   GI+ EI+
Sbjct: 1   MADKITVPTLGESLTEATVAKWLKKVGDSVQEDEEIVSLETDKVSIDVTAPKSGILSEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   + V + + +I   ++          +    V E     + +  +  +   +  
Sbjct: 61  AKDGA-TVEVGAHLGSIDASASPAKKKEVQQDKQETTVVEIKKEENILEKKIDNQNKKKE 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            SP  +R+  E  I++ S+ G+G  GRI+K D+  L+                       
Sbjct: 120 LSPSVKRIINEKNINIESVDGTGKDGRILKGDLIGLMGFS-------------------P 160

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A           E +    +R TIA RL++++          + ++  ++ +R+      
Sbjct: 161 APNTKKIEIGEEERVKMTRLRSTIAKRLKEAQNNAAILTTFNEIDMSMIIQIRKDNKDEF 220

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+      +KA   A+   P  N       ++   + +I VAV    G+V 
Sbjct: 221 EKR---YGTKLGFMSFFVKACVNALQTYPSVNAEVQGEEIVYKNYYNIGVAVGTEKGLVV 277

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++  AD+ S  +I  E+  L  +AK  +L  EE QGGT +I+N G+ G      +INPP
Sbjct: 278 PVLGNADELSFAEIEKEIITLGTKAKNNQLSIEELQGGTFTITNGGIYGSMLSTPIINPP 337

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS +L +    ++ V  N +I++  IM   LS DHR +DG  A   L + KE +E+P  +
Sbjct: 338 QSGVLGMHNIVQRAVVINGKIEIRPIMYLALSYDHRIIDGKEAVSFLVRVKEILEDPRRL 397

Query: 422 LM 423
            +
Sbjct: 398 FL 399


>gi|239826426|ref|YP_002949050.1| dihydrolipoamide succinyltransferase [Geobacillus sp. WCH70]
 gi|239806719|gb|ACS23784.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Geobacillus sp. WCH70]
          Length = 419

 Score =  298 bits (763), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 103/423 (24%), Positives = 191/423 (45%), Gaps = 7/423 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L+ ++TEG +A+W+K+ GD +  G+ +CE+ETDK  +E  + + G++ +IL
Sbjct: 1   MA-EVKVPELAESITEGTIAQWLKKPGDHVEKGESICELETDKVNVEIMAEESGVLQQIL 59

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + +AV   I  I       P +    K+   E  +  +  +  + ++  S ++P 
Sbjct: 60  ANEG-DTVAVGQAIAVIGEGQEAAPSNQEEPKQATPENLQATNVQAEEIEKQPLSASQPT 118

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
             P+A   A +   +        P    +    +  + +    +            +   
Sbjct: 119 QRPIASPAARKIAREKGIDLTQVPTVDPLGRVRKQDVESFAQQQARPQATPATPAQQP-A 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            +++                R+TIA RL +  Q+        + ++  ++ LR++     
Sbjct: 178 PSVVKQDDGKPVIREKMSRRRQTIAKRLLEVTQSTAMLTTFNEIDMSAVIELRKRKKDKF 237

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
                    ++      +KA   A+ + P  N     + +I  K+ DI VAVS   G+V 
Sbjct: 238 FEE---HDVRLGFMSFFVKAAVAALKKYPYVNAEIQGDEIILKKYYDIGVAVSTDEGLVV 294

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+K+  +I  ++  LA +A+  KL   + QGGT +I+N G+ G      ++N P
Sbjct: 295 PVVRDCDRKNFAEIERDIADLAAKARSNKLSLSDLQGGTFTITNGGVFGSLFSTPLLNGP 354

Query: 362 QSTILAIGAGEKKVVFQNEE-IKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           Q  IL + + + + V  +EE I+   +M   LS DHR +DG  A   L   K+ IENP  
Sbjct: 355 QVGILGMHSIKLRPVAIDEERIENRPMMYVALSYDHRIIDGKEAVGFLKTVKDLIENPED 414

Query: 421 MLM 423
           +L+
Sbjct: 415 LLL 417


>gi|52840777|ref|YP_094576.1| dihydrolipoamide succinyltransferase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52627888|gb|AAU26629.1| dihydrolipoamide succinyltransferase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 409

 Score =  298 bits (763), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 110/422 (26%), Positives = 191/422 (45%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++ +  +A W K+ GDK+S  + L ++ETDK ++E  S  +G++ +IL
Sbjct: 1   MSIEVKVPVLPESVADATVAAWHKKVGDKVSRDENLVDLETDKVVLEVPSPVDGVLSDIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + +     +  I         S    K    E   +             +K    
Sbjct: 61  FNTG-DTVGSGDLLAKI-----SQSVSVESQKTEKEEKPVKKEEIKISESESVSTKEDKS 114

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            SP+ RR+  E+ +    + G+G  GRI K D+ + I +     + +          ++ 
Sbjct: 115 TSPVVRRMMAENDLKAGQIQGTGKDGRITKEDVLSYIESNREKANQTAEVQKEPSMRALS 174

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                 F     + +P   +R  IA RL Q++          + N+  ++ +R Q   + 
Sbjct: 175 ------FGGREEKRVPMTRLRAKIAERLLQAQHNAAMLTTFNEVNLKAVMDMRSQYKDSF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   ++ + P  N S     ++ H   DI +AVS   G+V 
Sbjct: 229 EKK---HGVKLGFMSFFTKAVVESLKRFPAVNASIDGQDIVYHGFYDIGIAVSTERGLVV 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ S+ +I L +   A +A+  KL  EE QGGT +I+N G+ G      +INPP
Sbjct: 286 PVIRDADQLSMAEIELAINDAASKARTGKLSMEEMQGGTFTITNGGVFGSLLATPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   E++ + +  +I +  +M   LS DHR +DG  + + L   KE +E+P  +
Sbjct: 346 QTGILGMHKIEERPIVEKGQIVIRPMMYVALSYDHRLIDGKDSVQFLVSVKELLEDPSRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|54296567|ref|YP_122936.1| dihydrolipoamide succinyltransferase, E2 subunit [Legionella
           pneumophila str. Paris]
 gi|53750352|emb|CAH11746.1| dihydrolipoamide succinyltransferase, E2 subunit [Legionella
           pneumophila str. Paris]
          Length = 409

 Score =  298 bits (763), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 110/422 (26%), Positives = 191/422 (45%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++ +  +A W K+ GDK+S  + L ++ETDK ++E  S  +G++ +IL
Sbjct: 1   MSIEVKVPVLPESVADATVAAWHKKVGDKVSRDENLVDLETDKVVLEVPSPVDGVLSDIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + +     +  I         S    K    E   +             +K    
Sbjct: 61  FNTG-DTVGSGDLLAKI-----SQSVSVESQKTEKEEKPVKKEEIKISESESVSTKEDKS 114

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            SP+ RR+  E+ +    + G+G  GRI K D+ + I +     + +          ++ 
Sbjct: 115 TSPVVRRMMAENDLKAGQIQGTGKDGRITKEDVLSYIESNREKSNQTAEVQKESSMRTLS 174

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                 F     + +P   +R  IA RL Q++          + N+  ++ +R Q   + 
Sbjct: 175 ------FGGREEKRVPMTRLRAKIAERLLQAQHNAAMLTTFNEVNLKAVMDMRSQYKDSF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   ++ + P  N S     ++ H   DI +AVS   G+V 
Sbjct: 229 EKK---HGVKLGFMSFFTKAVVESLKRFPAVNASIDGQDIVYHGFYDIGIAVSTERGLVV 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ S+ +I L +   A +A+  KL  EE QGGT +I+N G+ G      +INPP
Sbjct: 286 PVIRDADQLSMAEIELAINDAASKARTGKLSMEEMQGGTFTITNGGVFGSLLATPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   E++ + +  +I +  +M   LS DHR +DG  + + L   KE +E+P  +
Sbjct: 346 QTGILGMHKIEERPIVEKGQIVIRPMMYVALSYDHRLIDGKDSVQFLVSVKELLEDPSRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|188580837|ref|YP_001924282.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Methylobacterium populi BJ001]
 gi|179344335|gb|ACB79747.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Methylobacterium populi BJ001]
          Length = 445

 Score =  298 bits (763), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 102/447 (22%), Positives = 180/447 (40%), Gaps = 29/447 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  + +W K+ GD ++  + L E+ETDK  +E  +   G + EIL
Sbjct: 1   MATDILVPTLGESVSEATIGRWFKKPGDTVAADEPLVELETDKVTLEVNAPAAGELGEIL 60

Query: 62  VPAGTENIAVNSPILNILMDS-------------TEIPPSPPLSKENIVEVREEHSHSSP 108
           V  G E +   + + +I+                ++  P+P  ++    +          
Sbjct: 61  VKDG-ETVEPGAVLGSIVEGGKGADKGAAKSESKSDSKPAPKSAEPAETKSESREEKGGK 119

Query: 109 VVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYS 168
                    +    S      AG       S        R    D  +L  +  + +   
Sbjct: 120 SKDGPAQESSASYGSHGDAPPAGGGRGADESGPAVAKLARESGVDPSSLNGSGKDGRVTK 179

Query: 169 TIQSFGLVDESIDANILNLFAKD------------SYEVIPHDNIRKTIACRLQQSKQTI 216
                 +      A      A                E +    +R+TIA RL+ ++ T 
Sbjct: 180 GDMLAAIDKGGAKAPAQETKAPAPPRAPSAPDDAAREERVRMTKLRQTIARRLKSAQDTA 239

Query: 217 PHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSW 276
                  D ++  +++LR Q     +        K+       KA   A+  VP  N   
Sbjct: 240 AMLTTFNDVDMGAVMALRAQYKDIFEKK---HGTKLGFMGFFTKAVIGALKDVPAVNAEI 296

Query: 277 TTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEY 336
               ++   +  I +AV    G+V P++R AD  SI  I  ++    ++A++ KL  +E 
Sbjct: 297 DGQDLVYKNYYHIGIAVGTDKGLVVPVVRDADDLSIAGIEKKIAGFGKKAREGKLSIDEM 356

Query: 337 QGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADH 396
           QGGT +I+N G+ G      ++N PQS IL +   E++ V +  +I+   +M   LS DH
Sbjct: 357 QGGTFTITNGGIYGSLMSTPILNAPQSGILGMHRIEERPVVRGGKIEARPMMYLALSYDH 416

Query: 397 RSVDGAIASKLLAKFKEYIENPVWMLM 423
           R VDG  A   L + KE +E+P  +++
Sbjct: 417 RIVDGKEAVTFLVRVKEALEDPARLVL 443


>gi|269838081|ref|YP_003320309.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Sphaerobacter thermophilus DSM
           20745]
 gi|269787344|gb|ACZ39487.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Sphaerobacter thermophilus DSM
           20745]
          Length = 442

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 120/444 (27%), Positives = 198/444 (44%), Gaps = 26/444 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +  W+K+EGD +  G+ L E+ETDK  +E  +   G++ +IL
Sbjct: 1   MPVEIRVPQLGESVVDAVVGTWLKKEGDPVQVGETLVELETDKVNVEITAEQSGVLAKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVR-EKHSKNRP 120
            P G E +AV   I  I+       P+P  + E         +            +   P
Sbjct: 61  KPEG-ETVAVGEVIGAIVEAEAAAAPAPAAAAEAPAAPAPAPAREPEPEPVAVPAAPGGP 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
            A+P  RRLA E+ IDL+ +  SG  GR+ + D+   I      ++ +        +   
Sbjct: 120 RATPAVRRLAAEYDIDLAQVPASGEGGRVTREDVLAYIQRAGRTREAAPAAPANGAEAPA 179

Query: 181 DANILN---------------------LFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
                                             E +     R+TIA RL +++ T    
Sbjct: 180 APAPAPTPAAPAAPAAPAAPSALPFEIAADGRREERVRMTRRRQTIAQRLVEAQHTAAML 239

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN 279
               + ++  ++ LR++   + Q        K+       KA   A+   P  N     N
Sbjct: 240 TTFNEVDMSAVMELRKRRGESFQQR---HGVKLGFMSFFTKAVVGALKAFPYLNAEIQGN 296

Query: 280 AMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
            ++   + DI +AV    G+V P++R AD+KS  +I  E+  LA RA++ KL+ +E  GG
Sbjct: 297 EIVLKHYYDIGIAVGAEEGLVVPVVRDADRKSFAEIEREILDLATRAREGKLQLQELMGG 356

Query: 340 TTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSV 399
           T +I+N G+ G      ++NPPQ  IL +   E++ V  + EI +  +M   LS DHR V
Sbjct: 357 TFTITNGGVYGSLLSTPILNPPQVGILGMHKIEQRPVVVDGEIVIRPMMYLALSYDHRIV 416

Query: 400 DGAIASKLLAKFKEYIENPVWMLM 423
           DG+ A + L + KE IE+P  +L+
Sbjct: 417 DGSDAVRFLVRVKELIEDPESLLL 440


>gi|261868413|ref|YP_003256335.1| dihydrolipoyllysine-residue succinyltransferase [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413745|gb|ACX83116.1| dihydrolipoyllysine-residue succinyltransferase [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 407

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 104/422 (24%), Positives = 183/422 (43%), Gaps = 17/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ G  +   +++ EIETDK ++E  +  +G++ +IL
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKAGYAVKRDEVIVEIETDKVVLEVPAQADGVLAQIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  +    T    +   + E   + R       P V           
Sbjct: 61  QEEGA-TVVSKQLLGTLEDSVTAAAIATEKTAEPTPKDRRTEVPDEPHV----------- 108

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
               A+  A    +    L  S             +              +      + D
Sbjct: 109 --TDAQGPAVRRLLAEHGLQPSDVADVKGTGVGGRITREDVEAILAQRTAAAAQPQVAED 166

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                 +A  S + +P   +RK IA RL ++K T        + ++  +++LR+Q     
Sbjct: 167 TLSTVAYAARSEKRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMNLRKQYGEKF 226

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + +I H + D+S+AVS P G+VT
Sbjct: 227 EKQ---HGVRLGFMSFYIKAVVEALKRYPEVNASIDGDDVIYHNYFDVSIAVSTPRGLVT 283

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D  S+ DI   +K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 284 PVLRDCDNLSMADIEKSIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 343

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ V  N ++ +  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 344 QSAILGMHAIKERPVALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRL 403

Query: 422 LM 423
           L+
Sbjct: 404 LL 405


>gi|114321755|ref|YP_743438.1| 2-oxoglutarate dehydrogenase E2 component [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|114228149|gb|ABI57948.1| 2-oxoglutarate dehydrogenase E2 component [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 422

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 97/424 (22%), Positives = 188/424 (44%), Gaps = 6/424 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  +++E  +  W KQ GD +S  + L ++ETDK ++E  +  +G++ E  
Sbjct: 1   MSIEVKVPPLPESVSEATVVAWHKQPGDAVSRDENLVDLETDKVVLEVPAPADGVMGERF 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + +  +  +  +   +         ++      +E  S  +P       + + P 
Sbjct: 61  KNEG-DTVTADEVLGKLEEGAAPAKAESKPAEAAPAPKQEAASAPAPKPAEAPAAASAPA 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIV--KSDIETLISTKTNVKDYSTIQSFGLVDES 179
                   A    ++ ++L      G     +   E ++             + G    +
Sbjct: 120 EDLADLPPAARRLVEENNLDPKQIPGTGRAGRITKEDVVRFMKGETQPVQQPAAGQPAAA 179

Query: 180 IDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
               +    A    + +P   +R+ IA RL +++QT        + N+  +++ R Q   
Sbjct: 180 AAPQVSADAADRPEKRVPMTRLRQRIAERLVEAQQTAAMLTTFNEVNMQPVMNTRGQYKD 239

Query: 240 TLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGI 299
             +        K+      +KA   A+ + P  N S     ++ H + D+ +AVS P G+
Sbjct: 240 KFEKT---HGIKLGFMSFFVKAAVEALQRFPAVNASIDGKDIMYHGYYDVGIAVSSPRGL 296

Query: 300 VTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVIN 359
           V P++R ADQ S  +I  ++ +  Q+A++ KL  EE  GGT +I+N G+ G      ++N
Sbjct: 297 VVPVLRDADQMSFAEIEAKIAEFGQKAREGKLSMEELTGGTFTITNGGIFGSLLSTPILN 356

Query: 360 PPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPV 419
           PPQS IL +   +++ + +N ++ +  +M    S DHR +DG  A + L   KE +E+P 
Sbjct: 357 PPQSGILGMHKIQERPMAENGQVVIRPMMYLAHSYDHRIIDGREAVQFLVTIKECLEDPT 416

Query: 420 WMLM 423
            +L+
Sbjct: 417 RLLL 420


>gi|85706334|ref|ZP_01037428.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Roseovarius sp. 217]
 gi|85669107|gb|EAQ23974.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Roseovarius sp. 217]
          Length = 435

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 195/438 (44%), Positives = 272/438 (62%), Gaps = 21/438 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+V+EG++ ++L
Sbjct: 1   MPIEILMPALSPTMEEGTLAKWLVKEGDTVSAGDLLAEIETDKATMEFEAVEEGVVGKLL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPP-----------SPPLSKENIVEVREEHSHSSPVV 110
           V  GTE + VN+PI  +L D                   P  K      ++         
Sbjct: 61  VAEGTEGVKVNTPIAVMLEDGESASDIGSAPAKAKTSEAPSEKSPEAAPQKADEAKPAPA 120

Query: 111 VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
             +     R  ASPLARR+A + GIDL+ + GSGPHGRIVK+D+E   S+   VKD +  
Sbjct: 121 AAKSGDGARIFASPLARRIAADKGIDLAGIKGSGPHGRIVKADVEGAKSSTAPVKDAAKP 180

Query: 171 QSFGLVDESIDANILN-----LFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
                   SI +   +     ++    YE +  D +RKTIA RL ++KQT+PHFY+  + 
Sbjct: 181 ADKAPAPASIASGPSSDAVIAMYQGREYEEVKLDGMRKTIAARLTEAKQTVPHFYLRREI 240

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
            +D L+  R  +N+ L+        K+SVND I+KA ALA+  VP+AN  W  + ++R K
Sbjct: 241 RLDALMKFRADLNKQLEAR----GVKLSVNDFIIKACALALQAVPDANAVWAGDKVLRLK 296

Query: 286 HIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
             D++VAV+I GG+ TP+++ A+ KS+  +S E+K LA+RA+ RKL P+EYQGGT +ISN
Sbjct: 297 PSDVAVAVAIEGGLFTPVLKDAEMKSLSALSAEMKDLAKRARDRKLAPQEYQGGTFAISN 356

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHRSVDGAIA 404
           +GM GI +F AVINPP   ILA+GAG KK V  ++ E+ VAT+M+ TLS DHR +DGA+ 
Sbjct: 357 LGMFGIENFDAVINPPHGAILAVGAGLKKPVVGKDGELSVATVMSVTLSVDHRVIDGALG 416

Query: 405 SKLLAKFKEYIENPVWML 422
           ++LL K  E +ENP+ ML
Sbjct: 417 AELLGKIVENLENPLVML 434


>gi|190575085|ref|YP_001972930.1| dihydrolipoamide succinyltransferase [Stenotrophomonas maltophilia
           K279a]
 gi|190013007|emb|CAQ46639.1| putative dihydrolipoamide succinyltransferase E2 component
           [Stenotrophomonas maltophilia K279a]
          Length = 400

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 111/422 (26%), Positives = 190/422 (45%), Gaps = 26/422 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   +  P L  ++ +G +A W K+ GD +   + L ++ETDK ++E  S  +G++ EI 
Sbjct: 1   MATEVKAPVLPESVADGTIATWHKKVGDAVKRDENLLDLETDKVVLEVPSPVDGVLKEIK 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G+  +  +  +  I   +    P+P              +  +        +K+   
Sbjct: 61  FAEGS-TVTSSQVVAIIEEGAVAAAPAPAAEAAPAAAAAPAAAAPAAAAAPAPAAKSAAD 119

Query: 122 A-SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           A  P AR  A   G++ + + G+G  G + K DI                        + 
Sbjct: 120 ALPPGARFTAITEGVNPADVDGTGRRGAVTKEDIVNF---------------------AR 158

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
           +            E +P   IRK IA RL +SK +        + ++  + + R+++   
Sbjct: 159 NGGAGKAGGARPEERVPMTRIRKRIAERLMESKNSTAMLTTFNEVDLSKVSAARKELQDE 218

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
                     K+      +KA A A+ + P  N S   + +I H + DIS+AVS   G+V
Sbjct: 219 FVKA---HGIKLGFMSFFVKAAANALQRFPLVNASIDGDDIIYHGYSDISIAVSTEKGLV 275

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  ++ S  DI   +   A++A+  KL  +E QGGT +++N G  G      +INP
Sbjct: 276 TPVLRNVERMSFADIEKTIADYAKKARDGKLGLDELQGGTFTVTNGGTFGSLLSTPIINP 335

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A +++ + QN ++ +A +M   LS DHR +DG  + + L   K  +ENP  
Sbjct: 336 PQSAILGMHAIKERPIAQNGQVVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGR 395

Query: 421 ML 422
           ML
Sbjct: 396 ML 397


>gi|325925703|ref|ZP_08187079.1| 2-oxoglutarate dehydrogenase E2 component [Xanthomonas perforans
           91-118]
 gi|325543872|gb|EGD15279.1| 2-oxoglutarate dehydrogenase E2 component [Xanthomonas perforans
           91-118]
          Length = 404

 Score =  298 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 104/421 (24%), Positives = 182/421 (43%), Gaps = 20/421 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++++  +A W K+ G+ +   + L ++ETDK ++E  S  +G++ EI 
Sbjct: 1   MATEVKVPVLPESVSDATIASWHKKAGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G+  +  N  +  I   +          K +          ++              
Sbjct: 61  FDTGS-TVTSNQILAIIEEGAVAAAAPAEAKKADAPAPAAAAPAAA-------------- 105

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
             P     A       S+     P  R          S          +    +V+ +  
Sbjct: 106 --PAPAAAAAPAAASKSAADALPPGARFSAITQGVDPSQVEGTGRRGAVTKEDIVNFAKA 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
             +         E +P   +RKTIA RL +SK +        + N+  + + R+++    
Sbjct: 164 GGVGKASGARPEERVPMTRVRKTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKELQDEF 223

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           Q        K+      +KA A A+ + P  N S   + +I H + DIS+AVS   G+VT
Sbjct: 224 QKA---HGIKLGFMSFFVKAAANALQRFPLVNASIDGDDIIYHGYSDISIAVSTDKGLVT 280

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  +++S  D+   +   A +A+  KL  E+ QGGT +I+N G  G      +INPP
Sbjct: 281 PVLRNVERQSFADVEQGIADYAAKARAGKLGLEDLQGGTFTITNGGTFGSLLSTPIINPP 340

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ + +N ++ +A +M   LS DHR +DG  + + L   K  +ENP  M
Sbjct: 341 QSAILGMHAIKERPIAENGQVVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRM 400

Query: 422 L 422
           L
Sbjct: 401 L 401


>gi|121602497|ref|YP_988365.1| dihydrolipoamide acetyltransferase [Bartonella bacilliformis KC583]
 gi|120614674|gb|ABM45275.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Bartonella bacilliformis KC583]
          Length = 401

 Score =  298 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 111/422 (26%), Positives = 193/422 (45%), Gaps = 23/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW KQ G+ ++  + L E+ETDK  +E  S   G + EI+
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKQFGETVAVDEPLVELETDKVTVEVPSPVAGKLSEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + +  +   +     SP  +                     + S +   
Sbjct: 61  AKEG-DTVEVGALLGMVEAGAVGTISSPSPAVAPS--------SVVTSAPAPQFSGHSMP 111

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +P A +L  E+ I+   +SGSG HG+I+K D+   ++ K          S  +   S+ 
Sbjct: 112 PAPSAAKLMAENNIEKIDISGSGKHGQILKEDVLNALTQKVAAPASVESSSSAMSANSV- 170

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                       E +    +R+TIA RL+ ++          + ++  ++ LR++     
Sbjct: 171 ----------REERVRMTKLRQTIARRLKDAQNIAAMLTTFNEVDMSAVMDLRKRYKDVF 220

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++   +++  +AV    G+V 
Sbjct: 221 EKK---HGAKLGFMGFFTKAVCHALKELPAVNAEIDGTDIVYKNYVNAGIAVGTDKGLVV 277

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQKSI +I  E+  L + A+  KL   + QGGT +I+N G+ G      ++N P
Sbjct: 278 PVIRDADQKSIAEIEKEIVHLGRLARDGKLAVTDMQGGTFTITNGGVYGSLMSTPILNAP 337

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ V    +I +  +M   LS DHR VDG  A   L + KE +ENP  +
Sbjct: 338 QSGILGMHAIKERAVVVGGQIVIRPMMYLALSYDHRIVDGQEAVTFLVRVKESLENPERL 397

Query: 422 LM 423
           ++
Sbjct: 398 VL 399


>gi|149201841|ref|ZP_01878815.1| branched-chain alpha-keto acid dehydrogenase E2 subunit
           [Roseovarius sp. TM1035]
 gi|149144889|gb|EDM32918.1| branched-chain alpha-keto acid dehydrogenase E2 subunit
           [Roseovarius sp. TM1035]
          Length = 435

 Score =  298 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 171/438 (39%), Positives = 245/438 (55%), Gaps = 21/438 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+V+EG++ +IL
Sbjct: 1   MATEILMPALSPTMEEGTLAKWLVKEGDTVSAGDLLAEIETDKATMEFEAVEEGVVGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEI----------------PPSPPLSKENIVEVREEHSH 105
           V  GTE + VN+PI  +L +                            E   +       
Sbjct: 61  VAEGTEGVKVNTPIAVMLDEGESAADISSAPAKAEAPAAKQAEATPQAEVAAKPAPAAPK 120

Query: 106 SSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           +            R IA+     LAG  G                        + +    
Sbjct: 121 TGDGDRIFASPLARRIAADKGIDLAGITGSGPHGRIVKADVEGAKAGAAPVASAAEAPAS 180

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             +T              ++ ++   +YE +  D +RKTIA RL ++KQT+PHFY+  + 
Sbjct: 181 KAATPAPAAAPSGPSSDAVVAMYQGRAYEEVKLDGMRKTIAARLTEAKQTVPHFYLRREI 240

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
            +D L+  R ++N+ L+        K+SVND I+KA ALA+  VP+AN  W  + ++R K
Sbjct: 241 RLDALMKFRAELNKQLEPR----GVKLSVNDFIIKACALALQAVPDANAVWAGDKVLRLK 296

Query: 286 HIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
             D++VAV+I GG+ TP+++ A+ KS+  +S E+K LA+RA+ RKL P+EYQGGT +ISN
Sbjct: 297 PSDVAVAVAIEGGLFTPVLKDAEMKSLSALSAEMKDLAKRARDRKLAPQEYQGGTFAISN 356

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHRSVDGAIA 404
           +GM GI +F AVINPP   ILA+GAG KK V  ++ E+ VAT+M+ TLS DHR +DGA+ 
Sbjct: 357 LGMFGIENFDAVINPPHGAILAVGAGLKKPVVGKDGELTVATVMSVTLSVDHRVIDGALG 416

Query: 405 SKLLAKFKEYIENPVWML 422
           ++LL K  E +ENP+ ML
Sbjct: 417 AELLTKIVENLENPMVML 434


>gi|126463384|ref|YP_001044498.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Rhodobacter sphaeroides ATCC 17029]
 gi|126105048|gb|ABN77726.1| 2-oxoglutarate dehydrogenase E2 component [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 509

 Score =  298 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 103/421 (24%), Positives = 183/421 (43%), Gaps = 18/421 (4%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  + +P+L  +++E  ++ W K+ GD ++  ++LCE+ETDK  +E  +   G++ EILV
Sbjct: 105 MIDVMVPALGESVSEATVSTWFKKPGDTVAQDEMLCELETDKVSVEVPAPAAGVLAEILV 164

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             GT  +A  S +  I  D   +  +P        E       +    V +  S  + +A
Sbjct: 165 TEGT-TVAAGSKLALISSDGQGVAAAPKAETPKKTEAAPAQEPAPKKDVEDAPSARKAMA 223

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
                  A +              G      I      +                 ++  
Sbjct: 224 EAGLSPDAVQ--------------GTGRDGRIMKDDVARAVAGASQAAAPAPAPQPALPR 269

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
             +        E +    +R+TIA RL++++ T        + ++  ++ LR +     +
Sbjct: 270 QPVPADDAAREERVKMTRLRQTIARRLKEAQNTAAMLTTYNEVDMSGVMGLRNEYKDAFE 329

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                   K+      +KA   A+ +VPE N       ++   ++ + VAV  P G+V P
Sbjct: 330 KK---HGTKMGFMSFFVKACCHALKEVPEVNAEIDGTDIVYKNYVHMGVAVGTPSGLVVP 386

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R ADQ     I  ++ +L  RA+  KL   E QGG+ +ISN G+ G      ++NPPQ
Sbjct: 387 VVRDADQMGFAQIEKKIAELGLRARDGKLSMAEMQGGSFTISNGGVYGSLMSSPILNPPQ 446

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL +   +++ V +  +I +  +M   LS DHR VDG  A   L + KE +E+P  +L
Sbjct: 447 SGILGMHKIQERPVVEKGQIVIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRLL 506

Query: 423 M 423
           +
Sbjct: 507 L 507



 Score =  122 bits (306), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 54/110 (49%), Gaps = 1/110 (0%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P+L  +++E  +A W K+ GD+++  ++LCE+ETDK  +E  +   G + EI+
Sbjct: 1   MGTEVRVPTLGESVSEATVATWFKKPGDRVAADEMLCELETDKVTVEVHAPVAGRLVEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVV 111
            P GT  +AV++ +  I        P+P  +                 V+
Sbjct: 61  APEGT-TVAVSALLAQIGAAEAGEDPAPEKTHAGAEAKAGAGESKMIDVM 109


>gi|219870876|ref|YP_002475251.1| dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex (E2) [Haemophilus
           parasuis SH0165]
 gi|219691080|gb|ACL32303.1| dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex (E2) [Haemophilus
           parasuis SH0165]
          Length = 405

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 99/422 (23%), Positives = 185/422 (43%), Gaps = 19/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD +   +++ EIETDK ++E  +  +G+I EI 
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKVGDSVKRDEVIVEIETDKVVLEVPATSDGVITEIQ 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  ++           +   N     +  + S         +    +
Sbjct: 61  QGEGA-TVVSKQVLGILVTQQAGDVSLATIKPVNEATPSDRQTASLEPDNSSADALGPSV 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              LA        +  S + G      I     +                +  + ++  +
Sbjct: 120 RRLLAEHGLEASEVKGSGVGGRITREDIEAVVAKR---------------NAKVAEKVEN 164

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                 ++  S + +P   +RK IA RL ++K T        + ++  ++ LR+Q     
Sbjct: 165 TISTVAYSARSEKRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMKPIMDLRKQYGEKF 224

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+VT
Sbjct: 225 EKQ---HGVRLGFMSFYIKAVVEALKRYPEVNASIDGDDVVYHNYFDVSIAVSTPRGLVT 281

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ DI   +K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 282 PVLRDCDKLSMADIEKAIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 341

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A + + V  + ++ +  +M   LS DHR +DG  +   L   K+ +E+P  +
Sbjct: 342 QSAILGMHAIKDRPVAVDGQVVIRPMMYLALSYDHRLIDGRESVGFLVAIKDLLEDPTRL 401

Query: 422 LM 423
           L+
Sbjct: 402 LL 403


>gi|148554218|ref|YP_001261800.1| 2-oxoglutarate dehydrogenase E2 component [Sphingomonas wittichii
           RW1]
 gi|148499408|gb|ABQ67662.1| 2-oxoglutarate dehydrogenase E2 component [Sphingomonas wittichii
           RW1]
          Length = 416

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 101/422 (23%), Positives = 182/422 (43%), Gaps = 8/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P+L  ++TE  L +W+K+ G+ +   + +  +ETDK  +E  +   G+I E++
Sbjct: 1   MATDVVVPTLGESITEATLGQWLKKPGEAVKADEPIASLETDKVSVEVPAPTAGVIAELV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  G + + V + I  I   +T    + P  ++     + E +  +            P+
Sbjct: 61  VGEG-DTVNVGAVIARIDAGATASTAATPAVEDRNAIGQAEAAAPAEPAAAPVEDAGDPV 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
               + R A        S          +  D     +        +          +  
Sbjct: 120 TLSPSVRRAVLEHGVDPSKIKGTGKDGRLTKDDVIAAAKTQPKPAAAAAAPA----AAPV 175

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A       +   E +    +R+T+A RL++++ T        D ++  ++  R +     
Sbjct: 176 AAAAAPAGERREERVRMTRLRQTVASRLKEAQNTAAILTTFNDVDMTAVIEARNKYKDLF 235

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA  +A+  VP  N S   + ++   ++D+SVAVS P G+V 
Sbjct: 236 EKK---HGVRLGFMGFFVKAACMALRDVPAVNASIEGDEIVYRDYVDVSVAVSAPNGLVV 292

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR A   S+  I   +     RAK   LK EE +GGT +ISN G+ G      +INPP
Sbjct: 293 PVIRDAQDLSVAGIEKTIGDFGARAKAGTLKLEEMKGGTFTISNGGVFGSLMSTPIINPP 352

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ +L +   E++ V ++ +I    +M   LS DHR +DG  A   L   K  IE+P  +
Sbjct: 353 QAGVLGLHRIEERPVVRDGQIVARPMMYLALSYDHRLIDGREAVTFLVAIKNAIEDPTRL 412

Query: 422 LM 423
           L+
Sbjct: 413 LI 414


>gi|251792223|ref|YP_003006944.1| dihydrolipoyllysine-residue succinyltransferase [Aggregatibacter
           aphrophilus NJ8700]
 gi|247533611|gb|ACS96857.1| dihydrolipoyllysine-residue succinyltransferase [Aggregatibacter
           aphrophilus NJ8700]
          Length = 401

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 103/422 (24%), Positives = 182/422 (43%), Gaps = 23/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD +   +++ EIETDK ++E  +  +GII EIL
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKAGDAVKRDEVIVEIETDKVVLEVPAQADGIITEIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  +    +    +   + E     R       P          R +
Sbjct: 61  QGEGA-TVVSKQLLGTLEDSVSAAAAAMEKTAEPTPADRRTEVPDEPHTSDVLSPGVRRL 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            + L  +     G  +           ++                         V  + +
Sbjct: 120 LAELDVQATEVKGTGVGGRITREDVEAVIAKR-------------------AAAVKPAEN 160

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                 +A  S + +P   +RK IA RL ++K          + ++  ++SLR+Q     
Sbjct: 161 TVSTVSYAARSEKRVPMTRLRKRIAERLLEAKNNTAMLTTFNEVDMQPIMSLRKQYGEKF 220

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + +I H + D+S+AVS P G+VT
Sbjct: 221 EKQ---HGVRLGFMSFYIKAVVEALKRYPEVNASIDGDDVIYHNYFDVSIAVSTPRGLVT 277

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ +I   +K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 278 PVLRDCDKLSMAEIEKSIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 337

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A + + V    ++ +  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 338 QSAILGMHAIKDRPVAIEGQVVIRPMMYLALSYDHRLIDGRESVGFLVTVKELLEDPTRL 397

Query: 422 LM 423
           L+
Sbjct: 398 LL 399


>gi|84517289|ref|ZP_01004643.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Loktanella
           vestfoldensis SKA53]
 gi|84508769|gb|EAQ05232.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Loktanella
           vestfoldensis SKA53]
          Length = 436

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 167/439 (38%), Positives = 245/439 (55%), Gaps = 22/439 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW  +EGDK+S GDIL EIETDKA MEFE+VDEGI+ +I+
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWHVKEGDKVSSGDILAEIETDKATMEFEAVDEGIMGKIM 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +  GTE + VN  I  +L +         +  E      ++    +P       +    +
Sbjct: 61  IAEGTEGVKVNDVIAVLLEEGESAGDISKVPGEARDASAKKADAPAPAPGPRAAAAAPAV 120

Query: 122 ASPLARRLAGEHGIDL-----------------SSLSGSGPHGRIVKSDIETLISTKTNV 164
           A            +                             +  K+      +T    
Sbjct: 121 APAKDSSRVFASPLARRIAAEKGLDLAGVSGSGPHGRIVKADVQTAKAGATHAPTTAAAP 180

Query: 165 KDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSID 224
           K  +   +  +        ++ ++    Y  +  D +RKTIA RL ++KQ++PHFY+  D
Sbjct: 181 KAEAPKAATTMATGPSTDAVIKMYDGRPYTEVKLDGMRKTIAARLTEAKQSVPHFYLRRD 240

Query: 225 CNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRH 284
            N+D L++ R Q+N  L+        K+SVND I+KA ALA+ QVP+AN  W  +  ++ 
Sbjct: 241 INLDALMAFRGQLNAQLEGR----GVKLSVNDFIIKACALALQQVPDANAVWAGDRTLKF 296

Query: 285 KHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSIS 344
              D++VAV+I GG+ TP++R A+ KS+  +S E+K LA RA+ RKL P+EYQGG+ +IS
Sbjct: 297 AKSDVAVAVAIEGGLFTPVLRDAEMKSLSALSAEMKDLATRARDRKLAPQEYQGGSFAIS 356

Query: 345 NMGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHRSVDGAI 403
           N+GM GI++F A+INPP + ILA+GAG KK +  ++  + VATIM+ TLS DHR +DGA+
Sbjct: 357 NLGMFGIDNFDAIINPPHAAILAVGAGVKKPIVGKDGALAVATIMSVTLSVDHRVIDGAL 416

Query: 404 ASKLLAKFKEYIENPVWML 422
            + LLA  K+ +ENP+ ML
Sbjct: 417 GANLLAAIKDNLENPLTML 435


>gi|77464544|ref|YP_354048.1| dihydrolipoamide acetyltransferase [Rhodobacter sphaeroides 2.4.1]
 gi|77388962|gb|ABA80147.1| 2-oxoglutarate dehydrogenase E2 component [Rhodobacter sphaeroides
           2.4.1]
          Length = 510

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 101/421 (23%), Positives = 182/421 (43%), Gaps = 18/421 (4%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  + +P+L  +++E  ++ W K+ GD ++  ++LCE+ETDK  +E  +   G++ EILV
Sbjct: 106 MIDVMVPALGESVSEATVSTWFKKPGDTVAQDEMLCELETDKVSVEVPAPAAGVLAEILV 165

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             GT  +A  S +  I  D   +  +P        E       +    V +  S  + +A
Sbjct: 166 TEGT-TVAAGSKLALISSDGQGVAAAPKAETPKKTEAAPAQEPAPKKDVEDAPSARKAMA 224

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
                  A +       +        +  +      +                       
Sbjct: 225 EAGLSPDAVQGTGRDGRIMKDDVARAVSGASQAAAPTPAPQPALPRQ------------- 271

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
             +        E +    +R+TIA RL++++ T        + ++  ++ LR +     +
Sbjct: 272 -PVPADDAAREERVKMTRLRQTIARRLKEAQNTAAMLTTYNEVDMSGVMGLRNEYKDAFE 330

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                   K+      +KA   A+ +VPE N       ++   ++ + VAV  P G+V P
Sbjct: 331 KK---HGTKMGFMSFFVKACCHALKEVPEVNAEIDGTDIVYKNYVHMGVAVGTPSGLVVP 387

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R ADQ     I  ++ +L  RA+  KL   E QGG+ +ISN G+ G      ++NPPQ
Sbjct: 388 VVRDADQMGFAQIEKKIAELGLRARDGKLSMAEMQGGSFTISNGGVYGSLMSSPILNPPQ 447

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL +   +++ V +  +I +  +M   LS DHR VDG  A   L + KE +E+P  +L
Sbjct: 448 SGILGMHKIQERPVVEKGQIVIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRLL 507

Query: 423 M 423
           +
Sbjct: 508 L 508



 Score =  126 bits (317), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 30/111 (27%), Positives = 55/111 (49%), Gaps = 1/111 (0%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           MM   + +P+L  +++E  +A W K+ GD+++  ++LCE+ETDK  +E  +   G + EI
Sbjct: 1   MMGTEVRVPTLGESVSEATVATWFKKPGDRVAADEMLCELETDKVTVEVHAPVAGRLVEI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVV 111
           + P GT  +AV++ +  I        P+P  +                 V+
Sbjct: 61  VAPEGT-TVAVSALLAQIGAAEAGEDPAPEKTHAGAEAKAGAGESKMIDVM 110


>gi|85374428|ref|YP_458490.1| dihydrolipoamide succinyl transferase [Erythrobacter litoralis
           HTCC2594]
 gi|84787511|gb|ABC63693.1| dihydrolipoamide succinyl transferase [Erythrobacter litoralis
           HTCC2594]
          Length = 416

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 119/424 (28%), Positives = 184/424 (43%), Gaps = 12/424 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++TEG + +W+KQ GD +   + +  +ETDK  +E  S   G+I E+ 
Sbjct: 1   MTTEIQVPQLGESVTEGTIGEWLKQPGDAVEVDEPIASLETDKVAVEVPSPVAGVIGELK 60

Query: 62  VPAGTENIAVNSPILNILMD--STEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNR 119
              G + + V + I  +             P   +   E   E                 
Sbjct: 61  AEVG-DTVEVGAVIATVEEGATGAATKGEEPARSQEKREQGREERAEQEEATDSPSVDGS 119

Query: 120 PIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDES 179
              SP  RR   EHG+D S++ G+G  GR+ K D+      K +    S          +
Sbjct: 120 QTLSPAVRRAVLEHGVDPSTIKGTGKDGRLTKEDVVAAARAKRDGGGESASA------PA 173

Query: 180 IDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
                     +   E +    +R+TIA RL+ +++         D ++  ++  R +   
Sbjct: 174 PAPAAATSGGERREERVKMTRMRQTIAKRLKGAQEEAALLTTFNDVDMSAVIEARTKYKD 233

Query: 240 TLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGI 299
                      ++       KA  LA+  VP  N       ++ H +IDISVAVS P G+
Sbjct: 234 LFAKK---HDIRLGFMGFFAKAACLALKDVPSVNAYIEGEEIVYHDYIDISVAVSAPNGL 290

Query: 300 VTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVIN 359
           V P+IR A  K    I  ++    +RAK+  L  E+ +GGT +ISN G+ G      +IN
Sbjct: 291 VVPVIRDAQAKGFAQIEKDIADFGKRAKEGTLTMEDMKGGTFTISNGGVFGSLMSTPIIN 350

Query: 360 PPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPV 419
           PPQS +L +   E + V  N E+ +  +M   LS DHR +DG  A   L   KE IE+P 
Sbjct: 351 PPQSAVLGLHRIEDRPVAVNGEVVIRPMMYIALSYDHRLIDGREAVTALKIIKEAIEDPT 410

Query: 420 WMLM 423
            ML+
Sbjct: 411 RMLI 414


>gi|312884955|ref|ZP_07744645.1| dihydrolipoamide succinyltransferase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367432|gb|EFP94994.1| dihydrolipoamide succinyltransferase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 401

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 99/422 (23%), Positives = 184/422 (43%), Gaps = 23/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W KQ GD +   ++L +IETDK ++E  + + G+++ I+
Sbjct: 1   MTIEILVPDLPESVADATVATWHKQPGDAVERDEVLVDIETDKVVLEVPAPEAGVLEAII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     I  +   +    P+   ++E+     + H  S      +  S     
Sbjct: 61  EEEGA-TVLSKQLIAKLKPGAVAGEPTSDTTQESEASPDKRHKASLTEESSDALSPAVRR 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A +          +        ++  +  S                   +  
Sbjct: 120 LLAEHSLDASQVKGTGVGGRITREDIEAHLANGSSAKS-------------------ADS 160

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A +    A  S + +P   +RKT+A RL ++K +        + N+  ++ LR+Q     
Sbjct: 161 APVEAPAALRSQKRVPMTRLRKTVANRLLEAKNSTAMLTTFNEVNMKPIMDLRKQYKDQF 220

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 221 EKR---HDTRLGFMSFYVKAVTEALKRFPEVNASIDGDDIVYHNYFDISMAVSTPRGLVT 277

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D     DI   +K+LA + +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 278 PVLKDCDTLGFADIEKGIKELAIKGRDGKLTVDELMGGNFTITNGGVFGSLMSTPIINPP 337

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 338 QSAILGMHKIQDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARL 397

Query: 422 LM 423
           L+
Sbjct: 398 LL 399


>gi|126728755|ref|ZP_01744570.1| Dihydrolipoamide acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [Sagittula stellata E-37]
 gi|126710685|gb|EBA09736.1| Dihydrolipoamide acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [Sagittula stellata E-37]
          Length = 433

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 162/436 (37%), Positives = 235/436 (53%), Gaps = 19/436 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+VDEG+I  I+
Sbjct: 1   MPVEIQMPALSPTMEEGTLAKWLVKEGDTVSSGDVLAEIETDKATMEFEAVDEGVIGRIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  GT  + V + I  +L +          ++             +        +   P 
Sbjct: 61  VAEGTAEVKVGTVIAVLLEEGETAEDIGTSAESTAETPATPEEEPAAPKTDSHAAPPAPE 120

Query: 122 ASPLARRLAGEHGIDLSSLS--------------GSGPHGRIVKSDIETLISTKTNVKDY 167
            +   R  A      +++                          +               
Sbjct: 121 RADGERIFASPLARRIAAQKGLDLSRITGSGPRGRIVKADVESATAEPAAAKPAAAAATP 180

Query: 168 STIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNI 227
           +   +         +++  L+A   Y  +P D +R+TIA RL ++KQTIPHFY+  D  +
Sbjct: 181 AVAPAKAAPTPVDPSSVAALYADRDYTEVPLDGMRRTIAARLTEAKQTIPHFYLRRDITL 240

Query: 228 DNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHI 287
           D L++ R Q+N  L         K+SVND I+KA A+A+ QVP+AN  W  + +++    
Sbjct: 241 DALMAFRAQLNEQLAPR----GVKLSVNDFIIKACAMALQQVPKANAVWAGDRILQLTPS 296

Query: 288 DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMG 347
           D++VAV+I GG+ TP++R A QK++  +S ++K LA RA+ RKL P EYQGG+ +ISN+G
Sbjct: 297 DVAVAVAIEGGLFTPVLRDAHQKTLSALSADMKDLAARARDRKLAPSEYQGGSFAISNLG 356

Query: 348 MLGINSFCAVINPPQSTILAIGAGEKKVVFQ-NEEIKVATIMNATLSADHRSVDGAIASK 406
           M GI +F AVINPP   ILA+GAG KK V   +  + VAT+M+ TLS DHR +DGA+ ++
Sbjct: 357 MFGIENFDAVINPPHGAILAVGAGVKKPVVNADGALAVATVMSVTLSVDHRVIDGALGAE 416

Query: 407 LLAKFKEYIENPVWML 422
           LL   K  +ENP+ ML
Sbjct: 417 LLTAIKGNLENPLAML 432


>gi|295696004|ref|YP_003589242.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Bacillus tusciae DSM 2912]
 gi|295411606|gb|ADG06098.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Bacillus tusciae DSM 2912]
          Length = 435

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 110/438 (25%), Positives = 186/438 (42%), Gaps = 21/438 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ E  +  W K EGD ++ G+ + E+ETDK  +E  S ++G+++ IL
Sbjct: 1   MA-DIKVPELGESIVEATILSWRKNEGDPVAKGETVAEVETDKVNVEVASEEDGVLEAIL 59

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPV-----------V 110
            PAG E + V   I  I   + +       ++    +         P             
Sbjct: 60  KPAG-ETVFVGETIARIRSGAADQAAEHTPNQPARGQEPTPPETKHPNAGEKGLAVESRP 118

Query: 111 VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNV-----K 165
           V     K  P  +      A +     SS++   P     +         +        +
Sbjct: 119 VEASRGKTGPQTADNPSPAALDQATAPSSVTSPTPRTPSQRRRARQADGPQAAPATSAAR 178

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
                ++                 +   E IP    R+TIA RL ++KQ+        + 
Sbjct: 179 TEVVREATAPAAPVAPGTTAASPLRPDEERIPMTRRRQTIARRLLEAKQSTAMLTTFNEI 238

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
           ++  +L LR +     +         +       +A   A+   P  N     N ++   
Sbjct: 239 DMSAVLDLRRRRKDQFKEE---HGVGLGFMSFFTRAAVGALKAFPMLNAEIEGNEIVVKH 295

Query: 286 HIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
           H DI +AV+ P G+V P++R AD+ +  +I   +  LA+RA++  L P+E QGGT +I+N
Sbjct: 296 HYDIGIAVATPAGLVVPVVRDADRLTFAEIESRIADLAKRAREGTLHPQELQGGTFTITN 355

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIAS 405
            G+ G      ++NPPQ  IL + A +++ V    +I +  +M   LS DHR VDGA A 
Sbjct: 356 GGVFGSLFSTPILNPPQVGILGMHAIKERPVAVEGQIVLRPMMYVALSYDHRIVDGAEAV 415

Query: 406 KLLAKFKEYIENPVWMLM 423
           + L K KE +E+P  +L+
Sbjct: 416 QFLVKVKEMVEDPETLLL 433


>gi|319406379|emb|CBI80020.1| dihydrolipoamide succinyltransferase [Bartonella sp. AR 15-3]
          Length = 409

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 97/422 (22%), Positives = 186/422 (44%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++TE  + KW K+ G+ ++  + L E+ETDK  +E  S   G + EI+
Sbjct: 1   MATEIRVPILGESVTEATIGKWFKKIGEAVAMDEPLVELETDKVTVEVPSPVAGKLSEII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + VN+ +  +   +  +  SP +S    +      + +   +     + +   
Sbjct: 61  AKEG-DTVEVNALLGMVEAGADGVSASPAVSASPALSSSVTSTPTFAPMAASVSAFSLGG 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
             P     A     +    S     G+  +     ++      K+ S   S     ++++
Sbjct: 120 TMPPTPSAAKLMAENNIEKSDLAGSGKHGQILKGDVLDVLAQGKETSASVSSVASMDAVN 179

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                       E +    +R+TIA RL+ ++ T        + ++  ++ LR++     
Sbjct: 180 E-----------ERVRMTKLRQTIARRLKDAQNTAAMLTTFNEVDMSTVMDLRKRYKDLF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++   +++  +AV    G+V 
Sbjct: 229 EKK---HGVKLGFMGFFTKAVCHALKELPAVNAEIDGTDIVYKNYVNAGIAVGTDKGLVV 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ SI +I  E+ +L + A+  KL   +  GGT +I+N G+ G      ++N P
Sbjct: 286 PVVRNADQMSIAEIEKEIGRLGRLARDGKLAVADMLGGTFTITNGGVYGSLMSTPILNAP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +    +I +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 346 QSGILGMHAIKERAMVVGGQIVIRPMMYLALSYDHRIVDGQEAVTFLVRVKESLEDPERL 405

Query: 422 LM 423
           ++
Sbjct: 406 VL 407


>gi|84684239|ref|ZP_01012141.1| Dihydrolipoamide transsuccinylase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84667992|gb|EAQ14460.1| Dihydrolipoamide transsuccinylase [Rhodobacterales bacterium
           HTCC2654]
          Length = 507

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 108/421 (25%), Positives = 181/421 (42%), Gaps = 24/421 (5%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
              I +P+L  +++E  ++ W K+ GD ++  ++LCE+ETDK  +E  +   G I EIL 
Sbjct: 109 SVDIMVPALGESVSEATVSTWFKKVGDTVAADEMLCELETDKVSVEVPAPSAGTITEILA 168

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G E +A  + +  I        P+P        E +                      
Sbjct: 169 DEG-ETVAAGAKLGVISASGDAPAPAPKSEAPKGDEAKSS-------------------- 207

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
           S      A      ++         +    D   +          S   +      S   
Sbjct: 208 SGKDVEDAPSAKKMMAEAGLKSDDVKGTGRDGRVMKEDVQAAISASKSAASSPAPASAPR 267

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
             ++   +   E +    +R+TIA RL++++ T        + ++  +++LR +      
Sbjct: 268 APVSADDEAREERVKMTRLRQTIARRLKEAQNTAAMLTTYNEVDMTEVMALRNEYKDLFF 327

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                   K+      +KA A A+ +VPE N       +I   ++ + VAV  P G+V P
Sbjct: 328 KK---HGIKLGFMSFFVKACAHALKEVPEVNAEIDGTDVIYKNYVHMGVAVGTPTGLVVP 384

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R ADQ S   I  ++ +L +RA+  KL   E QGG+ +ISN G+ G      ++NPPQ
Sbjct: 385 VVRDADQMSFHGIEAKINELGKRARDGKLSMAEMQGGSFTISNGGVYGSLMSSPILNPPQ 444

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL +   + + +  N EIK+  +M   LS DHR VDG  A   L + KE +E+P  +L
Sbjct: 445 SGILGMHKIQDRPMVVNGEIKIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRLL 504

Query: 423 M 423
           M
Sbjct: 505 M 505



 Score =  131 bits (328), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   + +P+L  ++TE  +A W K+ GD +   ++LCE+ETDK  +E  +   G + +I+
Sbjct: 1  MSTEVRVPTLGESVTEATVATWFKKPGDAVQADEMLCELETDKVTVEVPAPAAGTLGDIV 60

Query: 62 VPAGTENIAVNSPILNILMDSTEIP 86
             G + + V++ +  I       P
Sbjct: 61 ANEG-DTVGVDALLATIEEGEGAKP 84


>gi|67459485|ref|YP_247109.1| dihydrolipoamide acetyltransferase [Rickettsia felis URRWXCal2]
 gi|75536108|sp|Q4UKI7|ODO2_RICFE RecName: Full=Dihydrolipoyllysine-residue succinyltransferase
           component of 2-oxoglutarate dehydrogenase complex;
           AltName: Full=2-oxoglutarate dehydrogenase complex
           component E2; Short=OGDC-E2; AltName:
           Full=Dihydrolipoamide succinyltransferase component of
           2-oxoglutarate dehydrogenase complex
 gi|67005018|gb|AAY61944.1| Dihydrolipoamide acetyltransferase component [Rickettsia felis
           URRWXCal2]
          Length = 401

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 109/422 (25%), Positives = 178/422 (42%), Gaps = 23/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +PSL  ++TE  +AKW K+EGD +   ++L EIET+K  +E  +  +G I +I 
Sbjct: 1   MSVKIIVPSLGESVTEATIAKWYKKEGDPVKTDELLLEIETEKVTLEVNAPCDGTIGKIS 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G  N+AV   I  I   +                V +  S          ++   P 
Sbjct: 61  KTDGA-NVAVGEEIGEINEGAAANTAGTNNESAKAQAVTQPTSEKPVEKPAVVNNILAPS 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              L      +      +          V   I T                      +  
Sbjct: 120 VQKLVTENKLDPNNIKGTGRDGRITKGDVLETINT-------------------PSAATS 160

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
              +N   ++  + +    +RKTIA RL+ S+ T        + ++  +++LR Q     
Sbjct: 161 TPTVNKTNEERVQRVRMSRLRKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEF 220

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+      +KA   A+  +P  N     + ++   + DI VAV    G+V 
Sbjct: 221 EKK---HLVKLGFMSFFVKATIEALKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVV 277

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD+    ++   +  LA++A++ KL   +  GGT SISN G+ G      +INPP
Sbjct: 278 PVVRDADKMGFAEVEKAIGTLAKKAREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPP 337

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   E++ V  + +I++  +M   LS DHR +DG      L K KE IENP  +
Sbjct: 338 QSGILGLHKTEERAVVIDGKIEIRPMMYIALSYDHRIIDGKEGVSFLVKIKELIENPEKL 397

Query: 422 LM 423
           L+
Sbjct: 398 LL 399


>gi|285018445|ref|YP_003376156.1| dihydrolipoamide succinyltransferase [Xanthomonas albilineans GPE
           PC73]
 gi|283473663|emb|CBA16166.1| probable dihydrolipoamide succinyltransferase protein [Xanthomonas
           albilineans]
          Length = 404

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 101/421 (23%), Positives = 180/421 (42%), Gaps = 20/421 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++++  +A W K+ GD +   + L ++ETDK ++E  S  +G++ EI 
Sbjct: 1   MATEVKVPVLPESVSDATIASWHKKAGDAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G  ++  +  +  I   ++                    + ++              
Sbjct: 61  FETGA-SVTSSQILAIIEEGASAAASPAAAKDAAAPTPSAPKAAAA-------------- 105

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                +    E       +S   P  R          +          +    +++ + +
Sbjct: 106 --ETPKAAKVETPKASGDVSSLPPGARFSAITEGVDPAQVEGTGRRGAVTKEDILNYAKN 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                       E +P   +RK IA RL QSK +        + N+  + + R+++    
Sbjct: 164 GGAGKASGARPEERVPMTRVRKRIAERLMQSKNSTAMLTTFNEVNLAKVSAARKELQDEF 223

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           Q        K+      +KA A A+ + P  N S     +I H + DIS+AVS   G+VT
Sbjct: 224 QK---VHGIKLGFMSFFVKAAANALQRFPLVNASIDGEDIIYHGYSDISIAVSTDKGLVT 280

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  ++ S  DI   +   A++A+  KL  EE QGGT +++N G  G      +INPP
Sbjct: 281 PVLRNVERLSFADIEQGIADYAKKARDGKLSLEELQGGTFTVTNGGTFGSLLSTPIINPP 340

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ + +N ++ +A +M   LS DHR +DG  + + L   K  +ENP  M
Sbjct: 341 QSAILGMHAIKERPIAENGQVVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRM 400

Query: 422 L 422
           L
Sbjct: 401 L 401


>gi|67459153|ref|YP_246777.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           felis URRWXCal2]
 gi|75536415|sp|Q4ULG1|ODP2_RICFE RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component of pyruvate dehydrogenase complex; AltName:
           Full=Dihydrolipoamide acetyltransferase component of
           pyruvate dehydrogenase complex; AltName: Full=E2
 gi|67004686|gb|AAY61612.1| Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rickettsia felis URRWXCal2]
          Length = 412

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 171/422 (40%), Positives = 260/422 (61%), Gaps = 10/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP LSPTMTEG LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I+
Sbjct: 1   MPIKILMPVLSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +P  ++N+ VNS I  +  +  E         +N        + ++              
Sbjct: 61  IPQNSQNVPVNSLIAVLSEEGEEKTDIDAFIAKNNNVSPSPKTDANLPKP-------HEN 113

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            + +  ++A          +           +I       +        Q       S  
Sbjct: 114 IAKVEEQVAVIKHDASKIFASPLAKRLAKMGNIRLESVKGSGPHGRIVKQDILSYTPSTV 173

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            N +     + Y ++P++NIRK IA RL +SKQT+PHFY+SI+CN+D LL +RE +N++ 
Sbjct: 174 HNKIVSRNPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKSF 233

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
               E+ S +ISVND I+ A A A+ ++P AN SW  +A+  H ++DISVAV+I  G+VT
Sbjct: 234 ---SEDKSTRISVNDFIILAVAKALQELPNANASWGEDAIRYHNNVDISVAVAIENGLVT 290

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI++ A+QK+I+++S E+K+L ++AK  KL PEE+QGG  +ISN+GM GI +F A+INPP
Sbjct: 291 PIVKNANQKNIIELSREMKELIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPP 350

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS I+ +GA  K+ + +N+++ +ATIM+ TLSADHR VDGA+ ++ LA FK++IE+P  M
Sbjct: 351 QSCIMGVGASAKRAIVKNDQVTIATIMDVTLSADHRVVDGAVGAEFLAAFKKFIESPALM 410

Query: 422 LM 423
           L+
Sbjct: 411 LI 412


>gi|49476302|ref|YP_034343.1| dihydrolipoamide acetyltransferase [Bartonella henselae str.
           Houston-1]
 gi|38489205|gb|AAR21287.1| dihydrolipoamide succinyltransferase [Bartonella henselae]
 gi|49239110|emb|CAF28414.1| Dihydrolipoamide succinyltransferase [Bartonella henselae str.
           Houston-1]
          Length = 406

 Score =  297 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 103/422 (24%), Positives = 187/422 (44%), Gaps = 18/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ ++  + L E+ETDK  +E  S   G + EI+
Sbjct: 1   MTTEIRVPTLGESVTEATVGKWFKKLGEAVAVDEPLIELETDKVTVEVPSPVAGKLSEII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + +  +   +  I  S   S   I EV  E   SS            P 
Sbjct: 61  AKEG-DTVEVKALLGLVEAGAAGISQSFSPSATPIPEVPSELKQSS--SSGAMQKDTMPP 117

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           +   A+ +A  +    +          + +  +  L          +   S  LV E  +
Sbjct: 118 SPSAAKLMAENNIAKSNISGSGKRGQILKEDVLGVLEQEVKAPSVSAASSSASLVQEKHE 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                       E +    +R+TIA RL+ ++ T        + ++  ++ LR++     
Sbjct: 178 ------------ERVRMTKLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMDLRKRYKDLF 225

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++   ++++ +AV    G+V 
Sbjct: 226 EKK---HGVKLGFMGFFTKAVCHALKELPAVNAEIDGTDIVYKNYVNVGIAVGTDKGLVV 282

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ S+ +I  E+ +L + A+  KL   + QGGT +I+N G+ G      ++N P
Sbjct: 283 PVVRHADQMSLAEIEKEIGRLGRLARDGKLAVSDMQGGTFTITNGGVYGSLMSTPILNAP 342

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +    +I +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 343 QSGILGMHAIKERAMVVGGQIVIRPMMYLALSYDHRIVDGQEAVTFLVRVKESLEDPERL 402

Query: 422 LM 423
           ++
Sbjct: 403 VL 404


>gi|119383306|ref|YP_914362.1| dihydrolipoamide acetyltransferase [Paracoccus denitrificans
           PD1222]
 gi|119373073|gb|ABL68666.1| 2-oxoglutarate dehydrogenase E2 component [Paracoccus denitrificans
           PD1222]
          Length = 510

 Score =  297 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 102/421 (24%), Positives = 172/421 (40%), Gaps = 20/421 (4%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
              + +P+L  ++TE  +A W K+ GD ++  ++LCE+ETDK  +E  +   G++ EIL 
Sbjct: 108 SVDVMVPTLGESVTEATVATWFKKVGDSVAQDEMLCELETDKVSVEVPAPAAGVLAEILA 167

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
           P G   +  ++ +  I   +  +  +   +           + +                
Sbjct: 168 PEGA-TVDASAKLAIITEGAAGVAKAEAPAAAVQSPGAGPETPAP--------------- 211

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
                  A      ++    S         D   +              S          
Sbjct: 212 -RKDVEDAPSAKKAMAEAGVSRDAVTGTGRDGRVMKEDVARAASAPQAASPAPAPAQAPR 270

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
              +       E +    +R TIA RL+ ++ T        + ++  ++ LR       +
Sbjct: 271 APSSADDAAREERVKMTRLRATIARRLKDAQNTAAMLTTYNEVDMKGIMDLRNTYKDQFE 330

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                   K+      +KA   A+ +VPE N       ++    + + VAV  P G+V P
Sbjct: 331 KK---HKVKLGFMSFFVKACCHALKEVPEVNAEIDGGDVVYKNFVHMGVAVGTPNGLVVP 387

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R ADQKS   I  E+ +L  RA+  KL   E QGGT +ISN G+ G      ++NPPQ
Sbjct: 388 VVRDADQKSFARIEKEIAELGTRARDGKLTMAEMQGGTFTISNGGVYGSLMSSPILNPPQ 447

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL +   + + V  + +I +  +M   LS DHR VDG  A   L + KE +E+P  +L
Sbjct: 448 SGILGMHKIQDRPVVVDGQIVIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRLL 507

Query: 423 M 423
           M
Sbjct: 508 M 508



 Score =  125 bits (312), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 49/93 (52%), Gaps = 1/93 (1%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   + +P+L  +++E  +A W K+ GD+++  ++LCE+ETDK  +E  S   G + EI+
Sbjct: 1  MAVELRVPTLGESVSEATVATWFKKPGDRVAVDEMLCELETDKVTVEVPSPVAGKLAEIV 60

Query: 62 VPAGTENIAVNSPILNILMDSTEIPPSPPLSKE 94
           P G   +A N+ +  I+      P       +
Sbjct: 61 APEGA-VVAPNALLAQIMEQGDAGPEEMLPKAD 92


>gi|167001006|ref|ZP_02266807.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Burkholderia mallei PRL-20]
 gi|243063184|gb|EES45370.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Burkholderia mallei PRL-20]
          Length = 424

 Score =  297 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 118/426 (27%), Positives = 201/426 (47%), Gaps = 7/426 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL E+ETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G + +  +  I  I  ++     +      ++       +  +P       + +  
Sbjct: 61  LQNDG-DTVVADQVIATIDTEAKAGAAAAAAGAADVQSAAAPVAAPAPAAQPAAAASSTA 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
             SP A +L  E GI    ++GSG  GRI K D+ +  S        +  ++        
Sbjct: 120 ATSPAASKLMAEKGIGAGDVAGSGRDGRITKGDVLSAGSAPKAAPAAAPAKAAVKPALPE 179

Query: 181 ---DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
               A+          + +P   +R  IA RL +S+QT        + N+  ++ LR + 
Sbjct: 180 VKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKY 239

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
               +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P 
Sbjct: 240 KDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPR 296

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G+V PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G      +
Sbjct: 297 GLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPI 356

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           INPPQS IL + A +++ V +N +I +  I    LS DHR +DG  A   L   K+ +E+
Sbjct: 357 INPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALED 416

Query: 418 PVWMLM 423
           P  +L+
Sbjct: 417 PARLLL 422


>gi|297584334|ref|YP_003700114.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Bacillus selenitireducens MLS10]
 gi|297142791|gb|ADH99548.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Bacillus selenitireducens MLS10]
          Length = 421

 Score =  297 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 101/423 (23%), Positives = 182/423 (43%), Gaps = 6/423 (1%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I +P L+ ++TEG +AKW+K  GD I  GD + E+ETDK  +E  +   GI+ E+L 
Sbjct: 1   MIEIKVPELAESITEGTIAKWLKSPGDTIEKGDDIVELETDKVNVEVHAEASGILSEVLF 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G + + V   I  +   + +   +   +++         + +         S +    
Sbjct: 61  EEG-DTVQVGDVIARLEAGNNDDKENEQQNEDTESTSDTAKADAGNDQKEAVSSDSSGQT 119

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETL-ISTKTNVKDYSTIQSFGLVDESID 181
                +            +             + +   T  ++  +S  ++         
Sbjct: 120 EKNKEQERIIASPATRKYAREKGIDLKDIQPADPMGKVTNRDIDHHSQGKTNQNQSTDSS 179

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           ++  +   +           R+TIA RL +++QT        + ++ NL++LR++     
Sbjct: 180 SDTHDDDIRKPVRREKMSRRRQTIAKRLVEAQQTAAMLTTFNEVDMTNLMALRDRRKDKF 239

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           Q        K+       KA   A+ + P  N     + +I     DI +AVS   G+V 
Sbjct: 240 QDDF---GVKLGFMSFFTKAVIGALKKYPYVNAEIDGDEIILKDFYDIGMAVSTEDGLVV 296

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD+     I  E+  LA++A  +KL  E+ QGG+ +I+N G+ G      ++N P
Sbjct: 297 PVVRDADRLDFAGIEKEIGHLAEKAHGKKLGLEDLQGGSFTITNGGVFGSLWSTPILNSP 356

Query: 362 QSTILAIGAGEKKVVFQ-NEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           Q  IL +   +K+ V   ++  +   +M   LS DHR +DG  A   L K KE IE+P  
Sbjct: 357 QVGILGMHTIQKRPVATGDDTFENRPMMYIALSYDHRIIDGKDAVGFLVKVKELIEDPES 416

Query: 421 MLM 423
           +L+
Sbjct: 417 LLL 419


>gi|53724835|ref|YP_102750.1| dihydrolipoamide succinyltransferase [Burkholderia mallei ATCC
           23344]
 gi|121598930|ref|YP_992827.1| dihydrolipoamide succinyltransferase [Burkholderia mallei SAVP1]
 gi|124385896|ref|YP_001026170.1| dihydrolipoamide succinyltransferase [Burkholderia mallei NCTC
           10229]
 gi|126449605|ref|YP_001080560.1| dihydrolipoamide succinyltransferase [Burkholderia mallei NCTC
           10247]
 gi|254178108|ref|ZP_04884763.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia mallei ATCC 10399]
 gi|254199699|ref|ZP_04906065.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia mallei FMH]
 gi|254206022|ref|ZP_04912374.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia mallei JHU]
 gi|254358394|ref|ZP_04974667.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia mallei 2002721280]
 gi|52428258|gb|AAU48851.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia mallei ATCC 23344]
 gi|121227740|gb|ABM50258.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia mallei SAVP1]
 gi|124293916|gb|ABN03185.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Burkholderia mallei NCTC 10229]
 gi|126242475|gb|ABO05568.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Burkholderia mallei NCTC 10247]
 gi|147749295|gb|EDK56369.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia mallei FMH]
 gi|147753465|gb|EDK60530.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia mallei JHU]
 gi|148027521|gb|EDK85542.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia mallei 2002721280]
 gi|160699147|gb|EDP89117.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia mallei ATCC 10399]
          Length = 424

 Score =  297 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 118/426 (27%), Positives = 201/426 (47%), Gaps = 7/426 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL E+ETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G + +  +  I  I  ++     +      ++       +  +P       + +  
Sbjct: 61  LQNDG-DTVVADQVIATIDTEAKAGAAAAAAGAADVQSAAAPVAAPAPAAQPAAAASSTA 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
             SP A +L  E GI    ++GSG  GRI K D+ +  S        +  ++        
Sbjct: 120 ATSPAASKLMAEKGIGAGDVAGSGRDGRITKGDVLSAGSAPKAAPAAAPAKAAAKPALPE 179

Query: 181 ---DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
               A+          + +P   +R  IA RL +S+QT        + N+  ++ LR + 
Sbjct: 180 VKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKY 239

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
               +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P 
Sbjct: 240 KDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPR 296

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G+V PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G      +
Sbjct: 297 GLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPI 356

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           INPPQS IL + A +++ V +N +I +  I    LS DHR +DG  A   L   K+ +E+
Sbjct: 357 INPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALED 416

Query: 418 PVWMLM 423
           P  +L+
Sbjct: 417 PARLLL 422


>gi|217423636|ref|ZP_03455137.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia pseudomallei 576]
 gi|217393494|gb|EEC33515.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia pseudomallei 576]
          Length = 424

 Score =  297 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 119/426 (27%), Positives = 202/426 (47%), Gaps = 7/426 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL E+ETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G + +  +  I  I  ++     +      ++       +  +P       + +  
Sbjct: 61  LQNDG-DTVVADQVIATIDTEAKAGAAAAAAGAADVQPAAAPVAAPAPAAQPAAAASSTA 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
            ASP A +L  E GI    ++GSG  GRI K D+ +  S        +  ++        
Sbjct: 120 AASPAASKLMAEKGIGAGDVAGSGRDGRITKGDVLSAGSAPKAAPAAAPAKAAAKPALPE 179

Query: 181 ---DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
               A+          + +P   +R  IA RL +S+QT        + N+  ++ LR + 
Sbjct: 180 VKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKY 239

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
               +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P 
Sbjct: 240 KDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPR 296

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G+V PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G      +
Sbjct: 297 GLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPI 356

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           INPPQS IL + A +++ V +N +I +  I    LS DHR +DG  A   L   K+ +E+
Sbjct: 357 INPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALED 416

Query: 418 PVWMLM 423
           P  +L+
Sbjct: 417 PARLLL 422


>gi|300722387|ref|YP_003711673.1| dihydrolipoyltranssuccinate transferase, component of the
           2-oxoglutarate dehydrogenase complex [Xenorhabdus
           nematophila ATCC 19061]
 gi|297628890|emb|CBJ89473.1| dihydrolipoyltranssuccinate transferase, component of the
           2-oxoglutarate dehydrogenase complex [Xenorhabdus
           nematophila ATCC 19061]
          Length = 403

 Score =  297 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 102/423 (24%), Positives = 184/423 (43%), Gaps = 22/423 (5%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  + + G+++ I
Sbjct: 1   MSSVEILVPDLPESVADATVATWHKKPGDTVERDEVLVEIETDKVVLEVPASEAGVLEAI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G   +     I  I +  +   P+    K      + + +              R 
Sbjct: 61  LEEEGA-TVLSKQLIGRIRLGDSTGIPADVKEKTEATPAQRQTASLEEESNDALSPAVRR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           + +      A   G  +          + + ++                         + 
Sbjct: 120 LIAEHDLNPAAIKGSGVGGRIVREDVEKHIAANK------------------KEGDKPAA 161

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
            A+  +  +  S + +P   +RK +A RL ++K          + N+  +  LR+Q    
Sbjct: 162 PASQQSSLSHRSEKRVPMTRLRKRVAERLLEAKNNTAMLTTFNEVNMKPIQELRKQYGDA 221

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S     ++ H + DIS+AVS P G+V
Sbjct: 222 FEKR---HGMRLGFMSFYVKAVVEALKRYPEVNASIDGTDVVYHNYFDISIAVSTPRGLV 278

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R AD  S+ +I   +K+LA + +  KL  EE  GG  +I+N G+ G      +INP
Sbjct: 279 TPVLRDADALSMAEIEKSIKELAIKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINP 338

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 339 PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKEMLEDPTR 398

Query: 421 MLM 423
           +L+
Sbjct: 399 LLL 401


>gi|134295583|ref|YP_001119318.1| dihydrolipoamide succinyltransferase [Burkholderia vietnamiensis
           G4]
 gi|134138740|gb|ABO54483.1| 2-oxoglutarate dehydrogenase E2 component [Burkholderia
           vietnamiensis G4]
          Length = 425

 Score =  297 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 116/427 (27%), Positives = 198/427 (46%), Gaps = 8/427 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL E+ETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G + +  +  I  I  ++             +       + +         + +  
Sbjct: 61  LQNDG-DTVVADQVIATIDTEAKAGAAQAAAGAAEVQPAAAPAAAAPAAQPAAATASSSA 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDE-- 178
            ASP A +L  E G+    ++GSG  GR+ K D     S        +  ++        
Sbjct: 120 AASPAAAKLLAEKGLSTGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKTAAAKPSLP 179

Query: 179 --SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
              + A+          + +P   +R  IA RL +S+QT        + N+  ++ LR +
Sbjct: 180 EVKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAK 239

Query: 237 MNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIP 296
                +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P
Sbjct: 240 YKDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSP 296

Query: 297 GGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCA 356
            G+V PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G      
Sbjct: 297 RGLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTP 356

Query: 357 VINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIE 416
           +INPPQS IL + A +++ V +N +I +  I    LS DHR +DG  A   L   K+ +E
Sbjct: 357 IINPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALE 416

Query: 417 NPVWMLM 423
           +P  +L+
Sbjct: 417 DPARLLL 423


>gi|319899501|ref|YP_004159598.1| dihydrolipoamide succinyltransferase [Bartonella clarridgeiae 73]
 gi|319403469|emb|CBI77049.1| dihydrolipoamide succinyltransferase [Bartonella clarridgeiae 73]
          Length = 403

 Score =  297 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 97/422 (22%), Positives = 177/422 (41%), Gaps = 21/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ ++  + L E+ETDK  +E  S   G + EI+
Sbjct: 1   MATEIRVPTLGESVTEATIGKWFKKIGEAVAMDEPLVELETDKVTVEVPSPVAGKLSEII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + VN+ +  +   +  I  S   S             +S +            
Sbjct: 61  AKEG-DIVEVNALLGIVEAGADGISASSASSPSVTSTPTSAPVVASVLASS--------- 110

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A       + L       +   S                  Q    +     
Sbjct: 111 -----LGGAMSLAPSAAKLMAENNIEKNDISGSGKRGQILKGDVLDVLTQKTKTLASVSS 165

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A  +N+  +   E +    +R+TIA RL+ ++ T        + ++  ++ LR++     
Sbjct: 166 AASVNIVHE---ERVRMTKLRQTIARRLKDAQNTAAMLTTFNEVDMSTVMDLRKRYKDLF 222

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++   +++  +AV    G+V 
Sbjct: 223 EKK---HGVKLGFMGFFTKAVCHALKELPAVNAEIDGTDIVYKNYVNAGIAVGTNKGLVV 279

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ SI +I  E+ +L + A+  KL   +  GGT +I+N G+ G      ++N P
Sbjct: 280 PVVRNADQMSIAEIEKEIGRLGRLARDGKLAVADMLGGTFTITNGGVYGSLMSTPILNAP 339

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +    +I +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 340 QSGILGMHAIKERAIVVGGQIVIRPMMYLALSYDHRIVDGQEAVTFLVRVKESLEDPERL 399

Query: 422 LM 423
           ++
Sbjct: 400 VL 401


>gi|221640455|ref|YP_002526717.1| dihydrolipoamide succinyltransferase [Rhodobacter sphaeroides
           KD131]
 gi|221161236|gb|ACM02216.1| 2-oxoglutarate dehydrogenase E2 component [Rhodobacter sphaeroides
           KD131]
          Length = 510

 Score =  297 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 103/421 (24%), Positives = 183/421 (43%), Gaps = 18/421 (4%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  + +P+L  +++E  ++ W K+ GD ++  ++LCE+ETDK  +E  +   G++ EILV
Sbjct: 106 MIDVMVPALGESVSEATVSTWFKKPGDTVAQDEMLCELETDKVSVEVPAPAAGVLAEILV 165

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             GT  +A  S +  I  D   +  +P        E       +    V +  S  + +A
Sbjct: 166 TEGT-TVAAGSKLALISSDGQGVAAAPEAETPKKTEAAPAQEPAPKKDVEDAPSAKKAMA 224

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
                  A +              G      I      +                 ++  
Sbjct: 225 EAGLSPDAVQ--------------GTGRDGRIMKDDVARAVAGASQAAAPAPAPQPALPR 270

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
             +        E +    +R+TIA RL++++ T        + ++  ++ LR +     +
Sbjct: 271 QPVPADDAAREERVKMTRLRQTIARRLKEAQNTAAMLTTYNEVDMSGVMGLRNEYKDAFE 330

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                   K+      +KA   A+ +VPE N       ++   ++ + VAV  P G+V P
Sbjct: 331 KK---HGTKMGFMSFFVKACCHALKEVPEVNAEIDGTDIVYKNYVHMGVAVGTPSGLVVP 387

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R ADQ     I  ++ +L  RA+  KL   E QGG+ +ISN G+ G      ++NPPQ
Sbjct: 388 VVRDADQMGFAQIEKKIAELGLRARDGKLSMAEMQGGSFTISNGGVYGSLMSSPILNPPQ 447

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL +   +++ V +  +I +  +M   LS DHR VDG  A   L + KE +E+P  +L
Sbjct: 448 SGILGMHKIQERPVVEKGQIVIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRLL 507

Query: 423 M 423
           +
Sbjct: 508 L 508



 Score =  126 bits (316), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 30/111 (27%), Positives = 55/111 (49%), Gaps = 1/111 (0%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           MM   + +P+L  +++E  +A W K+ GD+++  ++LCE+ETDK  +E  +   G + EI
Sbjct: 1   MMGTEVRVPTLGESVSEATVATWFKKPGDRVAADEMLCELETDKVTVEVHAPVAGRLVEI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVV 111
           + P GT  +AV++ +  I        P+P  +                 V+
Sbjct: 61  VAPEGT-TVAVSALLAQIGAAEAGEDPAPEKTHAGAEAKAGAGESKMIDVM 110


>gi|207723221|ref|YP_002253620.1| dihydrolipoamide succinyltransferase (component of 2-oxoglutarate
           dehydrogenase complex) protein [Ralstonia solanacearum
           MolK2]
 gi|206588417|emb|CAQ35380.1| dihydrolipoamide succinyltransferase (component of 2-oxoglutarate
           dehydrogenase complex) protein [Ralstonia solanacearum
           MolK2]
          Length = 421

 Score =  297 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 105/423 (24%), Positives = 178/423 (42%), Gaps = 4/423 (0%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P  S ++ EG L  W K+ G+ ++  +IL E+ETDK ++E  +   G++ E+
Sbjct: 1   MAIVEVKVPQFSESVEEGTLISWKKKPGEAVAVDEILIEVETDKVVLEVPAPAAGVLAEV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           LV  G   +     +  I  +      +P  +           + ++        +    
Sbjct: 61  LVADGA-TVTSEQLLAKIDTEGKAGAAAPAAAAAAPAPAAAAPAPAAAAPAAAAATGGVA 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           + S               + +G                  K      +   +   + +  
Sbjct: 120 MPSAAKLMAEANLSAGQVAGTGRDGRITKGDVLGAVAGGAKPAAAVAAPQAARPALQQVA 179

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                 +      E +P   +R  IA RL QS+ T        + N+  ++ LR +    
Sbjct: 180 APVDFAVLGDRPEERVPMSRLRARIAERLVQSQSTNAILTTFNEVNMKPVMDLRAKFKDQ 239

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P G+V
Sbjct: 240 FEKT---HGVKLGFMSFFVKAAVHALKKYPVINASVDGNDIVYHGYFDIGIAVGSPRGLV 296

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            PI+R ADQ S+ DI  ++ +  Q+AK  KL  ++  GGT SISN G  G      +INP
Sbjct: 297 VPILRNADQMSLADIEKKIAEFGQKAKDGKLTLDDLTGGTFSISNGGTFGSMLSTPIINP 356

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + V +N ++ V  +    +S DHR +DG  A   L   KE +E+P  
Sbjct: 357 PQSAILGVHATKDRAVVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPAR 416

Query: 421 MLM 423
           +L+
Sbjct: 417 LLL 419


>gi|300691740|ref|YP_003752735.1| dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Ralstonia
           solanacearum PSI07]
 gi|299078800|emb|CBJ51460.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Ralstonia
           solanacearum PSI07]
          Length = 420

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 112/424 (26%), Positives = 189/424 (44%), Gaps = 7/424 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P  S ++ EG L  W K+ G+ ++  ++L EIETDK ++E  +   G++ E+
Sbjct: 1   MAIVDVKVPQFSESVEEGTLISWKKKPGEAVAVDEVLVEIETDKVVLEVPAPSAGVLAEV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           LV  G   +A    +  I  +      +                 ++P       +    
Sbjct: 61  LVADGA-TVASEQLLAKIDTEGKAGAAATAAVASAPAAAAPAPVAAAPASAAAAATGGVA 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           + S        E  +    ++G+G  GRI K D+   ++        +  Q+     + +
Sbjct: 120 MPSAAKLMA--EANLSAGQVAGTGRDGRITKGDVLGAVAGGAKPAPAAAPQAARPALQQV 177

Query: 181 DANI-LNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
            A +          E +P   +R  IA RL QS+ T        + N+  ++ LR +   
Sbjct: 178 AAPVDFAALGDRPEERVPMSRLRARIAERLVQSQSTNAILTTFNEVNMKPVMDLRAKFKD 237

Query: 240 TLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGI 299
             +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P G+
Sbjct: 238 QFEKT---HGVKLGFMSFFVKAAVHALKKYPVINASVDGNDIVYHGYFDIGIAVGSPRGL 294

Query: 300 VTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVIN 359
           V PI+R ADQ S+ DI  ++ +   +A+  KL  ++  GGT SISN G  G      +IN
Sbjct: 295 VVPILRNADQMSLADIEKKIAEFGVKARDGKLTLDDLTGGTFSISNGGTFGSMLSTPIIN 354

Query: 360 PPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPV 419
           PPQS IL + A + + V +N ++ V  +    +S DHR +DG  A   L   KE +E+P 
Sbjct: 355 PPQSAILGVHATKDRAVVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPA 414

Query: 420 WMLM 423
            +L+
Sbjct: 415 RLLL 418


>gi|288959420|ref|YP_003449761.1| 2-oxoglutarate dehydrogenase E2 component [Azospirillum sp. B510]
 gi|288911728|dbj|BAI73217.1| 2-oxoglutarate dehydrogenase E2 component [Azospirillum sp. B510]
          Length = 413

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 109/422 (25%), Positives = 194/422 (45%), Gaps = 11/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  +A+W+K+ G+ ++  + L E+ETDK  +E  +   G++ EI+
Sbjct: 1   MATDIKVPTLGESVSEATVARWLKKAGEAVAMDEALVELETDKVTLEVNASAAGVLAEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
            P G  N+ V + +  I         S               + +           N   
Sbjct: 61  APEGA-NVEVGALLGVIAE-----GASAGAVPAAPAPAAAPAAAAPAPAAAPAAPGNIAA 114

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           + P AR+LA E G+D S+++GSG  GRI K D+    +     K  +   +  +   +  
Sbjct: 115 SGPAARKLADEKGVDTSAIAGSGKDGRITKGDVLAAPAAAPAAKPAAPAPAPKVQWAAGT 174

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                  A++  E +    +R+ IA RL++++ +        + ++   ++LR +     
Sbjct: 175 QGDRPRAAQE--ERVRMTRLRQRIAERLKEAQNSAAMLTTFNEVDMSAAIALRAEYKDYF 232

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ ++P  N       ++   + DI VAV  P G+V 
Sbjct: 233 EKR---HKVRLGFMSFFVKAAVQALKEIPAVNAEIDGTDIVYKNYYDIGVAVGTPQGLVV 289

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD+     +   +  L ++ +  KL  +E  GGT +ISN G+ G      +INPP
Sbjct: 290 PVVRDADKLDFAGVEGTIAALGKKGRDGKLSMDELTGGTFTISNGGVYGSLMSTPIINPP 349

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +     + V    +I+V  +M   LS DHR +DG  A   L + KE IE+P  +
Sbjct: 350 QSAILGMHKTMDRAVVVGGKIEVRPMMYLALSYDHRIIDGKEAVTFLVRIKELIEDPRRL 409

Query: 422 LM 423
           L+
Sbjct: 410 LL 411


>gi|31006894|gb|AAN78229.2| dihydrolipoamide succinyltransferase [Bartonella quintana]
          Length = 409

 Score =  296 bits (758), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 95/422 (22%), Positives = 179/422 (42%), Gaps = 14/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ ++  + L E+ETDK  +E  S   G + EI+
Sbjct: 1   MTTEIRVPTLGESVTEATIGKWFKKLGEAVAVDEPLVELETDKVTVEVPSPVMGKLTEII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + VN+ +  +   +  I  S   S                     + S +   
Sbjct: 61  AKEG-DIVEVNAVLGFVESGAAGISQSFSPSAT----------SIPEAPSELEQSPSSSA 109

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A      ++  + +           + L           T  S  +   +  
Sbjct: 110 TPSGTMPPAPSAAKLMAENNIAKSDISGSGKRGQILKEDVLGALAQGTKASTSVATLTAS 169

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           ++      +   E +    +R+TIA RL+ ++ T        + ++  ++ LR++     
Sbjct: 170 SSSAAPIQEMREERVRMTKLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMDLRKRYKDLF 229

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ + P  N       ++   +++  +AV    G+V 
Sbjct: 230 EKK---HGVKLGFMGFFTKAVCHALKEFPTVNAEIDGTDIVYKNYVNAGIAVGTDKGLVV 286

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ S+ +I  E+ +L + A+  KL   + QGGT +I+N G+ G      ++N P
Sbjct: 287 PVVRDADQMSLAEIEKEISRLGRLARDGKLAVSDMQGGTFTITNGGVYGSLMSTPILNAP 346

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +    +I +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 347 QSGILGMHAIKERAMVVGGQIIICPMMYLALSYDHRIVDGQEAVTFLVRVKESLEDPERL 406

Query: 422 LM 423
           ++
Sbjct: 407 VL 408


>gi|157803731|ref|YP_001492280.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           canadensis str. McKiel]
 gi|157784994|gb|ABV73495.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           canadensis str. McKiel]
          Length = 418

 Score =  296 bits (758), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 165/422 (39%), Positives = 261/422 (61%), Gaps = 4/422 (0%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEG L++W+K EGDK++PG+++ EIETDKA ME E+VDEGI+ +I+
Sbjct: 1   MPIKILMPALSPTMTEGNLSRWLKNEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +P  ++N+ VNS I  +  +  +I        +N   +    + +   +++         
Sbjct: 61  IPQNSQNVPVNSLIAVLSEEGEDIDDINGFIAKNSSVLPSLKADADANLLKSTEDIAVQY 120

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           ++   +     H       S        +++     +                    S  
Sbjct: 121 SNVEEQVAVTNHNKSKIFASPLAKRLAKIQNIRLESVKGSGPHGRIIKQDILSYT-PSTV 179

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            N + +   + Y ++P++NIRK IA R+ +SKQ +PHFY+SI+CN+D LL +RE +N++ 
Sbjct: 180 PNKIVIRNPEEYHLVPNNNIRKIIAKRVLESKQAVPHFYLSIECNVDKLLEIREDINKSF 239

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
               E+ S +ISVND I+ A A A+ +VP AN SW  +A+  + ++DI+VAV+I  G+VT
Sbjct: 240 ---SEDNSTRISVNDFIILAIAKALQEVPNANASWGKDAIRYYNNVDIAVAVAIENGLVT 296

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI++ ADQK+I+++S E+K+L ++AK  KL PEE+QGG  +ISN+GM GI +F A+INPP
Sbjct: 297 PIVKNADQKNIIELSHEMKELIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPP 356

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS I+ +G+  K+ + +N++I +ATIM+ TLSADHR +DG + ++ LA FK++IE P  M
Sbjct: 357 QSCIMGVGSSSKRAIVKNDQINIATIMDVTLSADHRVIDGVVGAEFLAAFKKFIERPALM 416

Query: 422 LM 423
           L+
Sbjct: 417 LL 418


>gi|240851385|ref|YP_002972788.1| dihydrolipoamide succinyltransferase [Bartonella grahamii as4aup]
 gi|240268508|gb|ACS52096.1| dihydrolipoamide succinyltransferase [Bartonella grahamii as4aup]
          Length = 403

 Score =  296 bits (758), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 90/422 (21%), Positives = 176/422 (41%), Gaps = 21/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ ++  + L E+ETDK  +E  S   G + EI+
Sbjct: 1   MTTEIRVPTLGESVTEATIGKWFKKLGEAVAMDEPLVELETDKVTVEVPSPVAGKLSEII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + VN+ +  +      +  S   S   +     E    +             +
Sbjct: 61  AKEG-DTVEVNALLGVVEAGEAGVSQSFSPSATLVPAASSESEKPASGSTMPPSPSAAKL 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +      +   G               +K        + +                   
Sbjct: 120 MAENNVAKSDISGSGKRGQILKEDVLGGLKQSTNAPTPSSSA-----------------T 162

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           ++      +   E +    +R+TIA RL+ ++          + ++  ++ LR++     
Sbjct: 163 SSSATPVQETREERVRMTKLRQTIARRLKDAQNVAAMLTTFNEVDMSAVMDLRKRYKDLF 222

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++   ++++ +AV    G+V 
Sbjct: 223 EKKN---GVKLGFMGFFTKAVCHALKELPAVNAEIDGTDIVYKNYVNVGIAVGTDKGLVV 279

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ S+ +I  E+ +L + A+  KL   + QGGT +I+N G+ G      ++N P
Sbjct: 280 PVVRDADQMSLAEIEKEIGRLGRLARDGKLAVSDMQGGTFTITNGGVYGSLMSTPILNAP 339

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +    ++ +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 340 QSGILGMHAIKERAMVVEGQVVIRPMMYLALSYDHRIVDGQEAVTFLVRVKESLEDPERL 399

Query: 422 LM 423
           ++
Sbjct: 400 VL 401


>gi|157964245|ref|YP_001499069.1| dihydrolipoamide succinyltransferase [Rickettsia massiliae MTU5]
 gi|157844021|gb|ABV84522.1| Dihydrolipoamide acetyltransferase component [Rickettsia massiliae
           MTU5]
          Length = 401

 Score =  296 bits (758), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 106/423 (25%), Positives = 183/423 (43%), Gaps = 24/423 (5%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           MM   I +PSL  ++TE  +AKW KQEGD +   ++L EIET+K  +E  +   G I +I
Sbjct: 1   MMSVKIIVPSLGESVTEATIAKWYKQEGDSVKTDELLLEIETEKVTLEVNAPCNGTIGKI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
                + N+AV   I  I   +         ++    +   + +   PV      +    
Sbjct: 61  S-KTDSANVAVGEEIGEINEGAAANTAGTHHNESAKAQAATQPTSEKPVEKPAVANNTLA 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
            +             ++      G   +    +                     +   + 
Sbjct: 120 PSVQKLVTENKLDPNNIKGTGRDGRITKGDVLET--------------------INTTAT 159

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
            A  ++   ++  + +    +RKTIA RL+ S+ T        + ++  +++LR Q    
Sbjct: 160 SAPAISKSNEERVQRVRMSRLRKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEE 219

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +      + K+      +KA   A+  +P  N     + ++   + DI VAV    G+V
Sbjct: 220 FEKK---HAVKLGFMSFFVKATIEALKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLV 276

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            PI+R AD+    ++   +  LA++A++ KL   +  GGT SISN G+ G      +INP
Sbjct: 277 VPIVRDADKMGFAEVEKAIGILAKKAREGKLSMADLSGGTFSISNGGVYGSLLSTPIINP 336

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL +   E++ V  + +I++  +M   LS DHR +DG      L K K+ IENP  
Sbjct: 337 PQSGILGLHKTEERAVVIDGKIEIRPMMYIALSYDHRIIDGKEGVSFLVKIKQLIENPEK 396

Query: 421 MLM 423
           +L+
Sbjct: 397 LLL 399


>gi|298251911|ref|ZP_06975714.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Ktedonobacter racemifer DSM 44963]
 gi|297546503|gb|EFH80371.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Ktedonobacter racemifer DSM 44963]
          Length = 430

 Score =  296 bits (758), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 116/432 (26%), Positives = 196/432 (45%), Gaps = 14/432 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W+K+EGD +  G+ L E+ETDK  +E  +  +G+I +IL
Sbjct: 1   MSDEIRVPILGESIVDATIATWLKREGDAVHQGETLAELETDKVNVEVNAEQDGVIHKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSK-ENIVEVREEHSHSSPVVVREKHSKNRP 120
              G E + V   I  +  ++                  + E    +         +++ 
Sbjct: 61  KREG-ETVQVGEVIAFLGQEAQVSGKGSSNGAIATAPAPQSEEIKRTISQPLTAAGESQR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
             SPLARR+A EH +D+S + GS PHGR+ K D+ + +   ++    +T         + 
Sbjct: 120 PPSPLARRIAAEHNVDISQVRGSSPHGRVTKEDVMSYLEESSSQDVPATTAVAPQTTPAA 179

Query: 181 ---------DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
                            A    E +     R+TIA RL +++ T        + ++  ++
Sbjct: 180 RPQAAQPVLPPAQPAADASRREERVRMSRRRQTIAQRLVEAQHTAAMLTTFNEIDMSAVM 239

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISV 291
            +R +     +      +  +       KA   A+   P  N     N M+   + DI +
Sbjct: 240 DVRSRRKDAFKER---HNVSLGFMSFFTKAVVGALKAFPRLNAEIQGNEMVLKHYYDIGI 296

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGI 351
           AV    G+V P++R AD+KS   I  E+  LA+RA+   L   E QGGT +I+N G  G 
Sbjct: 297 AVGAEEGLVVPVVRDADRKSFAAIEREIGDLAKRARTNTLSLAELQGGTFTITNGGTFGS 356

Query: 352 NSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKF 411
                ++N PQ  IL +   E++ V  + ++ +  +M   LS DHR VDG+ A + L K 
Sbjct: 357 MLSTPILNGPQVGILGMHKIEQRPVAIDGQVVIRPMMYVALSYDHRIVDGSEAVRFLVKV 416

Query: 412 KEYIENPVWMLM 423
           KE +E+P  +L+
Sbjct: 417 KELVEDPEALLL 428


>gi|222087456|ref|YP_002545993.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Agrobacterium radiobacter K84]
 gi|221724904|gb|ACM28060.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Agrobacterium radiobacter K84]
          Length = 412

 Score =  296 bits (758), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 96/422 (22%), Positives = 170/422 (40%), Gaps = 12/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  +  W K+ GD I   + + E+ETDK  +E  S   G + EI+
Sbjct: 1   MATEIRVPTLGESVSEATVGTWFKKVGDAIKVDEPIVELETDKVTIEVPSPIAGTLSEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             AG E + + + +  I   +         +           +  +   V    S   P 
Sbjct: 61  AQAG-ETVGLGALLGQISAGNGAAAAPAQAAAPAAAPAPAAAAPVAAPAVSAPASAMPPA 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +            D    SG                +        +   +        D
Sbjct: 120 PAAAKLLAESNVSADQVDGSGKRGQVLKGDVIAAVAKAASAPAAVPAAPVAVRAPTTVED 179

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A           E +    +R+TIA RL+ ++ T        + ++  ++ LR +     
Sbjct: 180 A--------GREERVKMTRLRQTIARRLKDAQNTAAMLTTYNEVDMKAVMDLRNKYKDIF 231

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++   +  I +AV    G+V 
Sbjct: 232 EKK---HGVKLGFMGFFTKAVTHALKELPAVNAEIDGTDIVYKNYCHIGMAVGTDKGLVV 288

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR ADQ SI ++  E+ +LA+ A+   L   + QGGT +I+N G+ G      ++N P
Sbjct: 289 PVIRDADQMSIAEVEKELGRLAKAARDGTLSMADMQGGTFTITNGGVYGSLMSSPILNAP 348

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ V    ++ +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 349 QSGILGMHKIQERPVAIGGQVVIRPMMYLALSYDHRMVDGKEAVTFLVRVKESLEDPERL 408

Query: 422 LM 423
           ++
Sbjct: 409 VL 410


>gi|254509775|ref|ZP_05121842.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodobacteraceae bacterium KLH11]
 gi|221533486|gb|EEE36474.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodobacteraceae bacterium KLH11]
          Length = 431

 Score =  296 bits (758), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 187/434 (43%), Positives = 266/434 (61%), Gaps = 17/434 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+VDEG I +IL
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWLVKEGDTVSSGDLLAEIETDKATMEFEAVDEGTIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKN--- 118
           +P G+E + VN+ I  +L D            +          + +      +       
Sbjct: 61  IPEGSEGVRVNTAIAVLLEDGESADDIAATPAKAPEAAPAAAGNEAAAPAAPEAPAPAPA 120

Query: 119 --------RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
                   R  ASPLARR+A + G+DL+ ++GSGPHGRIVK+D+E+  +        +  
Sbjct: 121 APVKADGGRIFASPLARRIAAQKGLDLAQIAGSGPHGRIVKADVESATAAPAAAPAPAAA 180

Query: 171 QSFGLVDESIDANILNLFAKD-SYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
            +         A+++    +   YE I  D +RKTIA RL ++KQTIPHFY+  D  +D 
Sbjct: 181 PAPAAAPAGPSADMVARMYEGREYEEIQLDGMRKTIAARLGEAKQTIPHFYLRRDIKLDA 240

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDI 289
           LL  R Q+N+ L+        K+SVND I+KA A A+ QVPE N  W  + +++ K  D+
Sbjct: 241 LLKFRSQLNKQLEGR----GVKLSVNDFIIKAVANALQQVPECNAVWAGDRVLQLKPSDV 296

Query: 290 SVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGML 349
           +VAV+I GG+ TP+++ AD KS+  +S E+K LA RA++RKL P EYQGGT ++SN+GM 
Sbjct: 297 AVAVAIEGGLFTPVLQDADTKSLSALSSEMKDLAGRARERKLAPHEYQGGTFAVSNLGMF 356

Query: 350 GINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHRSVDGAIASKLL 408
           GI++F A++NPP + ILA+G G KK V   + E+ VAT+M+ T+S DHR +DGA+ ++LL
Sbjct: 357 GIDNFDAIVNPPHAGILAVGTGVKKPVVGDDGELTVATVMSVTMSVDHRVIDGALGAELL 416

Query: 409 AKFKEYIENPVWML 422
               E +ENP+ ML
Sbjct: 417 KAIVENLENPMVML 430


>gi|229524092|ref|ZP_04413497.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae
           bv. albensis VL426]
 gi|229337673|gb|EEO02690.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae
           bv. albensis VL426]
          Length = 404

 Score =  296 bits (758), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 96/422 (22%), Positives = 183/422 (43%), Gaps = 20/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD ++  +++ EIETDK ++E  + D G+++ IL
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKPGDMVARDEVIVEIETDKVVLEVPAPDAGVLEAIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  +   +    P+            + H  S               
Sbjct: 61  EQEGA-TVLSKQLLARLKPGAVAGEPTQDTPDATEPSPDKRHKASL-------------- 105

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A    +       +    ++  S +   I+ +      ++ ++         
Sbjct: 106 --TEESNDALSPAVRRLLAEHNLEASQVKGSGVGGRITREDIEAHLASNKAKPAAKAEAP 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
              L      S   +P   +RK IA RL ++K          + N+  ++ +R+Q     
Sbjct: 164 VAALAPVVGRSERRVPMTRLRKRIAERLLEAKNNTAMLTTFNEVNMKPIMDMRKQYQDVF 223

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+VT
Sbjct: 224 EKR---HGIRLGFMSFYVKAVTEALKRYPEVNASIDGDDLVYHNYFDVSIAVSTPRGLVT 280

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D  S+  I   +K+LA++ +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 281 PVLKNCDTLSLAQIEKGIKELAEKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINPP 340

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   + + +  + +I++  +M   LS DHRS+DG  +   L   KE +E+P  +
Sbjct: 341 QAAILGMHKIQDRAMVVDGKIEILPMMYLALSYDHRSIDGRESVGFLVTVKELLEDPARL 400

Query: 422 LM 423
           L+
Sbjct: 401 LL 402


>gi|21242285|ref|NP_641867.1| dihydrolipoamide succinyltransferase [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|21107713|gb|AAM36403.1| dihydrolipoamide S-succinyltransferase [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 403

 Score =  296 bits (757), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 110/425 (25%), Positives = 189/425 (44%), Gaps = 29/425 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++++  +A W K+ G+ +   + L ++ETDK ++E  S  +G++ EI 
Sbjct: 1   MATEVKVPVLPESVSDATIASWHKKAGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G+  +  N  +  I   +          +            ++P             
Sbjct: 61  FETGS-TVTSNQILAIIEEGAVAAAAPAEEKQAAAPAATAAAPAAAPAPAAAAAPAASKS 119

Query: 122 A----SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
           A     P AR  A   G+D S + G+G  G + K DI                       
Sbjct: 120 AADSLPPGARFSAITQGVDPSQVEGTGRRGAVTKEDIVNF-------------------- 159

Query: 178 ESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
            +    +         E +P   +RKTIA RL +SK +        + N+  + + R+++
Sbjct: 160 -AKAGGVGKASGARPEERVPMTRVRKTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKEL 218

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
               Q        K+      +KA A A+ + P  N S   + +I H + DIS+AVS   
Sbjct: 219 QDEFQKA---HGIKLGFMSFFVKAAANALQRFPLVNASIDGDDIIYHGYSDISIAVSTDK 275

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G+VTP++R  +++S  D+   +   A +A+  KL  ++ QGGT +I+N G  G      +
Sbjct: 276 GLVTPVLRNVERQSFADVEQGIADYAAKARAGKLGLDDLQGGTFTITNGGTFGSLLSTPI 335

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           INPPQS IL + A +++ + +N ++ +A +M   LS DHR +DG  + + L   K  +EN
Sbjct: 336 INPPQSAILGMHAIKERPIAENGQVVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLEN 395

Query: 418 PVWML 422
           P  ML
Sbjct: 396 PGRML 400


>gi|254436681|ref|ZP_05050175.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Octadecabacter antarcticus 307]
 gi|198252127|gb|EDY76441.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Octadecabacter antarcticus 307]
          Length = 428

 Score =  296 bits (757), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 171/431 (39%), Positives = 243/431 (56%), Gaps = 14/431 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD++  GD++ EIETDKA MEFE+VDEGII +IL
Sbjct: 1   MAIEILMPALSPTMEEGTLAKWLVKEGDEVKSGDLIAEIETDKATMEFETVDEGIIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  GTE + VN+PI  I  +  E+  +               + +         +   P 
Sbjct: 61  VAEGTEGVKVNTPICIIGEEGEEMSSASAAPAPKAEAAGVADTVAPAEAAATTSAAPAPA 120

Query: 122 ASPLARRLAGEHGIDLSS---------LSGSGPHGRIVKSDIETLISTKTNVKDYSTIQS 172
           A   +R  A      ++                   I                      S
Sbjct: 121 AKDGSRLFATPLARRIAKDKGLDLATIKGSGPHGRIIKADVENATAQPAAASAAAPLASS 180

Query: 173 FGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232
              V       ++ ++    +E I  D +RK IA RL ++KQT+PHFY+  D  +D LL 
Sbjct: 181 AVAVTGPSAQQVIKMYEGRKFEEIKLDGMRKIIASRLTEAKQTVPHFYLRRDIELDTLLK 240

Query: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVA 292
            R Q+N+TL+        K+SVND I+KA ALA+ ++PEAN  W  + +++    D++VA
Sbjct: 241 FRSQLNKTLEPR----GVKLSVNDFIIKACALALQEIPEANAVWAGDHVLQMTASDVAVA 296

Query: 293 VSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGIN 352
           V+I GG+ TP+++ A+ KS+  +S ++K LA RA++RKL P EYQGG+ +ISN+GM GI+
Sbjct: 297 VAIEGGLFTPVLQDAETKSLSALSAQMKDLASRARERKLAPHEYQGGSFAISNLGMFGID 356

Query: 353 SFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHRSVDGAIASKLLAKF 411
           +F A+INPP S ILA+GAG KK +   + EIKVATIM+ TLS DHR +DGA+ + LL   
Sbjct: 357 NFDAIINPPHSGILAVGAGAKKPIVGADGEIKVATIMSTTLSVDHRVIDGAMGANLLNAI 416

Query: 412 KEYIENPVWML 422
           K  +ENP+ ML
Sbjct: 417 KANLENPMGML 427


>gi|146276133|ref|YP_001166292.1| dihydrolipoamide acetyltransferase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554374|gb|ABP68987.1| 2-oxoglutarate dehydrogenase E2 component [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 506

 Score =  296 bits (757), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 103/421 (24%), Positives = 182/421 (43%), Gaps = 21/421 (4%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  + +P+L  +++E  ++ W K+ GD ++  ++LCE+ETDK  +E  +   G++ EILV
Sbjct: 105 MIDVMVPALGESVSEATVSTWFKKPGDTVAQDEMLCELETDKVSVEVPAPAAGVLAEILV 164

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             GT  +A  S +  I  D   +  +P      +                      R   
Sbjct: 165 TEGT-TVAAGSRLALISTDGQGVAAAPKAEAPKVDAAP-----------------ARAAK 206

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
             +    A +  +  + LS     G      I      +                 S+  
Sbjct: 207 KDVEDAPAAKKAMAEAGLSPDAVQGTGRDGRIMKDDVARAVAGASQAQAPAPAPQPSLPR 266

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
             +        E +    +R+TIA RL++++ T        + ++  +++LR +     +
Sbjct: 267 QPVPADDAAREERVKMTRLRQTIARRLKEAQNTAAMLTTYNEVDMSGVMALRNEYKDQFE 326

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                   K+      +KA   A+ +VPE N       ++   ++ + VAV  P G+V P
Sbjct: 327 KK---HGTKMGFMSFFVKACCHALKEVPEVNAEIDGTDIVYKNYVHMGVAVGTPSGLVVP 383

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R ADQ     I  ++ +L  RA+  KL   E QGG+ +ISN G+ G      ++NPPQ
Sbjct: 384 VVRDADQMGFAQIEKKIAELGARARDGKLSMAEMQGGSFTISNGGVYGSLMSSPILNPPQ 443

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL +   + + V +  +I +  +M   LS DHR VDG  A   L + KE +E+P  +L
Sbjct: 444 SGILGMHKIQDRPVVEKGQIVIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRLL 503

Query: 423 M 423
           +
Sbjct: 504 L 504



 Score =  123 bits (308), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   + +P+L  +++E  +A W K+ GD+++  ++LCE+ETDK  +E  +   G + EI+
Sbjct: 1  MGTEVRVPTLGESVSEATVATWFKKPGDRVAADEMLCELETDKVTVEVHAPVAGRLTEIV 60

Query: 62 VPAGTENIAVNSPILNILMDST 83
           P GT  +AV++ +  I     
Sbjct: 61 APEGT-TVAVSALLAQIGAAEA 81


>gi|163761404|ref|ZP_02168478.1| dihydrolipoamide acetyltransferase [Hoeflea phototrophica DFL-43]
 gi|162281399|gb|EDQ31696.1| dihydrolipoamide acetyltransferase [Hoeflea phototrophica DFL-43]
          Length = 406

 Score =  296 bits (757), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 101/422 (23%), Positives = 174/422 (41%), Gaps = 18/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P+L  +++E  +  W K+ GD +   + L E+ETDK  +E  S   G++ EIL
Sbjct: 1   MATEVRVPTLGESVSEATIGTWFKKAGDTVKVDEPLVELETDKVSIEVPSPVSGVLSEIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E + VN+ +  I         + P   E   +     +  +P           P 
Sbjct: 61  AKDG-ETVEVNALLAQIAEGEAGAAAAAPAKAEAPAKAEPAKADEAPKQAAGSDMPASPS 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A  L      + G    S          V   I                 S      +  
Sbjct: 120 AQKLMAENKIDAGNVAGSGKRGQVLKGDVLDAI--------------GKGSAPAAAPAAA 165

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
               +       E +    +R+TIA RL++++ T        + ++  ++ LR++     
Sbjct: 166 RPASSADDAPREERVKMTRLRQTIARRLKEAQNTAAMLTTYNEVDMTAVMELRKKYKDLF 225

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ +VP  N       +I   +  I VAV    G+V 
Sbjct: 226 EKK---HGVKLGFMGFFTKAVCHALKEVPGVNAEMDATDIIYKNYCHIGVAVGTDKGLVV 282

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ SI  I  E+ +L + A+  +L   + QGGT +ISN G+ G      ++N P
Sbjct: 283 PVVRDADQMSIAGIEQEIGRLGRAARDGELSMADMQGGTFTISNGGVYGSLMSSPILNSP 342

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS +L +   +++ +    ++ +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 343 QSGVLGMHKIQERPMAIGGQVVIRPMMYLALSYDHRVVDGKEAVTFLVRVKESLEDPERL 402

Query: 422 LM 423
           ++
Sbjct: 403 VL 404


>gi|209694426|ref|YP_002262354.1| dihydrolipoamide succinyltransferase [Aliivibrio salmonicida
           LFI1238]
 gi|208008377|emb|CAQ78532.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Aliivibrio salmonicida LFI1238]
          Length = 403

 Score =  296 bits (757), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 102/422 (24%), Positives = 184/422 (43%), Gaps = 21/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD +   +IL +IETDK ++E  + + G+++ I 
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKPGDTVERDEILVDIETDKVVLEVPAPEAGVLEAIF 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  I + +    P+  ++ E      + H+ S      +  S     
Sbjct: 61  EDEGA-TVLSKQLLAKIKLGAVVGEPTKDVTNETESSPDKRHTASLAEEKNDALSPAVRR 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A                   VK        T+ +V  +           ++ 
Sbjct: 120 LLGEHDIKA-----------------SDVKGTGVGGRITREDVDAHVAALKATSAKATVS 162

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                  A  S + +P   +RKT+A RL ++K +        + N+  ++ LR+Q     
Sbjct: 163 NEPAAPLAHRSQKRVPMTRLRKTVARRLLEAKNSTAMLTTFNEVNMKPIMELRKQYQEQF 222

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + +I H + DIS+AVS P G+VT
Sbjct: 223 EKR---HGTRLGFMSFYVKAVTEALKRYPEVNASIDGDDIIYHNYFDISMAVSTPRGLVT 279

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D     DI   +K+LA + +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 280 PVLKDCDALGFADIEKGIKELAIKGRDGKLAVEDLIGGNFTITNGGVFGSLMSTPIINPP 339

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   + + +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 340 QAAILGMHKIQDRPMAVNGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARL 399

Query: 422 LM 423
           L+
Sbjct: 400 LL 401


>gi|258621147|ref|ZP_05716181.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio mimicus VM573]
 gi|258626222|ref|ZP_05721070.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio mimicus VM603]
 gi|262170924|ref|ZP_06038602.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio mimicus
           MB-451]
 gi|258581577|gb|EEW06478.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio mimicus VM603]
 gi|258586535|gb|EEW11250.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio mimicus VM573]
 gi|261892000|gb|EEY37986.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio mimicus
           MB-451]
          Length = 404

 Score =  296 bits (756), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 94/422 (22%), Positives = 185/422 (43%), Gaps = 20/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD ++  +++ EIETDK ++E  + + G+++ IL
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKPGDSVARDEVIVEIETDKVVLEVPAPEAGVLEAIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  + + +    P+            + H  S               
Sbjct: 61  EEEGA-TVLSKQLLARLKLGAVAGEPTQDTPDATEPSPDKRHKASL-------------- 105

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A    +       +    ++  S +   I+ +      +  ++         
Sbjct: 106 --TEESNDALSPAVRRLLAEHNLEAHQVKGSGVGGRITREDIEAHLAANKAKPAAKAEAP 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
              +   A  + + +P   +RK IA RL ++K +        + N+  ++ +R+Q     
Sbjct: 164 VAAIAPVAGRTEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVNMKPIMDMRKQYQDVF 223

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S     ++ H + D+S+AVS P G+VT
Sbjct: 224 EKR---HGIRLGFMSFYVKAVTEALKRYPEVNASIDGEDLVYHNYFDVSIAVSTPRGLVT 280

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D  S+  I   +K+LA++ +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 281 PVLKNCDTLSLAQIEKGIKELAEKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINPP 340

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   + + +  + +I++  +M   LS DHRS+DG  +   L   KE +E+P  +
Sbjct: 341 QAAILGMHKIQDRAMVVDGKIEILPMMYLALSYDHRSIDGRESVGFLVTVKELLEDPARL 400

Query: 422 LM 423
           L+
Sbjct: 401 LL 402


>gi|46202384|ref|ZP_00053285.2| COG0508: Pyruvate/2-oxoglutarate dehydrogenase complex,
           dihydrolipoamide acyltransferase (E2) component, and
           related enzymes [Magnetospirillum magnetotacticum MS-1]
          Length = 415

 Score =  296 bits (756), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 192/421 (45%), Positives = 268/421 (63%), Gaps = 11/421 (2%)

Query: 8   MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTE 67
           MP+LSPTMTEG LAKW+K EGD +  GDILCEIETDKA MEFE+VDEG++ +ILV  GT 
Sbjct: 1   MPALSPTMTEGNLAKWLKNEGDAVKSGDILCEIETDKATMEFEAVDEGVLGKILVAGGTS 60

Query: 68  NIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP-----IA 122
            +AVN+PI  +L +  +            V      + +                   +A
Sbjct: 61  GVAVNTPIAVLLEEGEDASAISAAPAPKAVAAPASVAAAPIAAAPAAAPAAAHGGDRVVA 120

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
           SPLA+R+A +  +DL ++ GSGPHGRIVK+D+E  I         +T  +     +   A
Sbjct: 121 SPLAKRIAKDGNVDLKAVKGSGPHGRIVKADVEAAIKAGPAKPAAATPAAAAAAPKPAPA 180

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
                  + ++E IP+ ++RK IA RL ++K TIPHFY+SIDC +D+LL +R  +N    
Sbjct: 181 PASASPFEPAFEEIPNSSMRKVIARRLTEAKSTIPHFYLSIDCELDSLLKVRADLNGRSD 240

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
            +      K+SVND +++A ALA+ +VP AN SW  +A+ R+K +DISVAV+ P G++TP
Sbjct: 241 AY------KLSVNDFVVRAVALALKKVPAANASWGEDAIKRYKDVDISVAVATPSGLITP 294

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           I+  AD K + +IS E+K LA +A+  KLKPEE+QGG  +ISN+GM GI  F A+INPPQ
Sbjct: 295 IVHHADHKGLAEISNEMKALAGKARDNKLKPEEFQGGGFTISNLGMFGIKDFAAIINPPQ 354

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
             ILA+GAGE++ V +   + VAT+M  TLS DHR VDGA+ ++ LA FK+ IE+P+ ML
Sbjct: 355 GCILAVGAGEQRPVVKAGALAVATVMTCTLSVDHRVVDGAVGAEFLAAFKKLIEDPLSML 414

Query: 423 M 423
           +
Sbjct: 415 L 415


>gi|329113473|ref|ZP_08242254.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Acetobacter pomorum DM001]
 gi|326697298|gb|EGE48958.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Acetobacter pomorum DM001]
          Length = 415

 Score =  296 bits (756), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 172/422 (40%), Positives = 243/422 (57%), Gaps = 7/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEGKLA+W+K+EGD ++ GD+L EIETDKA ME E+++EGI+  IL
Sbjct: 1   MATEILMPALSPTMTEGKLARWLKKEGDAVNSGDVLAEIETDKATMEVEAIEEGILGRIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  G E +AVN+PI  ++ +   +P +               S  +              
Sbjct: 61  VQEGAEGVAVNTPIAILVEEGEAVPDNIDTPNNVASAAPATASQPAAASAPIATQAAPAQ 120

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +           +              +K                  +++         
Sbjct: 121 RADKPVGRVVASPLARRIARQKNIDLAALKGTGP------NGRIVKRDVEAALNKAPDAG 174

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                  A      +PH  +RK IA RL +SK TIPHFYVSID  +D LL+LR Q+N   
Sbjct: 175 QVASAPTASGGSRAVPHTTMRKVIARRLSESKSTIPHFYVSIDVELDALLALRSQLNAMS 234

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
                + + K+SVND+++KA A+A+ QVPE N S+T +AMI H+  DISVAVS+  G++T
Sbjct: 235 PAEGAD-AFKLSVNDMLIKASAVALKQVPEVNASYTEDAMILHEDADISVAVSLDDGLIT 293

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI++QAD+KS+ DIS E K L  RA+  KLKPEE+QGGT SISNMGM G+  F A++NPP
Sbjct: 294 PIVKQADRKSLKDISQEAKDLISRARAGKLKPEEFQGGTFSISNMGMYGVKDFAAIVNPP 353

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ ILAI AG+K+ V +  E+ +AT+M  TLS DHR VDGA A++ L+ F+  +E+P+ +
Sbjct: 354 QAAILAIAAGKKQAVVKGNELAIATVMTVTLSVDHRVVDGAAAARWLSAFRAAVESPLSL 413

Query: 422 LM 423
           ++
Sbjct: 414 VL 415


>gi|229522043|ref|ZP_04411460.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae TM
           11079-80]
 gi|229340968|gb|EEO05973.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae TM
           11079-80]
          Length = 404

 Score =  296 bits (756), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 96/422 (22%), Positives = 183/422 (43%), Gaps = 20/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD ++  +++ EIETDK ++E  + D G+++ IL
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKPGDMVARDEVIVEIETDKVVLEVPAPDAGVLEAIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  +   +    P+            + H  S               
Sbjct: 61  EQEGA-TVLSKQLLARLKPGAVAGEPTQDTPDATEPSPDKRHKASL-------------- 105

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A    +       +    ++  S +   I+ +      +  ++         
Sbjct: 106 --TEESNDALSPAVRRLLAEHNLEASQVKGSGVGGRITREDIEAHLAANKAKPAAKAEAP 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
              L      S + +P   +RK IA RL ++K          + N+  ++ +R+Q     
Sbjct: 164 VAALAPVVGRSEKRVPMTRLRKRIAERLLEAKNNTAMLTTFNEVNMKPIMDMRKQYQDVF 223

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+VT
Sbjct: 224 EKR---HGIRLGFMSFYVKAVTEALKRYPEVNASIDGDDLVYHNYFDVSIAVSTPRGLVT 280

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D  S+  I   +K+LA++ +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 281 PVLQNCDTLSLAQIEKGIKELAEKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINPP 340

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   + + +  + +I++  +M   LS DHRS+DG  +   L   KE +E+P  +
Sbjct: 341 QAAILGMHKIQDRAMVVDGKIEILPMMYLALSYDHRSIDGRESVGFLVTVKELLEDPARL 400

Query: 422 LM 423
           L+
Sbjct: 401 LL 402


>gi|260428116|ref|ZP_05782095.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Citreicella sp. SE45]
 gi|260422608|gb|EEX15859.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Citreicella sp. SE45]
          Length = 440

 Score =  296 bits (756), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 165/443 (37%), Positives = 236/443 (53%), Gaps = 26/443 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +S GDIL EIETDKA MEFE+VDEG I +IL
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWLVKEGDTVSSGDILAEIETDKATMEFEAVDEGTIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +  G+E + VN+PI  +L +          S       +     +               
Sbjct: 61  ISEGSEGVKVNTPIAVLLEEGESASDISATSSSAPEAPKASEPAAEAAPAGGSEKAAPAA 120

Query: 122 ASPLARRLAGEHGIDL---------------------SSLSGSGPHGRIVKSDIETLIST 160
           A    +   G+                                        +      + 
Sbjct: 121 APAAPQGADGKRIFATPLARRIAADKGLDLAAIKGSGPHGRIVKADVEGASAAPTAKPAA 180

Query: 161 KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
                  +   +  +        ++ ++    YE +  D +RKT+A RL ++KQTIPHFY
Sbjct: 181 AAAEAPAAKPAAAAMSAGPGAEQVMKMYEGRDYEEVKLDGMRKTVAARLTEAKQTIPHFY 240

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           +  D  +D LL  R Q+N+ L+        K+SVND I+KA ALA+  VP+AN  W  + 
Sbjct: 241 LRRDIKLDALLKFRSQLNKQLEGR----GVKLSVNDFIIKACALALQSVPDANAVWAGDR 296

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           M++ K  D++VAV++ GG+ TP+++ A+ KS+  +S E+K LA RA+ RKL P EY GG+
Sbjct: 297 MLKLKPSDVAVAVAVDGGLFTPVLKDAEMKSLSALSAEMKDLAGRARNRKLAPHEYVGGS 356

Query: 341 TSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHRSV 399
            +ISN+GM GI++F AVINPP   ILA+GAG KK V   + E+ VAT+M+ TLS DHR +
Sbjct: 357 FAISNLGMFGIDNFDAVINPPHGAILAVGAGVKKPVVGADGELTVATVMSVTLSVDHRVI 416

Query: 400 DGAIASKLLAKFKEYIENPVWML 422
           DGA+ ++LL    E +ENP+ ML
Sbjct: 417 DGALGAELLQAIVENLENPMVML 439


>gi|209965548|ref|YP_002298463.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Rhodospirillum centenum SW]
 gi|209959014|gb|ACI99650.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Rhodospirillum centenum SW]
          Length = 410

 Score =  296 bits (756), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 98/422 (23%), Positives = 181/422 (42%), Gaps = 14/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  +A+W+K+ GD +   + L E+ETDK  +E  +   G + +I 
Sbjct: 1   MATEIKVPTLGESVTEATVARWMKKVGDTVEADEPLVELETDKVTLEVNAPAGGTLTDIQ 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   + V + +  I   + +   +P  +             ++   V     K    
Sbjct: 61  AEDGA-TVGVGALLGVIADGAAKPAAAPAAAPAQAAPQPAAAPAAAAAGVMPAARKMADD 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
               A ++A                       I+ L   +          +         
Sbjct: 120 HGVDAGKIA----------GTGKDGRVTKGDVIQHLEQPRPAAAPAPAPTAPAAPAAKPA 169

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A        D  E +    +R+ IA RL++++ T        + ++ N++++R ++    
Sbjct: 170 APSGPRPRADLEERVRMTRLRQRIAERLKEAQDTAAMLTTFNEVDMTNVIAMRARLKDAF 229

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+      +KA  +A+ ++P  N     + ++   + DI VAV  P G+V 
Sbjct: 230 EKK---HGVKLGFMSFFVKACIVALKEIPAVNAEIDGSDLVYKNYYDIGVAVGTPQGLVV 286

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD+     +  ++ +L ++A+  KL  E+  GGT +ISN G+ G      ++NPP
Sbjct: 287 PVVRDADRLGFAGVEAKIAELGKKARDGKLSIEDLSGGTFTISNGGVYGSLMSTPILNPP 346

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +     + V  + +++V  +M   LS DHR +DG  A   L + KE IENP  +
Sbjct: 347 QSGILGMHKTMDRAVVVDGKVEVRPMMYLALSYDHRIIDGREAVTFLVRVKECIENPERI 406

Query: 422 LM 423
           L+
Sbjct: 407 LL 408


>gi|153801986|ref|ZP_01956572.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae MZO-3]
 gi|153828924|ref|ZP_01981591.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae 623-39]
 gi|124122500|gb|EAY41243.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae MZO-3]
 gi|148875630|gb|EDL73765.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae 623-39]
          Length = 404

 Score =  296 bits (756), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 96/422 (22%), Positives = 183/422 (43%), Gaps = 20/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD ++  +++ EIETDK ++E  + D G+++ IL
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKPGDMVARDEVIVEIETDKVVLEVPAPDAGVLEAIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  +   +    P+            + H  S               
Sbjct: 61  EQEGA-TVLSKQLLARLKPGAVAGEPTQDTPDATEPSPDKRHKASL-------------- 105

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A    +       +    ++  S +   I+ +      +  ++         
Sbjct: 106 --TEESNDALSPAVRRLLAEHNLEANQVKGSGVGGRITREDIEAHLAANKAKPAAKAEAP 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
              L      S + +P   +RK IA RL ++K          + N+  ++ +R+Q     
Sbjct: 164 VAALAPVVGRSEKRVPMTRLRKRIAERLLEAKNNTAMLTTFNEVNMKPIMDMRKQYQDVF 223

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+VT
Sbjct: 224 EKR---HGIRLGFMSFYVKAVTEALKRYPEVNASIDGDDLVYHNYFDVSIAVSTPRGLVT 280

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D  S+  I   +K+LA++ +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 281 PVLKNCDTLSLAQIEKGIKELAEKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINPP 340

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   + + +  + +I++  +M   LS DHRS+DG  +   L   KE +E+P  +
Sbjct: 341 QAAILGMHKIQDRAMVVDGKIEILPMMYLALSYDHRSIDGRESVGFLVTVKELLEDPARL 400

Query: 422 LM 423
           L+
Sbjct: 401 LL 402


>gi|15642086|ref|NP_231718.1| dihydrolipoamide succinyltransferase [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121586902|ref|ZP_01676682.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae 2740-80]
 gi|121727380|ref|ZP_01680519.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae V52]
 gi|147675118|ref|YP_001217611.1| dihydrolipoamide succinyltransferase [Vibrio cholerae O395]
 gi|153818382|ref|ZP_01971049.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae NCTC 8457]
 gi|153821675|ref|ZP_01974342.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae B33]
 gi|227082212|ref|YP_002810763.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae M66-2]
 gi|229507825|ref|ZP_04397330.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae BX
           330286]
 gi|229511938|ref|ZP_04401417.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae
           B33]
 gi|229519074|ref|ZP_04408517.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae
           RC9]
 gi|229607370|ref|YP_002878018.1| dihydrolipoamide succinyltransferase [Vibrio cholerae MJ-1236]
 gi|254849172|ref|ZP_05238522.1| dihydrolipoamide acetyltransferase [Vibrio cholerae MO10]
 gi|255745171|ref|ZP_05419120.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholera
           CIRS 101]
 gi|262155971|ref|ZP_06029092.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae
           INDRE 91/1]
 gi|262167705|ref|ZP_06035408.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae
           RC27]
 gi|298497888|ref|ZP_07007695.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Vibrio cholerae MAK 757]
 gi|9656634|gb|AAF95232.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121548838|gb|EAX58881.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae 2740-80]
 gi|121630272|gb|EAX62670.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae V52]
 gi|126511072|gb|EAZ73666.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae NCTC 8457]
 gi|126520773|gb|EAZ77996.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae B33]
 gi|146317001|gb|ABQ21540.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae O395]
 gi|227010100|gb|ACP06312.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae M66-2]
 gi|227013983|gb|ACP10193.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae O395]
 gi|229343763|gb|EEO08738.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae
           RC9]
 gi|229351903|gb|EEO16844.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae
           B33]
 gi|229355330|gb|EEO20251.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae BX
           330286]
 gi|229370025|gb|ACQ60448.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae
           MJ-1236]
 gi|254844877|gb|EET23291.1| dihydrolipoamide acetyltransferase [Vibrio cholerae MO10]
 gi|255737001|gb|EET92397.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholera
           CIRS 101]
 gi|262023910|gb|EEY42608.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae
           RC27]
 gi|262030282|gb|EEY48925.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae
           INDRE 91/1]
 gi|297542221|gb|EFH78271.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Vibrio cholerae MAK 757]
          Length = 404

 Score =  296 bits (756), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 96/422 (22%), Positives = 183/422 (43%), Gaps = 20/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD ++  +++ EIETDK ++E  + D G+++ IL
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKPGDMVARDEVIVEIETDKVVLEVPAPDAGVLEAIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  +   +    P+            + H  S               
Sbjct: 61  EQEGA-TVLSKQLLARLKPGAVAGEPTQDTPDATEPSPDKRHKASL-------------- 105

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A    +       +    ++  S +   I+ +      +  ++         
Sbjct: 106 --TEESNDALSPAVRRLLAEHNLEANQVKGSGVGGRITREDIEAHLAANKAKPAAKAEAP 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
              L      S + +P   +RK IA RL ++K          + N+  ++ +R+Q     
Sbjct: 164 IAALAPVVGRSEKRVPMTRLRKRIAERLLEAKNNTAMLTTFNEVNMKPIMDMRKQYQDVF 223

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+VT
Sbjct: 224 EKR---HGIRLGFMSFYVKAVTEALKRYPEVNASIDGDDLVYHNYFDVSIAVSTPRGLVT 280

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D  S+  I   +K+LA++ +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 281 PVLKNCDTLSLAQIEKGIKELAEKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINPP 340

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   + + +  + +I++  +M   LS DHRS+DG  +   L   KE +E+P  +
Sbjct: 341 QAAILGMHKIQDRAMVVDGKIEILPMMYLALSYDHRSIDGRESVGFLVTVKELLEDPARL 400

Query: 422 LM 423
           L+
Sbjct: 401 LL 402


>gi|146328208|emb|CAM58124.1| 2-oxoglutarate dehydrogenase [uncultured marine microorganism]
          Length = 397

 Score =  296 bits (756), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 87/422 (20%), Positives = 168/422 (39%), Gaps = 27/422 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++T+  L  W K+ G+ +   D L ++ETDK ++E  +   G + EI 
Sbjct: 1   MTIEIKVPQLPESVTDATLVGWHKKVGESVRRDDNLVDLETDKVVLEVPAPASGTLIEIK 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  GT  +     +  +   +         ++          +         +      +
Sbjct: 61  VSDGT-TVTSGELLALLDESAAPAAVERQQAEAPAPTAGTAEAAQKLSPAVRRLLDEHDL 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +        +  +  S +                                         
Sbjct: 120 DATSVSGSGKDGRLTKSDVMAYLKSHSDEDVTPG-----------------------DPA 156

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
             +    A  + + +P   +R  IA R+ +++          + ++  ++SLR++   + 
Sbjct: 157 PALPAAGASRTEQRVPMTRLRARIAARMVEAQHAAAMLTTFNEVDLTKVMSLRKRYKESF 216

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++       KA   A+ + P  N S   N +I H + DI +AVS   G++ 
Sbjct: 217 EKE---HGVRLGFMSFFAKAAVEALKKYPAVNASVEGNVIIYHDYFDIGIAVSSDRGLMV 273

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D  S   I  +V +L ++A+   +  E+  GGT +I+N G+ G      ++NPP
Sbjct: 274 PVLRNVDHLSFAQIESDVAELGKKARDGTMSLEDLTGGTFTITNGGVFGSMLSTPILNPP 333

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +  + EI V  +M   L+ DHR +DG  A + L   K  +E+P  +
Sbjct: 334 QSAILGMHAIQQRPMVVDGEIVVRPMMYLALTYDHRIIDGKEAVQFLVNLKNSLEDPGRL 393

Query: 422 LM 423
           L+
Sbjct: 394 LL 395


>gi|307825480|ref|ZP_07655698.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Methylobacter tundripaludum SV96]
 gi|307733366|gb|EFO04225.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Methylobacter tundripaludum SV96]
          Length = 422

 Score =  296 bits (756), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 98/424 (23%), Positives = 173/424 (40%), Gaps = 6/424 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P+L  ++++  L  W KQ GD +   + L ++ETDK ++E  + + GI+ +IL
Sbjct: 1   MSIEVLVPNLPESVSDATLITWHKQPGDTVIKNENLVDLETDKVVLEVPAPESGILGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK--NR 119
              G+  +     +  +   + E       +     +  E     SP V R       + 
Sbjct: 61  KEDGSIVVG-GEVLALLEPQAVEEGQKTAATAPEPEDEDESDIPLSPSVRRLIAENALDP 119

Query: 120 PIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDES 179
            I     +         L  L         +           +         +       
Sbjct: 120 SIIKGSGKDGRLTKTDVLDYLHKKTLQEAQLIVPTAKAEIPLSPPLTKEETATAISHPAP 179

Query: 180 IDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
            +     +      + +P   +R  +A RL Q++Q         + N+ N++ LR Q   
Sbjct: 180 KEETGRVISNLRPEQRVPMTRLRAKVAERLLQAQQNAAMLTTFNEVNMQNVIDLRNQYKE 239

Query: 240 TLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGI 299
             +        K+      +KA   A+ + P  N S   N +I H + DI +AVS   G+
Sbjct: 240 RFEKKHH---VKLGFMSFFVKASIEALKRFPAINASIDDNDIIYHGYYDIGIAVSTERGL 296

Query: 300 VTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVIN 359
           + P++R ADQ     I   +     + +   L  ++ +GGT +I+N G+ G      ++N
Sbjct: 297 IVPVLRDADQLDFAGIEQSIVDFGAKTRSGTLTYDDLKGGTFTITNGGIFGSMLSTPILN 356

Query: 360 PPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPV 419
           PPQ  IL + A +++ V +N +I +  IM   LS DHR VDG  A + L   KE +E P 
Sbjct: 357 PPQCAILGMHAIKERPVVENGQIVIRPIMYLALSYDHRLVDGREAVQFLVTIKECLEAPA 416

Query: 420 WMLM 423
            +L+
Sbjct: 417 HLLL 420


>gi|114707322|ref|ZP_01440219.1| dihydrolipoamide acetyltransferase [Fulvimarina pelagi HTCC2506]
 gi|114537203|gb|EAU40330.1| dihydrolipoamide acetyltransferase [Fulvimarina pelagi HTCC2506]
          Length = 545

 Score =  295 bits (755), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 97/420 (23%), Positives = 176/420 (41%), Gaps = 6/420 (1%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
             + +PS   ++TE  +    K+ GD +S  + L E+ETDKA  E  S   G+I E+ V 
Sbjct: 130 TDVNVPSAGESVTEATVGTIFKKVGDHVSMDEALLELETDKAAQEVPSPVAGVIRELAVS 189

Query: 64  AGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIAS 123
            G E + V + ++ I   ++        S   +     +             +++   A+
Sbjct: 190 EGDE-VQVGALLMKIEEGASAGEKGSDGSGGAVANRAPK--ADEHGADGPAAARSEEQAA 246

Query: 124 PLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDAN 183
              R  A      +   + S    +    D + L              S      +    
Sbjct: 247 EGKRPPAPSARKLMEERNLSADQVQGSGRDGQILKGDVLEAVSRGAPSSTQEKPAAPKRA 306

Query: 184 ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQF 243
             +       E +    +R+TIA RL+ ++ T        + ++   + +R++     + 
Sbjct: 307 EPSKDDAPREERVKMTRLRQTIAKRLKSAQDTAAMLTTFNEVDMTATMEMRKKYKELFEK 366

Query: 244 HREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPI 303
                  K+       KA   A+ ++P  N       ++      + +AV    G+V P+
Sbjct: 367 K---HGIKLGFMGFFTKAVCHALKEIPAVNAEIDGGDIVYKNFCHVGMAVGTDKGLVVPV 423

Query: 304 IRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQS 363
           IR ADQ +I +I  E+ +LA+ A+  KL   + QGGT +I+N G+ G      ++N PQS
Sbjct: 424 IRDADQMTIAEIEKELGRLAKAARDGKLGVSDMQGGTFTITNGGVYGSLMSTPILNAPQS 483

Query: 364 TILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            IL +   +++ +    E+K+  +M   LS DHR VDG  A   L + KE +E+P  +++
Sbjct: 484 GILGMHKIQERPMAVGGEVKIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLIL 543



 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 45/95 (47%), Gaps = 1/95 (1%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   I +P+L  +++E  +  W KQ GD++   + L E+ETDK  +E  +   G++ EI+
Sbjct: 1  MSTEIKVPTLGESVSEATIGTWFKQVGDRVEQDEALAELETDKVTVEVPAPAAGVLQEIV 60

Query: 62 VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENI 96
             G + + V + I  I         S   + E  
Sbjct: 61 ANQG-DTVGVGALIGMIGEGEGAGKGSSDDATEQP 94


>gi|171317101|ref|ZP_02906304.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia ambifaria MEX-5]
 gi|171097735|gb|EDT42562.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia ambifaria MEX-5]
          Length = 421

 Score =  295 bits (755), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 109/423 (25%), Positives = 185/423 (43%), Gaps = 4/423 (0%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL E+ETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G + +  +  I  I  ++             +       +      V    +   P
Sbjct: 61  LQNDG-DTVVADQIIATIDTEAKAGAAEAAAGAAEVKPAAAAPAAQPAAAVASSSAAASP 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
            AS L        G    S            +      +        +      L +  +
Sbjct: 120 AASKLLAEKGLSAGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKTAAAKPALPEVKV 179

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
            A+          + +P   +R  IA RL +S+QT        + N+  ++ LR +    
Sbjct: 180 PASAATWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNKYKDK 239

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P G+V
Sbjct: 240 FEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV 296

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G      +INP
Sbjct: 297 VPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP 356

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A +++ V +N +I +  I    LS DHR +DG  A   L   K+ +E+P  
Sbjct: 357 PQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPAR 416

Query: 421 MLM 423
           +L+
Sbjct: 417 LLL 419


>gi|153213693|ref|ZP_01948945.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae 1587]
 gi|229513741|ref|ZP_04403203.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae
           TMA 21]
 gi|229528898|ref|ZP_04418288.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae
           12129(1)]
 gi|254226089|ref|ZP_04919687.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae V51]
 gi|254286797|ref|ZP_04961750.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae AM-19226]
 gi|297579590|ref|ZP_06941518.1| 2-oxoglutarate dehydrogenase [Vibrio cholerae RC385]
 gi|124115754|gb|EAY34574.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae 1587]
 gi|125621401|gb|EAZ49737.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae V51]
 gi|150423088|gb|EDN15036.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae AM-19226]
 gi|229332672|gb|EEN98158.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae
           12129(1)]
 gi|229348922|gb|EEO13879.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae
           TMA 21]
 gi|297537184|gb|EFH76017.1| 2-oxoglutarate dehydrogenase [Vibrio cholerae RC385]
 gi|327484618|gb|AEA79025.1| Dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio cholerae
           LMA3894-4]
          Length = 404

 Score =  295 bits (755), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 96/422 (22%), Positives = 183/422 (43%), Gaps = 20/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD ++  +++ EIETDK ++E  + D G+++ IL
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKPGDMVARDEVIVEIETDKVVLEVPAPDAGVLEAIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  +   +    P+            + H  S               
Sbjct: 61  EQEGA-TVLSKQLLARLKPGAVAGEPTQDTPDATEPSPDKRHKASL-------------- 105

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A    +       +    ++  S +   I+ +      +  ++         
Sbjct: 106 --TEESNDALSPAVRRLLAEHNLEASQVKGSGVGGRITREDIEAHLAANKAKPAAKAEAP 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
              L      S + +P   +RK IA RL ++K          + N+  ++ +R+Q     
Sbjct: 164 VAALAPVVGRSEKRVPMTRLRKRIAERLLEAKNNTAMLTTFNEVNMKPIMDMRKQYQDVF 223

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+VT
Sbjct: 224 EKR---HGIRLGFMSFYVKAVTEALKRYPEVNASIDGDDLVYHNYFDVSIAVSTPRGLVT 280

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D  S+  I   +K+LA++ +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 281 PVLKNCDTLSLAQIEKGIKELAEKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINPP 340

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   + + +  + +I++  +M   LS DHRS+DG  +   L   KE +E+P  +
Sbjct: 341 QAAILGMHKIQDRAMVVDGKIEILPMMYLALSYDHRSIDGRESVGFLVTVKELLEDPARL 400

Query: 422 LM 423
           L+
Sbjct: 401 LL 402


>gi|126734824|ref|ZP_01750570.1| dihydrolipoamide succinyltransferase [Roseobacter sp. CCS2]
 gi|126715379|gb|EBA12244.1| dihydrolipoamide succinyltransferase [Roseobacter sp. CCS2]
          Length = 397

 Score =  295 bits (755), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 102/422 (24%), Positives = 179/422 (42%), Gaps = 27/422 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P+L  ++TE  +A W KQ GD ++  ++LCE+ETDK  +E  S   G + EI+
Sbjct: 1   MSTEVRVPTLGESVTEATVATWFKQPGDSVAVDEMLCELETDKVTVEVPSPIAGTLSEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E + V++ +  I        P+    +    + +   +    V       K    
Sbjct: 61  AAEG-ETVGVDALLAQIAEGDAAPAPAKKSEEAPKADEQPADTAEKDVEDAPSAKKLM-- 117

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                                +    + V+   +     K +V +  +  +         
Sbjct: 118 ---------------------AENDLKDVEGTGKDGRVMKEDVLNALSSAAPAPSSAPAP 156

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
              +     +  E +    +R+TIA RL+ S+ T        + ++  +++LR +     
Sbjct: 157 RAPVAADQAEREERVKMTRLRQTIAKRLKDSQNTAAMLTTYNEVDMTEVMALRTEYKDLF 216

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
                    K+       KA   A+ +VPE N       ++   ++++ +A   P G+V 
Sbjct: 217 LKK---HGVKLGFMSFFTKACVHALNEVPEVNAEIDGTDVVYKNYVNMGIAAGTPTGLVV 273

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+I  ADQ S   I   + ++  +A+  KL   E QGGT +ISN G+ G      ++NPP
Sbjct: 274 PVINDADQMSFATIEKSIAEMGAKARDGKLSMAEMQGGTFTISNGGVYGSLMSSPILNPP 333

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   + + +  N E+ +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 334 QSGILGMHKIQDRPMAINGEVVIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRL 393

Query: 422 LM 423
           LM
Sbjct: 394 LM 395


>gi|294625476|ref|ZP_06704106.1| dihydrolipoamide acetyltransferase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292600243|gb|EFF44350.1| dihydrolipoamide acetyltransferase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 404

 Score =  295 bits (755), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 105/421 (24%), Positives = 182/421 (43%), Gaps = 20/421 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++++  +A W K+ G+ +   + L ++ETDK ++E  S  +G++ EI 
Sbjct: 1   MATEVKVPVLPESVSDATIASWHKKAGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G+  +  N  +  I                    V                +   P 
Sbjct: 61  FDTGS-TVTSNQILAIIE----------------EGAVAAAAPAEEKQAAAPAATAAAPA 103

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A+P     A       S+     P  R          S          +    +V+ +  
Sbjct: 104 AAPAPAAAAAPAAASKSAADSLPPGARFSAITQGVDPSQVEGTGRRGAVTKEDIVNFAKA 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
             +         E +P   +RKTIA RL +SK +        + N+  + + R+++    
Sbjct: 164 GGVGKASGARPEERVPMTRVRKTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKELQDEF 223

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           Q        K+      +KA A A+ + P  N S   + +I H + DIS+AVS   G+VT
Sbjct: 224 QKA---HGIKLGFMSFFVKAAANALQRFPLVNASIDGDDIIYHGYSDISIAVSTDKGLVT 280

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  +++S  D+   +   A +A+  KL  ++ QGGT +I+N G  G      +INPP
Sbjct: 281 PVLRNVERQSFADVEQGIADYAAKARAGKLGLDDLQGGTFTITNGGTFGSLLSTPIINPP 340

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ + +N ++ +A +M   LS DHR +DG  + + L   K  +ENP  M
Sbjct: 341 QSAILGMHAIKERPIAENGQVVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRM 400

Query: 422 L 422
           L
Sbjct: 401 L 401


>gi|258512107|ref|YP_003185541.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257478833|gb|ACV59152.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 417

 Score =  295 bits (755), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 104/422 (24%), Positives = 183/422 (43%), Gaps = 7/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +PSL  ++ E  + +W+K+EGD +  G+ + E+ETDK  +E  +   G++ +IL
Sbjct: 1   MA-EVKVPSLGESIVEATIGQWLKREGDAVESGEAIAELETDKVNVEVIAEASGVLAQIL 59

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + +A+   I  I        P+   +     +  +  + S+P    +  S     
Sbjct: 60  KQVG-DTVAIGDVIAVIAEGQAPSAPASASAPAAQAQEVKPSAPSAPQAQAQAPSAPSAP 118

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                ++++    + +               D+  + +    +                 
Sbjct: 119 QVSAQQQVSVPGELLVRPTPSLRRAAAAQGIDLRQVQAGALGLGAQPAAPQAAPAPAVQP 178

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A+   L   +  E I     R TIA RL +++ T        + ++  ++ +R++     
Sbjct: 179 ASQAALRPDE--ERIRMSRRRATIAKRLVEAQHTAAMLTTFNEVDMSRVIEIRKRRK--- 233

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
              RE+    +       KA   A+ Q P  N       MI   H DI +AV+  GG+V 
Sbjct: 234 DAFREKYGVGLGYMSFFTKAVVGALKQFPLLNAEIQGEDMIVKHHYDIGIAVATEGGLVV 293

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD+ +  +I  ++  LA RA+  KL  EE QGGT +I+N G  G      ++N P
Sbjct: 294 PVVRNADRLTFAEIEQQIADLAARARANKLSLEELQGGTFTITNGGTFGSLFSTPILNAP 353

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q  IL +    ++ V  N ++++  +M   LS DHR VDGA A   L   K  IE+P  +
Sbjct: 354 QVGILGMHNIVERPVAVNGQVEIRPMMYIALSYDHRIVDGAEAVSFLVTVKRLIEDPESL 413

Query: 422 LM 423
           L+
Sbjct: 414 LL 415


>gi|108805326|ref|YP_645263.1| 2-oxoglutarate dehydrogenase E2 component [Rubrobacter xylanophilus
           DSM 9941]
 gi|108766569|gb|ABG05451.1| 2-oxoglutarate dehydrogenase E2 component [Rubrobacter xylanophilus
           DSM 9941]
          Length = 417

 Score =  295 bits (755), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 123/422 (29%), Positives = 208/422 (49%), Gaps = 7/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++T+  + +W+K+EG+ +  G+ + E+ETDK   E E+  +G+++ I 
Sbjct: 1   MPVEIRVPELGESVTDATVGRWLKKEGEAVKSGEPIVEVETDKINFEIEAEQDGVLESIA 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E + V   I  I     +   +    +E   E REE   +     RE+ ++    
Sbjct: 61  KGEG-ETVGVGDVIGTIAE--GDGRAAAAAEEEEEPEEREEAPAAEAPAGREEAAEEGFR 117

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           ASP  RRLA E+G+DL+ +SG+G  GRI + D+E LI  ++                +  
Sbjct: 118 ASPSVRRLAQEYGVDLAEVSGTGSGGRITREDVERLIRERSRPPAAPEEDGRREERPAPP 177

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                   +   E +     R+TIA RL +S++         + ++  ++ LR +   + 
Sbjct: 178 PERA-PGREALEERVRFSRRRQTIAQRLVESQRNAAMLTTFNEVDMSAVMDLRRRRKESF 236

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           Q        ++       KA   A+   P+ N     N ++  K+ DI VAVS   G+V 
Sbjct: 237 QERT---GARLGFMSFFTKASVAALKAFPQVNAELAGNELVLKKYYDIGVAVSTDEGLVV 293

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD+KS  +I  E+  LA RA++ +L  E+ +GGT +I+N G+ G      ++  P
Sbjct: 294 PVVRDADRKSFAEIEKEIADLAVRAREGRLTLEDLRGGTFTITNGGVFGSLLSTPILTLP 353

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q  IL +   +++ V  + EI+V  +M   LS DHR +DGA A   L + KE +E+P  +
Sbjct: 354 QVAILGMHKVQERPVVVDGEIQVRPMMYVALSYDHRVIDGAEAVSFLVRIKELVEDPETL 413

Query: 422 LM 423
           L+
Sbjct: 414 LL 415


>gi|157826726|ref|YP_001495790.1| dihydrolipoamide succinyltransferase [Rickettsia bellii OSU 85-389]
 gi|157802030|gb|ABV78753.1| dihydrolipoamide acetyltransferase [Rickettsia bellii OSU 85-389]
          Length = 400

 Score =  295 bits (755), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 110/422 (26%), Positives = 182/422 (43%), Gaps = 24/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +PSL  ++TE  +AKW K+EGD +   ++L EIET+K  +E  S   G I +I+
Sbjct: 1   MGVKIIVPSLGESVTEATIAKWYKKEGDAVKTDELLLEIETEKVTLEVNSPCNGTIGKII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G  N+AV   I +I         S   +K                            
Sbjct: 61  KADGA-NVAVGEEIGDINEGEAVATNSNEAAKPQTASQPVP------------------- 100

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              +  + A  +     S+       ++  ++I+         K             +  
Sbjct: 101 -EKVPEKPAVANNTLAPSVQKLVTENKLDPNNIKGTGKDGRITKGDVLETMNAPTPAATS 159

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                  +++  E +    +RKTIA RL+ S+ T        + ++  +++LR +     
Sbjct: 160 TTSSAKASEERVERVRMSRLRKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRGKYKDEF 219

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+      ++A   A+  +P  N     + ++   + DI VAV    G+V 
Sbjct: 220 EKK---HGVKLGFMSFFVRATIEALKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVV 276

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD+    DI   +  LA++A+  KL   +  GGT SISN G+ G      +INPP
Sbjct: 277 PVVRDADKMGFADIEKTIGGLAKKARDGKLSMADLSGGTFSISNGGVYGSLLSTPIINPP 336

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   E++VV  + +I++  +M   LS DHR +DG  A   L K KE IE+P  +
Sbjct: 337 QSGILGLHKTEERVVAIDGKIEIRPMMYIALSYDHRIIDGKEAVSFLVKIKELIESPEKL 396

Query: 422 LM 423
           L+
Sbjct: 397 LL 398


>gi|91205913|ref|YP_538268.1| dihydrolipoamide acetyltransferase [Rickettsia bellii RML369-C]
 gi|122425344|sp|Q1RHI5|ODO2_RICBR RecName: Full=Dihydrolipoyllysine-residue succinyltransferase
           component of 2-oxoglutarate dehydrogenase complex;
           AltName: Full=2-oxoglutarate dehydrogenase complex
           component E2; Short=OGDC-E2; AltName:
           Full=Dihydrolipoamide succinyltransferase component of
           2-oxoglutarate dehydrogenase complex
 gi|91069457|gb|ABE05179.1| Dihydrolipoamide acetyltransferase component [Rickettsia bellii
           RML369-C]
          Length = 400

 Score =  295 bits (755), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 110/422 (26%), Positives = 183/422 (43%), Gaps = 24/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +PSL  ++TE  +AKW K+EGD +   ++L EIET+K  +E  S   G I +I+
Sbjct: 1   MGVKIIVPSLGESVTEATIAKWYKKEGDAVKTDELLLEIETEKVTLEVNSPCNGTIGKII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G  N+AV   I +I         S   +K                            
Sbjct: 61  KADGA-NVAVGEEIGDINEGEAVATNSNEAAKPQTASQPVP------------------- 100

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              + ++ A  +     S+       ++  ++I+         K             +  
Sbjct: 101 -EKVPKKPAVANNTLAPSVQKLVTENKLDPNNIKGTGKDGRITKGDVLETMNAPTPAATS 159

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                  +++  E +    +RKTIA RL+ S+ T        + ++  +++LR +     
Sbjct: 160 TTSSAKASEERVERVRMSRLRKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRGKYKDEF 219

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+      ++A   A+  +P  N     + ++   + DI VAV    G+V 
Sbjct: 220 EKK---HGVKLGFMSFFVRATIEALKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVV 276

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD+    DI   +  LA++A+  KL   +  GGT SISN G+ G      +INPP
Sbjct: 277 PVVRDADKMGFADIEKTIGGLAKKARDGKLSMADLSGGTFSISNGGVYGSLLSTPIINPP 336

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   E++VV  + +I++  +M   LS DHR +DG  A   L K KE IE+P  +
Sbjct: 337 QSGILGLHKTEERVVAIDGKIEIRPMMYIALSYDHRIIDGKEAVSFLVKIKELIESPEKL 396

Query: 422 LM 423
           L+
Sbjct: 397 LL 398


>gi|78047133|ref|YP_363308.1| dihydrolipoamide succinyltransferase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78035563|emb|CAJ23212.1| dihydrolipoamide S-succinyltransferase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 404

 Score =  295 bits (755), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 105/421 (24%), Positives = 182/421 (43%), Gaps = 20/421 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++++  +A W K+ G+ +   + L ++ETDK ++E  S  +G++ EI 
Sbjct: 1   MATEVKVPVLPESVSDATIASWHKKAGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G+  +  N  +  I                    V                +   P 
Sbjct: 61  FDTGS-TVTSNQILAIIE----------------EGAVAAAAPAEEKKADAPAPAAAAPA 103

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A+P     A       S+     P  R          S          +    +V+ +  
Sbjct: 104 AAPAPAAAAAPAAASKSAADALPPGARFSAITQGVDPSQVEGTGRRGAVTKEDIVNFAKA 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
             +         E +P   +RKTIA RL +SK +        + N+  + + R+++    
Sbjct: 164 GGVGKASGARPEERVPMTRVRKTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKELQDEF 223

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           Q        K+      +KA A A+ + P  N S   + +I H + DIS+AVS   G+VT
Sbjct: 224 QKA---HGIKLGFMSFFVKAAANALQRFPLVNASIDGDDIIYHGYSDISIAVSTDKGLVT 280

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  +++S  D+   +   A +A+  KL  ++ QGGT +I+N G  G      +INPP
Sbjct: 281 PVLRNVERQSFADVEQGIADYAAKARAGKLGLDDLQGGTFTITNGGTFGSLLSTPIINPP 340

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ + +N ++ +A +M   LS DHR +DG  + + L   K  +ENP  M
Sbjct: 341 QSAILGMHAIKERPIAENGQVVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRM 400

Query: 422 L 422
           L
Sbjct: 401 L 401


>gi|297183586|gb|ADI19713.1| hypothetical protein [uncultured bacterium EB000_36F02]
          Length = 438

 Score =  295 bits (755), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 106/440 (24%), Positives = 182/440 (41%), Gaps = 22/440 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++TE  +AKW+K +GD I   + + E+ETDK  +E  S   GI+ EI 
Sbjct: 1   MSEKILVPVLGESITEATVAKWLKNKGDSIKIDEAIVELETDKVNLEVPSAVNGILTEIN 60

Query: 62  VPAGTENIAVNSPILNI-LMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
              G + + V S + +I   +S        + K+    +    +       +  + ++  
Sbjct: 61  AKDG-DVVKVGSVLGSINETESVAKEIKKIIPKKQENNIVNLDADKKKQSPKIFNEEDNS 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDES- 179
             S             L   +           +I+   S                V  S 
Sbjct: 120 TDSNEELLTLTNEAEPLILTNEIKKEKDSSVKNIKEKFSPAVRKMVAENDIDIEKVQGSG 179

Query: 180 ----------------IDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
                                         E I    +R+TIA RL+Q+++         
Sbjct: 180 KDGRILKGDLIDIMGVSPKPSERKIKYGQEERIKMTRLRQTIAKRLKQAQENAAMLTTFN 239

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           + ++ N++ +R++     Q        K+      +KA  + +   P  N     N +I 
Sbjct: 240 EVDMTNIIEMRKENQEDFQKR---YGIKLGFMSFFVKACVVGLKNFPAINAEIENNEIIY 296

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
             + +IS AVS   G+V P++R AD+ S  DI   +  ++++A+  KL  E+ QGGT +I
Sbjct: 297 KNYYNISFAVSTEKGLVVPVLRNADELSFADIEKNIISVSEKARNGKLTIEDLQGGTFTI 356

Query: 344 SNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAI 403
           SN G+ G      ++NPPQS +L +    ++ V  + +IK+ +IM   LS DHR +DG  
Sbjct: 357 SNGGVYGSMLSTPILNPPQSGVLGMHNIIERPVVIDSQIKIRSIMYLALSYDHRIIDGKD 416

Query: 404 ASKLLAKFKEYIENPVWMLM 423
           A   L   KE +E+P  + +
Sbjct: 417 AVSFLKNVKENLEDPRRLFL 436


>gi|153826062|ref|ZP_01978729.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae MZO-2]
 gi|149740179|gb|EDM54332.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio cholerae MZO-2]
          Length = 404

 Score =  295 bits (755), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 96/422 (22%), Positives = 183/422 (43%), Gaps = 20/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD ++  +++ EIETDK ++E  + D G+++ IL
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKPGDMVARDEVIVEIETDKVVLEVPAPDAGVLEAIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  +   +    P+            + H  S               
Sbjct: 61  EQEGA-TVLSKQLLARLKPGAVAGEPTQDTPDATEPSPDKRHKASL-------------- 105

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A    +       +    ++  S +   I+ +      +  ++         
Sbjct: 106 --TEESNDALSPAVRRLLAEHNLEANQVKGSGVGGRITREDIEAHLAANKAKPAAKVEAP 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
              L      S + +P   +RK IA RL ++K          + N+  ++ +R+Q     
Sbjct: 164 VAALAPVVGRSEKRVPMTRLRKRIAERLLEAKNNTAMLTTFNEVNMKPIMDMRKQYQDVF 223

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+VT
Sbjct: 224 EKR---HGIRLGFMSFYVKAVTEALKRYPEVNASIDGDDLVYHNYFDVSIAVSTPRGLVT 280

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D  S+  I   +K+LA++ +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 281 PVLKNCDTLSLAQIEKGIKELAEKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINPP 340

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   + + +  + +I++  +M   LS DHRS+DG  +   L   KE +E+P  +
Sbjct: 341 QAAILGMHKIQDRAMVVDGKIEILPMMYLALSYDHRSIDGRESVGFLVTVKELLEDPARL 400

Query: 422 LM 423
           L+
Sbjct: 401 LL 402


>gi|194366404|ref|YP_002029014.1| dihydrolipoamide succinyltransferase [Stenotrophomonas maltophilia
           R551-3]
 gi|194349208|gb|ACF52331.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Stenotrophomonas maltophilia
           R551-3]
          Length = 400

 Score =  295 bits (755), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 112/422 (26%), Positives = 189/422 (44%), Gaps = 26/422 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   +  P L  ++ +G +A W K+ GD +   + L ++ETDK ++E  S  +G+I EI 
Sbjct: 1   MATEVKAPVLPESVADGTIATWHKKVGDAVKRDENLLDLETDKVVLEVPSPVDGVIKEIK 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +  +  +  I   +    P+P              +  +        +K+   
Sbjct: 61  FAEGA-TVTSSQVVAIIEEGAVAAAPAPAAEAAPAAAAAPAAAAPAAAAAPAPAAKSAAD 119

Query: 122 A-SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           A  P AR  A   G++ + + G+G  G + K DI                        + 
Sbjct: 120 ALPPGARFTAITEGVNPADVDGTGRRGAVTKEDIVNF---------------------AR 158

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
           +            E +P   IRK IA RL +SK +        + ++  + + R+++   
Sbjct: 159 NGGAGKAGGARPEERVPMTRIRKRIAERLMESKNSTAMLTTFNEVDLSKVSAARKELQDE 218

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
                     K+      +KA A A+ + P  N S   + +I H + DIS+AVS   G+V
Sbjct: 219 FVKA---HGIKLGFMSFFVKAAANALQRFPLVNASIDGDDIIYHGYSDISIAVSTEKGLV 275

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  ++ S  DI   +   A++A+  KL  EE QGGT +++N G  G      +INP
Sbjct: 276 TPVLRNVERMSFADIERTIADYAKKARDGKLSLEELQGGTFTVTNGGTFGSLLSTPIINP 335

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A +++ + QN ++ +A +M   +S DHR +DG  + + L   K  +ENP  
Sbjct: 336 PQSAILGMHAIKERPIAQNGQVVIAPMMYLAMSYDHRIIDGKDSVQFLVDIKNQLENPGR 395

Query: 421 ML 422
           ML
Sbjct: 396 ML 397


>gi|163869361|ref|YP_001610617.1| dihydrolipoamide succinyltransferase [Bartonella tribocorum CIP
           105476]
 gi|161019064|emb|CAK02622.1| dihydrolipoamide succinyltransferase [Bartonella tribocorum CIP
           105476]
          Length = 403

 Score =  295 bits (755), Expect = 9e-78,   Method: Composition-based stats.
 Identities = 92/422 (21%), Positives = 180/422 (42%), Gaps = 21/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ ++  + L E+ETDK  +E  S   G + EI+
Sbjct: 1   MTTEIRVPTLGESVTEATVGKWFKKLGEAVAMDEPLVELETDKVTVEVPSPVAGKLSEII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + VN+ +  +      +  S   S   +     E    +             +
Sbjct: 61  AKEG-DTVEVNALLGAVEAGEAGVSQSFSPSATPVPAASSESEKLASSSTMPPSPSAAKL 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +      +   G         G     ++  I                        S+ 
Sbjct: 120 MAENNVAKSDIAGSGKRGQILKGDVLGGLEQRIN-----------------TPTPSSSVM 162

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           ++ +   ++   E +    +R+TIA RL+ ++          + ++  ++ LR++     
Sbjct: 163 SSSVTPVSETREERVRMTKLRQTIARRLKDAQNVAAMLTTFNEVDMSAVMDLRKRYKDLF 222

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ ++P  N       ++   ++++ +AV    G+V 
Sbjct: 223 EKK---HGVKLGFMGFFTKAVCHALKELPAVNAEIDGTDIVYKNYVNVGIAVGTDKGLVV 279

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ S+ +I  E+ +L + A+  KL   + QGGT +I+N G+ G      ++N P
Sbjct: 280 PVVRDADQMSLAEIEKEIGRLGRLARDGKLAVSDMQGGTFTITNGGVYGSLMSTPILNAP 339

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +    ++ +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 340 QSGILGMHAIKERAMVVEGQVVIRPMMYLALSYDHRIVDGQEAVTFLVRVKESLEDPERL 399

Query: 422 LM 423
           ++
Sbjct: 400 VL 401


>gi|162147212|ref|YP_001601673.1| 2-oxoglutarate dehydrogenase E2 component [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161785789|emb|CAP55360.1| 2-oxoglutarate dehydrogenase E2 component [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 476

 Score =  295 bits (755), Expect = 9e-78,   Method: Composition-based stats.
 Identities = 97/425 (22%), Positives = 180/425 (42%), Gaps = 6/425 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++T   +AKW+K+ G+ ++  + + E+ETDK  +E  + + G++   L
Sbjct: 53  MSAEIKVPTLGESVTTATIAKWLKKPGEAVTADEPVVELETDKVSVEVAAPEAGVMGPQL 112

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  G E + V + + ++   S         +           + +               
Sbjct: 113 VAEGDE-VEVGTVLASVEAGSGAAAKPAAAAPAPKKAAEAPKAPAGVQAQPTTSGPVARP 171

Query: 122 ASPLARRLAG---EHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDE 178
           A+P +   A       +  +    +       +  I T    +    D     S   V +
Sbjct: 172 ATPPSDVAAQGAAHAPMPSAQKMMTEKGVTTAEIGIGTGKDGRVTKGDVLAFLSQPPVAK 231

Query: 179 SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMN 238
           +  A           E +    +R+TIA RL+ ++ T        + ++    ++R +  
Sbjct: 232 AAAAPAAPRTDDPREERVKMTRLRRTIARRLKDAQNTAALLTTFNEVDMSAAKAMRAEYR 291

Query: 239 RTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGG 298
              +        K+    I  KA   A+ + P  N     + +I  + I++ +AV  P G
Sbjct: 292 DLFEKKN--GGVKLGFMSIFAKAAIAALKEFPAINAEIDGDDVIYREFINLGIAVGGPNG 349

Query: 299 IVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVI 358
           +V P+IR AD+ +   I   +    +RA+   LK +E  GGT SI+N G+ G      ++
Sbjct: 350 LVVPVIRDADKLNFAGIESAIAGFGKRARDGSLKLDELSGGTFSITNGGIYGSLMSTPIV 409

Query: 359 NPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENP 418
           N PQS IL + A + + V  N ++ +  +M   L+ DHR VDG  A   L + K+ +E+P
Sbjct: 410 NAPQSGILGMHAIQDRPVAVNGQVVIRPMMYIALTYDHRIVDGKEAVSFLVRVKQNVEDP 469

Query: 419 VWMLM 423
             +L+
Sbjct: 470 RRLLL 474


>gi|241662795|ref|YP_002981155.1| dihydrolipoamide succinyltransferase [Ralstonia pickettii 12D]
 gi|309782283|ref|ZP_07677010.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Ralstonia sp. 5_7_47FAA]
 gi|240864822|gb|ACS62483.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Ralstonia pickettii 12D]
 gi|308918901|gb|EFP64571.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Ralstonia sp. 5_7_47FAA]
          Length = 417

 Score =  295 bits (755), Expect = 9e-78,   Method: Composition-based stats.
 Identities = 106/423 (25%), Positives = 179/423 (42%), Gaps = 8/423 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P  S ++ EG L  W K+ G+ ++  +IL E+ETDK ++E  +   G++ E+
Sbjct: 1   MAIVEVKVPQFSESVEEGTLISWKKKPGEAVAQDEILIEVETDKVVLEVPAPSAGVLAEV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           LV  G   +     +  I  +      +P  +    V      + ++P            
Sbjct: 61  LVADGA-TVTSEQLLAKIDTEGKAGAAAPAAAAPAPVAAAPAPAAAAPAAAAAGGVAM-- 117

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                A+ +A  +                    +  +          +   +   + +  
Sbjct: 118 --PSAAKLMAENNLSAGQVAGTGRDGRITKGDVLGAVAGGAKPAAAAAPQAARPALQQVA 175

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                        E +P   +R  IA RL QS+ T        + N+  ++ LR +    
Sbjct: 176 APVDFAALGDRPEERVPMSRLRARIAERLVQSQSTNAILTTFNEVNMKPVMDLRAKFKDQ 235

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P G+V
Sbjct: 236 FEKT---HGVKLGFMSFFVKAAVHALKKYPIINASVDGNDIVYHGYFDIGIAVGSPRGLV 292

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            PI+R ADQ S+ DI  ++ +  Q+AK  KL  ++  GGT SISN G  G      +INP
Sbjct: 293 VPILRNADQMSLADIEKKIAEFGQKAKDGKLTLDDLTGGTFSISNGGTFGSMLSTPIINP 352

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + V +N ++ V  +    +S DHR +DG  A   L   KE +E+P  
Sbjct: 353 PQSAILGVHATKDRAVVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPAR 412

Query: 421 MLM 423
           +L+
Sbjct: 413 LLL 415


>gi|188992181|ref|YP_001904191.1| dihydrolipoamide succinyltransferase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167733941|emb|CAP52147.1| dihydrolipoamide S-succinyltransferase [Xanthomonas campestris pv.
           campestris]
          Length = 402

 Score =  295 bits (754), Expect = 9e-78,   Method: Composition-based stats.
 Identities = 107/424 (25%), Positives = 189/424 (44%), Gaps = 28/424 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++++  +A W K+ G+ +   + L ++ETDK ++E  S  +G++ EI 
Sbjct: 1   MATEVKVPVLPESVSDATIASWHKKAGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             AG+  +  N  +  I   +          K +        + +           ++  
Sbjct: 61  FEAGS-TVTSNQILAIIEEGAVAAAAPAEEKKADATAAAAAAAPAPAAAAAAAPVASKSS 119

Query: 122 ASPLAR---RLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDE 178
           A  L       A   G+D S + G+G  G + K DI                        
Sbjct: 120 ADSLPPGARFSAITQGVDPSQVDGTGRRGAVTKEDIVNF--------------------- 158

Query: 179 SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMN 238
           +    +         E +    +RKTIA RL +SK +        + N+  + + R+++ 
Sbjct: 159 AKAGGVGKASGARPEERVAMTRVRKTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKELQ 218

Query: 239 RTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGG 298
              Q        K+      +KA A A+ + P  N S   + +I H + DIS+AVS   G
Sbjct: 219 DEFQKA---HGIKLGFMSFFVKAAANALQRFPLVNASIDGDDIIYHGYSDISIAVSTEKG 275

Query: 299 IVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVI 358
           +VTP++R  +++S  ++   +   A +A+  KL  ++ QGGT +I+N G  G      +I
Sbjct: 276 LVTPVLRNVERQSFAEVEQGIADYAAKARAGKLGLDDLQGGTFTITNGGTFGSLLSTPII 335

Query: 359 NPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENP 418
           NPPQS IL + A +++ + +N ++ +A +M   LS DHR +DG  + + L   K  +ENP
Sbjct: 336 NPPQSAILGMHAIKERPIAENGQVVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENP 395

Query: 419 VWML 422
             ML
Sbjct: 396 GRML 399


>gi|21230941|ref|NP_636858.1| dihydrolipoamide succinyltransferase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66769057|ref|YP_243819.1| dihydrolipoamide succinyltransferase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21112557|gb|AAM40782.1| dihydrolipoamide S-succinyltransferase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66574389|gb|AAY49799.1| dihydrolipoamide S-succinyltransferase [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 404

 Score =  295 bits (754), Expect = 9e-78,   Method: Composition-based stats.
 Identities = 104/421 (24%), Positives = 180/421 (42%), Gaps = 20/421 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++++  +A W K+ G+ +   + L ++ETDK ++E  S  +G++ EI 
Sbjct: 1   MATEVKVPVLPESVSDATIASWHKKAGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             AG+  +  N  +  I                    V                +     
Sbjct: 61  FEAGS-TVTSNQILAIIE----------------EGAVAAAAPAEEKKADATAAAAAPAA 103

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A   A   A       SS     P  R          S          +    +V+ +  
Sbjct: 104 APAPAAAAAAAPVASKSSADSLPPGARFSAITQGVDPSQVDGTGRRGAVTKEDIVNFAKA 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
             +         E +    +RKTIA RL +SK +        + N+  + + R+++    
Sbjct: 164 GGVGKASGARPEERVAMTRVRKTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKELQDEF 223

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           Q        K+      +KA A A+ + P  N S   + +I H + DIS+AVS   G+VT
Sbjct: 224 QKA---HGIKLGFMSFFVKAAANALQRFPLVNASIDGDDIIYHGYSDISIAVSTEKGLVT 280

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  +++S  ++   +   A +A+  KL  ++ QGGT +I+N G  G      +INPP
Sbjct: 281 PVLRNVERQSFAEVEQGIADYAAKARAGKLGLDDLQGGTFTITNGGTFGSLLSTPIINPP 340

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ + +N ++ +A +M   LS DHR +DG  + + L   K  +ENP  M
Sbjct: 341 QSAILGMHAIKERPIAENGQVVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRM 400

Query: 422 L 422
           L
Sbjct: 401 L 401


>gi|83943190|ref|ZP_00955650.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Sulfitobacter sp.
           EE-36]
 gi|83846198|gb|EAP84075.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Sulfitobacter sp.
           EE-36]
          Length = 447

 Score =  295 bits (754), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 167/450 (37%), Positives = 250/450 (55%), Gaps = 33/450 (7%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+  EGD +S GDILCEIETDKA MEFE+VDEG I +IL
Sbjct: 1   MPIEILMPALSPTMEEGTLAKWLVSEGDSVSSGDILCEIETDKATMEFEAVDEGTIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +  G+E + VN+PI  +L +  E          ++ +  +E +        + + +    
Sbjct: 61  IGDGSEGVKVNTPIAVLLEEGEEASDIDSAPAPDVKDSAKEDAPDQDAAPEKGYGRGESD 120

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDI--------------------------- 154
           A+  +                  P  R + +D                            
Sbjct: 121 ANDTSTSAPAAPKSSDGKRLFVTPLARRIAADKGVDLAELSGSGPHGRIIKADVEAASAG 180

Query: 155 -ETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSK 213
                  ++     +   +           ++ ++   ++E I  + +RKTIA RL ++K
Sbjct: 181 SAKAKPAESTETASAPAATAAPAAGPSADAVMKIYEGRAFEEISLNGMRKTIAARLTEAK 240

Query: 214 QTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEAN 273
           Q+IPHFY+  D  +D LL  R ++N+ L+        K+SVND I+KA ALA+  V +AN
Sbjct: 241 QSIPHFYLRRDIELDALLKFRGELNKQLEAR----DVKLSVNDFIIKACALALQTVSDAN 296

Query: 274 VSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKP 333
             W  + +++ K  D++VAV+I GG+ TP+++ A+ KS+  +S E+K LA RA+ RKL P
Sbjct: 297 AVWAGDRILKLKPSDVAVAVAIEGGLFTPVLKDAEMKSLSTLSAEMKDLATRARDRKLAP 356

Query: 334 EEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATL 392
            EYQGG+ +ISN+GM GI++F AVINPP   ILA+GAG KK V  ++ E+ VAT+M+ TL
Sbjct: 357 HEYQGGSFAISNLGMFGIDNFDAVINPPHGAILAVGAGVKKPVVGKDGELAVATVMSVTL 416

Query: 393 SADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S DHR +DGA+ ++LL+  K+ +ENP+ ML
Sbjct: 417 SVDHRVIDGALGAQLLSAIKDNLENPMMML 446


>gi|296282620|ref|ZP_06860618.1| dihydrolipoamide succinyl transferase [Citromicrobium bathyomarinum
           JL354]
          Length = 414

 Score =  295 bits (754), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 108/422 (25%), Positives = 175/422 (41%), Gaps = 10/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   IT+P L  ++TEG +A+W+KQ GD ++  + +  +ETDK  ++  S   G+I+E+ 
Sbjct: 1   MATEITVPQLGESVTEGTIAEWLKQPGDAVAVDEPIASLETDKVAVDVPSPVAGVIEELR 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G +N+ V + I  +   +            +      +               N   
Sbjct: 61  AEVG-DNVEVGAVIATVKEGAEASSGKSSAPAPSPAPASTKDDAGQ------AAYGNHDE 113

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +  A +             G  P           L          +          +  
Sbjct: 114 GTGDAGQTLSPAVRRAVLEYGVDPSSIKGSGKDGRLTKEDVIAAAKNKGDDGAASAPAPS 173

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A       +   E +    +R+TIA RL+ ++          D ++  ++  RE+     
Sbjct: 174 APATAASGECREERVKMTRMRQTIAKRLKGAQDNAALLTTFNDVDMSAVIETREKYKDLF 233

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
                    K+       KA  LA+  VP AN     + ++ H  +DISVAVS P G+V 
Sbjct: 234 AKK---HDIKLGFMGFFAKAACLALKDVPAANAYIEGDEIVYHDFVDISVAVSAPNGLVV 290

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR AD+K    I  ++     RAK   L  ++ +GGT +ISN G+ G      +INPP
Sbjct: 291 PVIRDADKKGFAQIEKDIADFGARAKDGTLTMDDMKGGTFTISNGGVFGSLMSTPIINPP 350

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS +L +   E + V  N ++++  +M   LS DHR +DG  A   L   KE IE+P  M
Sbjct: 351 QSAVLGLHRIEDRPVAINGKVEIRPMMYIALSYDHRLIDGREAVTALKIMKEAIEDPTRM 410

Query: 422 LM 423
           L+
Sbjct: 411 LI 412


>gi|56963878|ref|YP_175609.1| dihydrolipoamide succinyltransferase [Bacillus clausii KSM-K16]
 gi|56910121|dbj|BAD64648.1| 2-oxoglutarate dehydrogenase E2 component [Bacillus clausii
           KSM-K16]
          Length = 420

 Score =  295 bits (754), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 100/422 (23%), Positives = 170/422 (40%), Gaps = 5/422 (1%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I +P L  ++TEG +++W+K+ GD +  G+ + E+ETDK   E      G+I E   
Sbjct: 1   MTEIKVPELGESITEGTISQWLKEVGDYVEQGEFIAELETDKVNAEIPVDTAGVIKEFKR 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G + + +   I  I    +    S            +E +        +     +  A
Sbjct: 61  EPG-DTVEIGEVIAIIDESGSAGGSSATSESTKEEATAKEEAPQEEKQAEQTQQPEKEEA 119

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
               R LA      L+   G              +             Q+     +   A
Sbjct: 120 VSNNRPLASPAARKLAREKGISLDAITPTDPTGKIRRQDIEAHQAKPKQTEAPKAQPSSA 179

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
            +    A    E       R+TIA RL   +          + ++  +++LR +      
Sbjct: 180 PVSEGEAGKPVERQKMSRRRQTIAKRLVDVQHETAMLTTFNEVDMSAVMNLRSRRK---D 236

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
              E+   K+       KA   A+ + P  N     + ++  K  DI +AVS   G+V P
Sbjct: 237 AFSEKHGVKLGFMSFFTKAVVGALKEFPLLNAEIQGDELLIKKFYDIGIAVSTDSGLVVP 296

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R AD+ S   I   + +L ++A+  KL+  + QGGT +I+N G+ G      ++N PQ
Sbjct: 297 VLRDADRLSFAGIEKGIGELGKKARDNKLQLADMQGGTFTITNGGVFGSLWSTPILNAPQ 356

Query: 363 STILAIGAGEKKVVFQNEE-IKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
             IL +   + + V  + E  +   +M   LS DHR VDG  A   L K K+ IE+P  +
Sbjct: 357 VGILGMHKIQMRPVAIDNERFENRPMMYLALSYDHRIVDGKEAVSFLVKIKQLIEDPEQL 416

Query: 422 LM 423
           L+
Sbjct: 417 LL 418


>gi|239947715|ref|ZP_04699468.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921991|gb|EER22015.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 412

 Score =  295 bits (754), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 173/422 (40%), Positives = 257/422 (60%), Gaps = 10/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMT G LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I+
Sbjct: 1   MPIKILMPALSPTMTGGNLARWLKKEGDKVNPGEVIVEIETDKATMEVEAVDEGILAKIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +P  ++N+ VNS I  +  +  E         +N          S          K    
Sbjct: 61  IPQNSQNVPVNSLIAVLSEEGEEKTDIDAFIAKNNSV-------SPLPKTDTNLPKPHEN 113

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            + +  + A          +           +I       +        Q       S  
Sbjct: 114 IANVEEQGAVIKHDTSKIFTSPLAKRLAKMGNIRLESVKGSGPHGRIVKQDILSYTSSTV 173

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            N +     + Y ++P++NIRK IA RL +SKQT+PHFY+SI+CN+D LL +RE +N++ 
Sbjct: 174 HNKIVSRNPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKSF 233

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
               E+ S KISVND I+ A A A+ +VP AN SW  +A+  + ++DISVAV+I  G+VT
Sbjct: 234 ---SEDKSTKISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISVAVAIENGLVT 290

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI++ A+QK+I+++S E+K+L ++AK  KL PEE+QGG  +ISN+GM GI +F A+INPP
Sbjct: 291 PIVKNANQKNIIELSREMKELIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPP 350

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS I+ +G+  K+ + +N++I +ATIM+ TLSADHR VDGA  ++ LA FK++IE+P  M
Sbjct: 351 QSCIMGVGSSSKRAIVKNDQITIATIMDVTLSADHRVVDGAAGAEFLAAFKKFIESPALM 410

Query: 422 LM 423
           L+
Sbjct: 411 LI 412


>gi|254447437|ref|ZP_05060903.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [gamma proteobacterium HTCC5015]
 gi|198262780|gb|EDY87059.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [gamma proteobacterium HTCC5015]
          Length = 431

 Score =  295 bits (754), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 110/433 (25%), Positives = 197/433 (45%), Gaps = 19/433 (4%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P L  ++ E  +A W KQ GD +   + L +IETDK I+E  +  +G++ +IL   G
Sbjct: 1   MKVPQLPESVAEATIAAWHKQPGDAVKRDENLVDIETDKVILEVPAPSDGVLGDILEEVG 60

Query: 66  TENIAVNSPILNILMDST-------------EIPPSPPLSKENIVEVREEHSHSSPVVVR 112
              +  +  +  +                  +         +      +    S+     
Sbjct: 61  A-TVTADQVLAKLEEGEAPAAKEEKASGTKKDAKEETKSDAKADKAESKASQASAQSAEA 119

Query: 113 EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQS 172
            +  K  P  SP  R+L  +H +D+  + G+G +GRI+K D+   I ++   +  +    
Sbjct: 120 PREEKAAPGLSPAVRKLVEQHQLDVDDIQGTGKNGRILKEDVMNYIESRPAHQSAAMASQ 179

Query: 173 FGLVDESIDANILNLFAKD--SYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNL 230
               D+S   +   L  +     + +P   +R+ IA RL  ++QT        + N+  +
Sbjct: 180 MSDEDKSNVLSPTKLTTEGDRPEKRVPMSRLRQRIAERLVDAQQTAAILTTFNEINMQPV 239

Query: 231 LSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDIS 290
           + LR +     +        ++      +KA   A+ + PE N S     ++ H + D+ 
Sbjct: 240 MDLRSKYKEHFES---VHGVRLGFMSFFVKAAVEALKRFPEINASIDGEDIVYHGYQDVG 296

Query: 291 VAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLG 350
           VAVS P G++ P++R A+  S+ DI   + Q  Q+A    +   + QGGT +I+N G+ G
Sbjct: 297 VAVSSPRGLLVPVLRNAEHMSMADIEKSISQYGQQAHDGTIDLNDLQGGTFTITNGGVFG 356

Query: 351 INSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAK 410
                 ++NPPQS IL +   +++ V +N EI +  +M   LS DHR VDG  A + L  
Sbjct: 357 SMMSTPILNPPQSAILGMHKTQERPVVENGEIVIRPMMYLALSYDHRIVDGKEAVQFLVT 416

Query: 411 FKEYIENPVWMLM 423
            KE +E P  +++
Sbjct: 417 IKELLEEPARIML 429


>gi|103487708|ref|YP_617269.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Sphingopyxis alaskensis RB2256]
 gi|98977785|gb|ABF53936.1| 2-oxoglutarate dehydrogenase E2 component [Sphingopyxis alaskensis
           RB2256]
          Length = 404

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 98/422 (23%), Positives = 177/422 (41%), Gaps = 20/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P+L  ++TE  + +W+K+ G+ ++  + +  +ETDK  +E  S   G++ + L
Sbjct: 1   MSTEVKVPTLGESVTEATIGEWLKKPGEAVALDEPIASLETDKVAVEVPSPVAGVMGQQL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + I  +        P+P  ++            +   +           
Sbjct: 61  AAVG-DTVNVGAVIATVEAGDAAAAPAPAKAETTAPAPAATAPAAGAGIDT--------- 110

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                  +A         +   G     +K   +    TK +V   +          +  
Sbjct: 111 -------VATMSPAVRRLVLEHGLDPTKIKGTGKDGRLTKEDVLAAANAAPETPPASAPA 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                       E +    +R+TIA RL+ ++ T        D ++  ++  R +     
Sbjct: 164 PAAAPAEPGRQEERVKMTRLRQTIAKRLKAAQDTAAMLTTFNDVDMSAVIEARARYKDLF 223

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++       KA  LA+  +P  N     + ++ + ++DISVAVS P G+V 
Sbjct: 224 EKK---HGVRLGFMGFFTKAACLALKDIPAVNGRIDGDEIVYNGYMDISVAVSGPSGLVV 280

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR A+  S  DI   +    +RAK+  L  ++  GGT +ISN G+ G      +INPP
Sbjct: 281 PVIRNAETLSFADIEKTIGDFGKRAKEGTLTMDDMAGGTFTISNGGVFGSLMSTPIINPP 340

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS +L +   E + V  N ++ +  +M   LS DHR +DG  A   L   KE IE+P  +
Sbjct: 341 QSAVLGLHRIEDRPVAINGQVVIRPMMYLALSYDHRLIDGREAVTFLKTIKEAIEDPTRL 400

Query: 422 LM 423
           L+
Sbjct: 401 LI 402


>gi|319779460|ref|YP_004130373.1| Dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Taylorella
           equigenitalis MCE9]
 gi|317109484|gb|ADU92230.1| Dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Taylorella
           equigenitalis MCE9]
          Length = 414

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 115/425 (27%), Positives = 185/425 (43%), Gaps = 15/425 (3%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++EG L +W  + GD++S  +IL EIETDK ++E  S   G+I EI
Sbjct: 1   MSIVNVVVPQLSESVSEGTLIEWKFKVGDQVSVDEILVEIETDKVLLEVPSPSAGVITEI 60

Query: 61  LVPAGTENIAVNSPILNILMDS--TEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKN 118
           L   G   +  +  +  I  ++             E   + +     +      +     
Sbjct: 61  LEQDGA-TVTPDQVLAKIDTEAKAEAKAEDTSKQSEPKEDAQSSKETTVESAKSDNSLAQ 119

Query: 119 RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDE 178
           +  +       A  + +    +  S   G      +    + K +     +         
Sbjct: 120 KSGSKGDVASPAARNILAEKDMKASDVAGSGRDGRVTKADAQKASKGSSVS--------- 170

Query: 179 SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMN 238
              A +         E IP   +R  +A RL QS+Q         + N+  ++ LR +  
Sbjct: 171 KPSAPMATNTEGRIEERIPMTRLRARVAERLIQSQQQNAILTTFNEVNMKPVMDLRNKYK 230

Query: 239 RTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGG 298
            + +        K+      +KA    + + P  N S   N ++ H + DI VAVS P G
Sbjct: 231 ESFEKE---HGIKLGFMSFFVKAAVHGLKKYPILNASVDGNDIVYHGYFDIGVAVSSPRG 287

Query: 299 IVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVI 358
           +V P+IR ADQ S  DI   + +  Q+AK+ KL  +E  GGT ++SN G+ G      +I
Sbjct: 288 LVVPVIRNADQLSFADIEKTIAEFGQKAKEGKLGLDELTGGTFTVSNGGVFGSMMSTPII 347

Query: 359 NPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENP 418
           NPPQS IL I A  ++ V +N EI +  +    LS DHR +DG  A   L   KE +E+P
Sbjct: 348 NPPQSAILGIHATRERAVVENGEIVIRPMNYFALSYDHRIIDGREAVLGLVAMKEALEDP 407

Query: 419 VWMLM 423
             +L+
Sbjct: 408 QRLLL 412


>gi|144898026|emb|CAM74890.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex (E2)
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 403

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 106/423 (25%), Positives = 177/423 (41%), Gaps = 23/423 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   IT+P+L  ++TE  +AKW K  GD +   + + E+ETDK  +E  +   G++ EI+
Sbjct: 1   MTTQITVPTLGESVTEATIAKWFKNVGDAVKADEPIVELETDKVTVEVPAPAAGVLTEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             AGT  + V + +  I   S  +                    ++P       +   P 
Sbjct: 61  AAAGT-TVEVGAVLGAIGAGSGAVAAPAAKPAAAPAPAAAPAPVAAPAPAAAPAAAAFPA 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A+ LA  +         S  G       V +      +                      
Sbjct: 120 AAKLAADVGLNPIAIAGSGKGGRVTKGDVIAAAAAPAAAAP------------------K 161

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A        D  + +    +R+TIA RL++++ T        + ++  L ++R Q     
Sbjct: 162 APSGPRAKADLEDRVAMTRLRRTIAGRLKEAQNTAAMLTTFNEVDMGALFAVRNQYKDQF 221

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+      +KA   A+   P  N       ++  K+ DI VAV  P G+V 
Sbjct: 222 EKR---HGTKLGFMSFFVKACISALKDWPAVNAEIDGTDLVYKKYYDIGVAVGTPQGLVV 278

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ S   +   +  L ++A+  KL  E+  GGT +ISN G+ G      ++N P
Sbjct: 279 PVVRNADQLSFAGVEQAIAGLGKKARDGKLSMEDLTGGTFTISNGGVYGSLMSTPILNTP 338

Query: 362 QSTILAIGAGEKKV-VFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           QS IL +   +++  V  + +I+   +M   LS DHR +DG  A   L + KE IE+P  
Sbjct: 339 QSGILGMHKVQQRPMVMPDGKIEARPMMYLALSYDHRIIDGREAVSFLVRVKECIEDPQR 398

Query: 421 MLM 423
           +L+
Sbjct: 399 ILL 401


>gi|149913125|ref|ZP_01901659.1| dihydrolipoamide succinyltransferase [Roseobacter sp. AzwK-3b]
 gi|149813531|gb|EDM73357.1| dihydrolipoamide succinyltransferase [Roseobacter sp. AzwK-3b]
          Length = 517

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 95/420 (22%), Positives = 166/420 (39%), Gaps = 16/420 (3%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
             + +P+L  ++TE  ++ W K+ GD ++  + LCE+ETDK  +E  +   G + EIL  
Sbjct: 112 TDVMVPTLGESVTEATVSTWFKKVGDSVAQDETLCELETDKVSVEVPAPAAGTLCEILAG 171

Query: 64  AGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIAS 123
            G + +     +  +   +          +    +    H+ S                 
Sbjct: 172 EG-DTVQAGGKLAVLSGSADGTIEPGLRPEPGGAQTEPAHASSG------------GGDV 218

Query: 124 PLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDAN 183
             A            S       G+  +   E +              S           
Sbjct: 219 EDAPSAKKAMAEAGLSRDQVQGTGKDGRIMKEDVSKAVAAASAAPAASSAPAAPVQPPRG 278

Query: 184 ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQF 243
            ++       E +    +R+TIA RL+ ++          + ++  +++LR         
Sbjct: 279 PVSADDAAREERVRMTRLRQTIARRLKDAQNNAAILTTYNEVDMTEVMALRNAYKDDF-- 336

Query: 244 HREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPI 303
             ++   K+       KA   A+ +VPE N       ++    + + +A   P G+V P+
Sbjct: 337 -YKKHGVKLGFMSFFTKACCHALREVPEVNAEIDGTDIVYKNFVHMGIAAGTPQGLVVPV 395

Query: 304 IRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQS 363
           IR AD  S  +I   + +   RA+  KL   E QGGT +ISN G+ G      ++NPPQS
Sbjct: 396 IRDADSMSFAEIEKAIAEKGARARDGKLSMAEMQGGTFTISNGGVYGSLMSSPILNPPQS 455

Query: 364 TILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            IL +   + + +  N +I    +M   LS DHR VDG  A   L + K+ +E+P  +LM
Sbjct: 456 GILGMHKIQDRPMVVNGQIVARPMMYLALSYDHRIVDGKGAVTFLVRVKDALEDPRRLLM 515



 Score =  133 bits (334), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 48/95 (50%), Gaps = 1/95 (1%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   + +P+L  ++TE  +A W K+ GD ++  ++LCE+ETDK  +E  +   G + EI+
Sbjct: 1  MSTEVRVPTLGESVTEATVATWFKKPGDPVAADEMLCELETDKVTVEVPAPAAGTLGEIV 60

Query: 62 VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENI 96
             G E + V++ +  I             +K + 
Sbjct: 61 AGEG-ETVGVDALLATISEGQAAGSGDSAPAKTHD 94


>gi|260914172|ref|ZP_05920645.1| 2-oxoglutarate dehydrogenase [Pasteurella dagmatis ATCC 43325]
 gi|260631805|gb|EEX49983.1| 2-oxoglutarate dehydrogenase [Pasteurella dagmatis ATCC 43325]
          Length = 406

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 103/423 (24%), Positives = 181/423 (42%), Gaps = 19/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I  P L  ++ +  +  W K+ GD +   +IL EIETDK ++E  +V +G+++ I
Sbjct: 1   MSNFEIITPDLPESVADATVVTWHKKVGDTVKRDEILVEIETDKVVLEVPAVSDGVLETI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           +   G   +     +  +   +     +            + ++ +         S +  
Sbjct: 61  IEAEGA-TVVSKQLLGKLSAVAVAGAVTKDTVATQEPTPADRYNATLSSESVGADSVSPG 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           +   +A        I  + + G      + K        TKT               E  
Sbjct: 120 VRRLIAEYDLNAEEIKGTGVGGRITREDVEKVLASKAQQTKT---------------ERE 164

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                        + +P   +RK IA RL ++K +        + ++  ++ LR+     
Sbjct: 165 AEPANFSVGNREEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMAPIMKLRKVYGEK 224

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+V
Sbjct: 225 FEKQ---HGTRLGFMSFYIKAVVEALKRYPEVNASIDGDDIVYHNYFDISIAVSTPRGLV 281

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D+ S+ DI  E+K LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 282 TPVLRNCDKLSMADIEKEIKALADKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 341

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + V  N E+ +  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 342 PQSAILGMHAIKDRPVAVNGEVVIRPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTR 401

Query: 421 MLM 423
           +L+
Sbjct: 402 LLL 404


>gi|83311417|ref|YP_421681.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide
           acyltransferase (E2) component, and related enzyme
           [Magnetospirillum magneticum AMB-1]
 gi|82946258|dbj|BAE51122.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide
           acyltransferase (E2) component, and related enzyme
           [Magnetospirillum magneticum AMB-1]
          Length = 427

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 189/433 (43%), Positives = 266/433 (61%), Gaps = 17/433 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEG LAKW+K EGD +  GDILCEIETDKA MEFE+VDEG++ +IL
Sbjct: 1   MPVQILMPALSPTMTEGNLAKWLKNEGDAVKSGDILCEIETDKATMEFEAVDEGVLGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  GT  +AVN+PI  +L +  +      +S  +     +  + ++        +     
Sbjct: 61  VAGGTSGVAVNTPIAVLLEEGEDASAISAISAISAAPAPKAAAPAAAAAPVTAAAPVAAP 120

Query: 122 ASPLA-----------RRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
           + P             +R+A +  +DL ++ GSGPHGRIVK+D+E  I         +  
Sbjct: 121 SGPAHGGDRVVASPLAKRIAKDGNVDLKAVKGSGPHGRIVKADVEAAIKAGPAKPAAAPA 180

Query: 171 QSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNL 230
                  +S  A       + ++E IP+ ++RK IA RL ++K TIPHFY+SIDC +D L
Sbjct: 181 AIVAPAAKSAPAPAAASPFEPAFEEIPNSSMRKVIARRLTEAKSTIPHFYLSIDCELDAL 240

Query: 231 LSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDIS 290
           L +R  +N     +      K+SVND +++A ALA+ + P AN SW   A+ R+  IDIS
Sbjct: 241 LKVRADLNGRSDAY------KLSVNDFVVRAVALALKKAPAANASWGEEAIKRYTDIDIS 294

Query: 291 VAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLG 350
           VAV+ P G++TPI+  AD K + +IS E+K LA +A+  KLKPEE+QGG  +ISN+GM G
Sbjct: 295 VAVATPSGLITPIVHHADHKGLAEISNEMKSLAAKARDGKLKPEEFQGGGFTISNLGMFG 354

Query: 351 INSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAK 410
           I  F A+INPPQ  ILA+GAGE++ V +   + VAT+M  TLS DHR VDGA+ ++ LA 
Sbjct: 355 IKEFAAIINPPQGCILAVGAGEQRPVVKAGALAVATVMTCTLSVDHRVVDGAVGAEFLAA 414

Query: 411 FKEYIENPVWMLM 423
           FK+ IE+P+ ML+
Sbjct: 415 FKKLIEDPLSMLL 427


>gi|254509021|ref|ZP_05121126.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Vibrio parahaemolyticus 16]
 gi|219548056|gb|EED25076.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Vibrio parahaemolyticus 16]
          Length = 402

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 96/422 (22%), Positives = 180/422 (42%), Gaps = 22/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W KQ GD +   ++L +IETDK ++E  + + G+++ I+
Sbjct: 1   MTIEILVPDLPESVADATVATWHKQPGDTVERDEVLVDIETDKVVLEVPAPEAGVLEAII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     I  +   +    P+   ++       + H  S      +  S     
Sbjct: 61  EEEGA-TVLSKQLIAKLKPGAVAGEPTTDTTESTEASPDKRHKASLTEESNDALSPAVRR 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A +          +        ++ +                          
Sbjct: 120 LLAEHSLEASQVKGTGVGGRITREDIEAYIANAKAAPK------------------AEDP 161

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A +    A  S + +P   +RKT+A RL ++K          + N+  ++ LR+Q     
Sbjct: 162 AAVEAPAAARSQKRVPMTRLRKTVANRLLEAKNNTAMLTTFNEVNMKPIMDLRKQYKDQF 221

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 222 EER---HGIRLGFMSFYVKAVTEALKRYPEVNASIDGDDIVYHNYFDISMAVSTPRGLVT 278

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D     D+   +K+LA + +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 279 PVLKDCDTLGFADVEKGIKELAIKGRDGKLTVDELMGGNFTITNGGVFGSLMSTPIINPP 338

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 339 QSAILGMHKIQERPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARL 398

Query: 422 LM 423
           L+
Sbjct: 399 LL 400


>gi|296158782|ref|ZP_06841611.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia sp. Ch1-1]
 gi|295890987|gb|EFG70776.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia sp. Ch1-1]
          Length = 427

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 118/429 (27%), Positives = 200/429 (46%), Gaps = 10/429 (2%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL EIETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLS-KENIVEVREEHSHSSPVVVREKHSKNR 119
           +   G + +  +  I  I  + T    +     K          +  +P       +   
Sbjct: 61  IANDG-DTVTADQVIAKIDTEGTASAAAVEAEVKPAPQAAPAPAAAPAPAAQAASATGAN 119

Query: 120 PIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDES 179
             ASP A +L  E G+    ++G+G  GRI K D+ +  +        +   +      S
Sbjct: 120 TAASPAAGKLMAEKGLGAGDVAGTGRDGRITKGDVLSAGAPAAKAAAPAPAAAPKAAKPS 179

Query: 180 -----IDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLR 234
                  A+          + +P   +R  IA RL +S+QT        + N+  ++ LR
Sbjct: 180 LPDVKAPASAEQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMDLR 239

Query: 235 EQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVS 294
            +     +        K+      +KA   A+ + P  N S   N ++ H + DI +AV 
Sbjct: 240 NKYKDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVG 296

Query: 295 IPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSF 354
            P G+V PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G    
Sbjct: 297 SPRGLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLS 356

Query: 355 CAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEY 414
             +INPPQS IL + A +++ V +N +I +  +    LS DHR +DG  A   L   K+ 
Sbjct: 357 TPIINPPQSAILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDA 416

Query: 415 IENPVWMLM 423
           +E+P  +L+
Sbjct: 417 LEDPARLLL 425


>gi|110834356|ref|YP_693215.1| dihydrolipoamide succinyltransferase [Alcanivorax borkumensis SK2]
 gi|110647467|emb|CAL16943.1| dihydrolipoamide succinyltransferase [Alcanivorax borkumensis SK2]
          Length = 421

 Score =  294 bits (753), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 93/423 (21%), Positives = 181/423 (42%), Gaps = 5/423 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I  P    ++ +G +A W KQEG+ +   ++L +IETDK ++E  +  +G++ +I+
Sbjct: 1   MATDIKAPQFPESVADGTVATWHKQEGEAVKRDELLVDIETDKVVLEVVAPADGVVSKIM 60

Query: 62  VPAGTENIAVNSPILNILMDST-EIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
              G E +     +      ++     S     E   +                +S +  
Sbjct: 61  AAEG-ETVESQQVLGTFDEGASGSAGSSNDKPAETDTKEASADHKEDAKSESADNSADDD 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
            +S      A    +    ++     G      I      K          +     +  
Sbjct: 120 DSSGDQAGPAARKLMSEHGIAADQVKGTGRGGRITKGDVEKVITDKAQKRANQPAPQQPA 179

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
             ++     +     +P   +RK IA RL  ++Q         + N+  ++ +R+     
Sbjct: 180 TLDVPGAPGEREERRVPMTRLRKRIAERLVSAQQDSAMLTTFNEVNMKPIMDMRKHYQPE 239

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +      + ++       +A   A+ + P  N S     ++ H + D+ VAVS   G+V
Sbjct: 240 FEKA---HNVRLGFMGFFTRACVEALKRFPAVNASIDGEDIVYHGYYDVGVAVSTERGLV 296

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            P++R ADQK + ++  ++ +  Q+A++ KL  EE  GGT +ISN G+ G      ++NP
Sbjct: 297 VPVLRDADQKGLAEVESQIIEYGQKAQKGKLSIEEMTGGTFTISNGGVFGSLISTPILNP 356

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQ+ IL +   +++ +  + ++++  +M   LS DHR +DG  A + L   K +IE+P  
Sbjct: 357 PQTAILGMHKIQERPMAVDGKVEILPMMYLALSYDHRLIDGKEAVQFLVAVKNFIEDPAR 416

Query: 421 MLM 423
           +L+
Sbjct: 417 LLL 419


>gi|91782998|ref|YP_558204.1| dihydrolipoamide acetyltransferase [Burkholderia xenovorans LB400]
 gi|91686952|gb|ABE30152.1| 2-oxoglutarate dehydrogenase E2 component [Burkholderia xenovorans
           LB400]
          Length = 427

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 119/429 (27%), Positives = 200/429 (46%), Gaps = 10/429 (2%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL EIETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLS-KENIVEVREEHSHSSPVVVREKHSKNR 119
           +   G + +  +  I  I  + T    +     K          +  +P       +   
Sbjct: 61  IANDG-DTVTADQVIAKIDTEGTASAAAVEAEVKPAPQAAPAPAAAPAPAAQAASATGAN 119

Query: 120 PIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDES 179
             ASP A +L  E G+    ++G+G  GRI K D+ T  +        +   +      S
Sbjct: 120 TAASPAAGKLMAEKGLGAGDVAGTGRDGRITKGDVLTAGAPAAKAAAPAPAAAPKAAKPS 179

Query: 180 -----IDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLR 234
                  A+          + +P   +R  IA RL +S+QT        + N+  ++ LR
Sbjct: 180 LPDVKAPASAEQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMDLR 239

Query: 235 EQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVS 294
            +     +        K+      +KA   A+ + P  N S   N ++ H + DI +AV 
Sbjct: 240 NKYKDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVG 296

Query: 295 IPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSF 354
            P G+V PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G    
Sbjct: 297 SPRGLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLS 356

Query: 355 CAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEY 414
             +INPPQS IL + A +++ V +N +I +  +    LS DHR +DG  A   L   K+ 
Sbjct: 357 TPIINPPQSAILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDA 416

Query: 415 IENPVWMLM 423
           +E+P  +L+
Sbjct: 417 LEDPARLLL 425


>gi|160872775|ref|ZP_02062907.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Rickettsiella grylli]
 gi|159121574|gb|EDP46912.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Rickettsiella grylli]
          Length = 403

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 93/422 (22%), Positives = 175/422 (41%), Gaps = 21/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++T+  +  W K+ G+ +   D L ++ETDK ++E  +  +GI+ +I+
Sbjct: 1   MSIEVKVPMLPESVTDATIVTWHKKPGETVKRDDNLVDLETDKVVLEVPASADGILGDII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  +  +                          P     K       
Sbjct: 61  KQTGA-VVKAGEILAYLNTEKE-----------------VTMKPEQPAHQETKIETEEKT 102

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                           S+   + P   I  S     ++    ++   + +   L  ES  
Sbjct: 103 KHDNRAEPVAGPAARRSAAEQNLPLKNITGSGKAGRVTRNDVLQHAHSPRQNPLSSESDA 162

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            + L        + +P   +R  IA RL  ++          + N+ N+++LR++   + 
Sbjct: 163 RSSLRHADDRLEKRVPMTRLRARIAERLLAAQHHAAILTTFNEINLQNVIALRQRYKESF 222

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++       KA   A+   P  N S   N ++ H + DI +AVS   G++ 
Sbjct: 223 EKK---HGIRLGFMSFFTKAVIEALKLFPAVNASIDGNDIVYHGYFDIGIAVSTDRGLMV 279

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI+R AD+ S  DI   +    ++AK+ ++  E+  GGT +I+N G+ G      +INPP
Sbjct: 280 PILRDADRLSFADIEKTISNYGRKAKENQIAIEDMTGGTFTITNGGVFGSLLATPIINPP 339

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   E++ + +  ++ +  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 340 QSAILGMNKIEERPIAEKGQVVIRPMMYVALSYDHRIIDGKESVSFLKTIKERLEDPARL 399

Query: 422 LM 423
           L+
Sbjct: 400 LI 401


>gi|87199201|ref|YP_496458.1| 2-oxoglutarate dehydrogenase E2 component [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87134882|gb|ABD25624.1| 2-oxoglutarate dehydrogenase E2 component [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 408

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 94/422 (22%), Positives = 172/422 (40%), Gaps = 16/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P+L  +++E  + +W+K+ G+ ++  + +  +ETDK  +E  +   G++  ++
Sbjct: 1   MSIEVKVPTLGESVSEATVGQWLKKPGEAVALDEPIVSLETDKVAVEVPAPAAGVLGALV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + +AV + +  I                     +     +   V     S+    
Sbjct: 61  ANEG-DTVAVGALLALIEDG------------VAAAGAQAPAPRTEAPVPPASASEAPAA 107

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +  A  L+      +          +    D                      V     
Sbjct: 108 PAGDAAVLSPAVRRAVLEYGIDPSTVKGTGKDGRLTKEDVMAAAAAKQAAPAAAVSAQAA 167

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                     + E +    +R+TIA RL+ +++T        D ++  ++  R +     
Sbjct: 168 TPAAAPAGGRNEERVKMTRLRQTIAKRLKSAQETAALLTTFNDVDMSAVMEARAKYKDVF 227

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+ +     KA  LA+  +P  N     + ++   ++DISVAVS P G+V 
Sbjct: 228 EKK---HGVKLGLMSFFAKASVLALKDIPSVNAQIQGDEIVYFDYVDISVAVSAPNGLVV 284

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S  DI   +    ++A+   L   +  GGT +ISN G+ G      +INPP
Sbjct: 285 PVVRDVDKMSFADIEKSIADYGKKARDGALTMADMAGGTFTISNGGVFGGLMSTPIINPP 344

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS +L +   E + V +N EI +  +M   LS DHR +DG  A   L   KE IE+P  +
Sbjct: 345 QSAVLGLHRIEDRPVVRNGEIVIRPMMYIALSYDHRIIDGREAVTALKTIKEAIEDPTRL 404

Query: 422 LM 423
           L+
Sbjct: 405 LI 406


>gi|17545989|ref|NP_519391.1| dihydrolipoamide acetyltransferase [Ralstonia solanacearum GMI1000]
 gi|17428284|emb|CAD14972.1| probable dihydrolipoamide succinyltransferase (component of
           2-oxoglutarate dehydrogenase complex) protein [Ralstonia
           solanacearum GMI1000]
          Length = 418

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 115/424 (27%), Positives = 193/424 (45%), Gaps = 9/424 (2%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P  S ++ EG L  W K+ G+ ++  ++L EIETDK ++E  +   G++ E+
Sbjct: 1   MAIVDVKVPQFSESVEEGTLISWKKKPGEAVTVDEVLVEIETDKVVLEVPAPSAGVLAEV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           LV  G   +     +  I  +      +P  +             ++P            
Sbjct: 61  LVADGA-TVTSEQLLAKIDTEGKAGAAAPAAAAPAPAAAAPAPVAAAPAAAAATGGVAM- 118

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
              P A +L  E  +    ++G+G  GRI K D+   ++        +  Q+     + +
Sbjct: 119 ---PSAAKLMAEANLSAGQVAGTGRDGRITKGDVLGAVAGGAKPAPAAAPQAARPALQQV 175

Query: 181 DANI-LNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
            A +   +      E +P   +R  IA RL QS+ T        + N+  ++ LR +   
Sbjct: 176 AAPVDFAVLGDRPEERVPMSRLRARIAERLVQSQSTNAILTTFNEVNMKPVMDLRAKFKD 235

Query: 240 TLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGI 299
             +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P G+
Sbjct: 236 QFEKT---HGVKLGFMSFFVKAAVHALKKYPVINASVDGNDIVYHGYFDIGIAVGSPRGL 292

Query: 300 VTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVIN 359
           V PI+R ADQ S+ DI  ++ +  Q+A+  KL  ++  GGT SISN G  G      +IN
Sbjct: 293 VVPILRNADQMSLADIEKKIAEFGQKARDGKLTLDDLTGGTFSISNGGTFGSMLSTPIIN 352

Query: 360 PPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPV 419
           PPQS IL + A + + V +N ++ V  +    +S DHR +DG  A   L   KE +E+P 
Sbjct: 353 PPQSAILGVHATKDRAVVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPA 412

Query: 420 WMLM 423
            +L+
Sbjct: 413 RLLL 416


>gi|261822342|ref|YP_003260448.1| dihydrolipoamide succinyltransferase [Pectobacterium wasabiae
           WPP163]
 gi|261606355|gb|ACX88841.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Pectobacterium wasabiae WPP163]
          Length = 408

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 100/423 (23%), Positives = 178/423 (42%), Gaps = 17/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  + + G++D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDSVQRDEVLVEIETDKVVLEVPASEAGVLDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G   +     +  I    +    +   S+       + H+        +  S    
Sbjct: 61  LEEEGA-TVTSRQLLGRIRRGDSSGKETGEKSQSKESTPAQRHTAGLEEENSDALSPAIR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A                         T      ++             E+ 
Sbjct: 120 RLIAEHDLDASTI-------------KGSGVGGRITREDVDKHLAAQKKDSGKAAKSEAP 166

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
            A+   +    S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 167 AASPAPVLGARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEINMQPIMDLRKQYGEA 226

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S     ++ H + D+S+AVS P G+V
Sbjct: 227 FEKR---HGVRLGFMSFYIKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLV 283

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI   +K+LA + +  KL  EE  GG  +I+N G+ G      +INP
Sbjct: 284 TPVLRDVDALGMADIEKRIKELAVKGRDGKLTVEELLGGNFTITNGGVFGSLMSTPIINP 343

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  + ++ +  +M   LS DHR VDG  +   L   KE +E+P  
Sbjct: 344 PQSAILGMHAIKDRPMAVDGQVVILPMMYLALSYDHRLVDGRESVGFLVTVKEMLEDPAR 403

Query: 421 MLM 423
           +L+
Sbjct: 404 LLL 406


>gi|187928191|ref|YP_001898678.1| dihydrolipoamide succinyltransferase [Ralstonia pickettii 12J]
 gi|187725081|gb|ACD26246.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Ralstonia pickettii 12J]
          Length = 416

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 104/423 (24%), Positives = 176/423 (41%), Gaps = 9/423 (2%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P  S ++ EG L  W K+ G+ ++  +IL E+ETDK ++E  +   G++ E+
Sbjct: 1   MAIVEVKVPQFSESVEEGTLISWKKKPGEAVAQDEILIEVETDKVVLEVPAPSAGVLAEV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           LV  G   +     +  I  +      +P  +             +         +    
Sbjct: 61  LVADGA-TVTSEQLLAKIDTEGKAGAAAPAAAAPAPAAAAPAPVAAPAAAATGGVAMP-- 117

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                A+ +A  +                    +  +          +   +   + +  
Sbjct: 118 ---SAAKLMAENNLSAGQVAGTGRDGRITKGDVLGAVAGGAKPAAAAAPQAARPALQQVA 174

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                        E +P   +R  IA RL QS+ T        + N+  ++ LR +    
Sbjct: 175 APVDFAALGDRPEERVPMSRLRARIAERLVQSQSTNAILTTFNEVNMKPVMDLRAKFKDQ 234

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P G+V
Sbjct: 235 FEKT---HGVKLGFMSFFVKAAVHALKKYPVINASVDGNDIVYHGYFDIGIAVGSPRGLV 291

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            PI+R ADQ S+ DI  ++ +  Q+AK  KL  ++  GGT SISN G  G      +INP
Sbjct: 292 VPILRNADQMSLADIEKKIAEFGQKAKDGKLTLDDLTGGTFSISNGGTFGSMLSTPIINP 351

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + V +N ++ V  +    +S DHR +DG  A   L   KE +E+P  
Sbjct: 352 PQSAILGVHATKDRAVVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPAR 411

Query: 421 MLM 423
           +L+
Sbjct: 412 LLL 414


>gi|315633947|ref|ZP_07889236.1| dihydrolipoyllysine-residue succinyltransferase [Aggregatibacter
           segnis ATCC 33393]
 gi|315477197|gb|EFU67940.1| dihydrolipoyllysine-residue succinyltransferase [Aggregatibacter
           segnis ATCC 33393]
          Length = 401

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 100/422 (23%), Positives = 184/422 (43%), Gaps = 23/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD +   +++ EIETDK ++E  +  +G+I EI+
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKAGDAVKRDEVIVEIETDKVVLEVPAQADGVISEIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  +   +T    +   + E     R       P          R +
Sbjct: 61  QDEGA-TVVSKQLLGKLEASATAAAAAMEKTAEPTPADRRTEVPDEPHSTDALSPGVRRL 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +    + +   G  +           ++          +T V                 
Sbjct: 120 LAEHDIQASEVKGTGVGGRITREDVEAVIAKRAAAPKPAETTVSTM-------------- 165

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                 ++  S + +P   +RK IA RL ++K          + ++  +++LR+Q     
Sbjct: 166 -----AYSARSEKRVPMTRLRKRIAERLLEAKNNTAMLTTFNEVDMKPIMNLRKQYGEKF 220

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+VT
Sbjct: 221 EKQ---HGVRLGFMSFYIKAVVEALKRYPEVNASIDGDDVVYHNYFDVSIAVSTPRGLVT 277

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D  S+ DI   +K LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 278 PVLRDCDNLSMADIEKSIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 337

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ V  + ++ +  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 338 QSAILGMHAIKERPVAVDGQVVIRPMMYLALSYDHRLIDGRESVGFLVTVKELLEDPTRL 397

Query: 422 LM 423
           L+
Sbjct: 398 LL 399


>gi|302389985|ref|YP_003825806.1| catalytic domain of components of various dehydrogenase complexes
           [Thermosediminibacter oceani DSM 16646]
 gi|302200613|gb|ADL08183.1| catalytic domain of components of various dehydrogenase complexes
           [Thermosediminibacter oceani DSM 16646]
          Length = 432

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 147/440 (33%), Positives = 242/440 (55%), Gaps = 26/440 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + MP L  TMTEG + KW+K+EG+++  G+ L EI+TDK  +E E+   GI+ +IL
Sbjct: 1   MAEIVRMPKLGLTMTEGTIVKWLKKEGEEVKQGEPLLEIQTDKVNLEEEAPASGILRKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
            P G+  +AV   I  I  ++       P   +N     ++                +  
Sbjct: 61  APEGS-VVAVGQEIAIIGAETE----PLPEIGKNTGVEVKQAGVEPERPAPAPPPSEKVK 115

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSF-------- 173
           ASP A+R+A E+GIDL S++ +GP GR+V+ D+   I ++         +          
Sbjct: 116 ASPAAKRVAREYGIDLKSVTPTGPDGRVVERDVLEYIESRKVKATPVARKIAEEKGVDLS 175

Query: 174 ----------GLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
                        D      + ++  ++ Y VIP   +RK I+ ++ ++K  +PHFY+++
Sbjct: 176 RIGKLEGERITKQDVLEALKLASVEPREEYRVIPWAGMRKIISDKMVKTKAQVPHFYLTL 235

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           + ++   L LRE++   +Q   E    K+S+NDI++KA A A+++ P  N S     ++ 
Sbjct: 236 EVDMGKALELREKLAPKIQ---ELNGVKLSINDILIKAAARALVEHPLVNSSAGEEGIVV 292

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
              I+I +AV++  G++ P+IR AD+K ++ IS E  +L ++A++ KL P++Y  GT +I
Sbjct: 293 KNRINIGLAVALDDGLIVPVIRDADKKGLVQISKETAELIKKAREGKLMPDDYLDGTFTI 352

Query: 344 SNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAI 403
           SN+GM  I  F A+IN P+S ILA+G   KK V   +EI V  +M  TLS DHR +DGA+
Sbjct: 353 SNLGMFDIEEFSAIINAPESAILAVGKIVKKPVVVEDEIVVRPMMKLTLSCDHRVIDGAL 412

Query: 404 ASKLLAKFKEYIENPVWMLM 423
            +K L + K+ +E+PV ML+
Sbjct: 413 GAKFLRRIKQLLEDPVEMLL 432


>gi|126452386|ref|YP_001066042.1| dihydrolipoamide acetyltransferase [Burkholderia pseudomallei
           1106a]
 gi|242315260|ref|ZP_04814276.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia pseudomallei 1106b]
 gi|126226028|gb|ABN89568.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia pseudomallei 1106a]
 gi|242138499|gb|EES24901.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia pseudomallei 1106b]
          Length = 421

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 105/423 (24%), Positives = 186/423 (43%), Gaps = 4/423 (0%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL E+ETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G + +  +  I  I  ++     +      ++       +  +P       + +  
Sbjct: 61  LQNDG-DTVVADQVIATIDTEAKAGAAAAAAGAADVQPAAAPVAAPAPAAQPAAAAASST 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
            A+  A           +           +         +              L +  +
Sbjct: 120 AAASPAASKLMAEKGIGAGDVAGSGRDGRITKGDVLSAGSAPAAAPAKAAAKPALPEVKV 179

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
            A+          + +P   +R  IA RL +S+QT        + N+  ++ LR +    
Sbjct: 180 PASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKYKDK 239

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P G+V
Sbjct: 240 FEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV 296

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G      +INP
Sbjct: 297 VPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP 356

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A +++ V +N +I +  I    LS DHR +DG  A   L   K+ +E+P  
Sbjct: 357 PQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPAR 416

Query: 421 MLM 423
           +L+
Sbjct: 417 LLL 419


>gi|209544264|ref|YP_002276493.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209531941|gb|ACI51878.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 424

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 97/425 (22%), Positives = 180/425 (42%), Gaps = 6/425 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++T   +AKW+K+ G+ ++  + + E+ETDK  +E  + + G++   L
Sbjct: 1   MSAEIKVPTLGESVTTATIAKWLKKPGEAVTADEPVVELETDKVSVEVAAPEAGVMGPQL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  G E + V + + ++   S         +           + +               
Sbjct: 61  VAEGDE-VEVGTVLASVEAGSGAAAKPAAAAPAPKKAAEAPKAPAGVQAQPTTSGPVARP 119

Query: 122 ASPLARRLAG---EHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDE 178
           A+P +   A       +  +    +       +  I T    +    D     S   V +
Sbjct: 120 ATPPSDVAAQGAAHAPMPSAQKMMTEKGVTTAEIGIGTGKDGRVTKGDVLAFLSQPPVAK 179

Query: 179 SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMN 238
           +  A           E +    +R+TIA RL+ ++ T        + ++    ++R +  
Sbjct: 180 AAAAPAAPRTDDPREERVKMTRLRRTIARRLKDAQNTAALLTTFNEVDMSAAKAMRAEYR 239

Query: 239 RTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGG 298
              +        K+    I  KA   A+ + P  N     + +I  + I++ +AV  P G
Sbjct: 240 DLFEKKN--GGVKLGFMSIFAKAAIAALKEFPAINAEIDGDDVIYREFINLGIAVGGPNG 297

Query: 299 IVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVI 358
           +V P+IR AD+ +   I   +    +RA+   LK +E  GGT SI+N G+ G      ++
Sbjct: 298 LVVPVIRDADKLNFAGIESAIAGFGKRARDGSLKLDELSGGTFSITNGGIYGSLMSTPIV 357

Query: 359 NPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENP 418
           N PQS IL + A + + V  N ++ +  +M   L+ DHR VDG  A   L + K+ +E+P
Sbjct: 358 NAPQSGILGMHAIQDRPVAVNGQVVIRPMMYIALTYDHRIVDGKEAVSFLVRVKQNVEDP 417

Query: 419 VWMLM 423
             +L+
Sbjct: 418 RRLLL 422


>gi|23098545|ref|NP_692011.1| dihydrolipoamide acetyltransferase [Oceanobacillus iheyensis
           HTE831]
 gi|22776771|dbj|BAC13046.1| 2-oxoglutarate dehydrogenase E2 subunit (dihydrolipoamide
           S-succinyltransferase) [Oceanobacillus iheyensis HTE831]
          Length = 422

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 101/424 (23%), Positives = 179/424 (42%), Gaps = 7/424 (1%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I +P L+ ++TEG +A+W+ ++GDK+  GD + E+ETDK  +E  +   G+I EI+ 
Sbjct: 1   MQEIKIPELAESITEGTIAEWLVKKGDKVEKGDPVVELETDKVNVEVNAEFSGVITEIIS 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK-NRPI 121
             G + + V   I  +  +      S     +   +  E+           + SK     
Sbjct: 61  EEGDD-VTVGDTIAKLDENGEAGSNSDESEPKEEPKQEEKQEDDKKKASETETSKGAETK 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           +      +A       +            +  +  + +     +  +  Q      E  D
Sbjct: 120 SESNGEVIASPAARKRARELNIDLSSVQSRDPLGRVRTEDVEAQAQANKQPAEKKQEKKD 179

Query: 182 ANILNLFAKD-SYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
           A        D   E +     R+TIA  L + +          + ++  ++ LR+Q    
Sbjct: 180 APKSEKTEFDKPVERVKMTRRRQTIAKNLVEVQHNTAMLTTFNEVDMTAVMELRKQRKDK 239

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
                     K+       KA   A+ + P  N     N ++  K  DI +AVS   G+V
Sbjct: 240 FLDKN---GVKLGFMSFFTKAVVGALKEFPLLNAEIQGNELVIKKFYDIGIAVSTDDGLV 296

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            P++R AD+K    I  ++  L  +A+  KL  ++ QGG+ +I+N G  G      ++N 
Sbjct: 297 VPVVRDADRKDFAGIEQDINDLGIKARDNKLTLKDLQGGSFTITNGGTFGSMMSTPILNA 356

Query: 361 PQSTILAIGAGEKKV-VFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPV 419
           PQ  IL +    K+  V  ++ I+V  +M   LS DHR VDG  A + L + K+ +E+P 
Sbjct: 357 PQVGILGMHNIVKRAMVMPDDSIEVRPMMYLALSYDHRIVDGKEAVQFLVRIKQMLEDPY 416

Query: 420 WMLM 423
            +L+
Sbjct: 417 DLLL 420


>gi|260772360|ref|ZP_05881276.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio
           metschnikovii CIP 69.14]
 gi|260611499|gb|EEX36702.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio
           metschnikovii CIP 69.14]
          Length = 402

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 110/422 (26%), Positives = 196/422 (46%), Gaps = 22/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W KQ GD ++  ++L EIETDK ++E  + + GI++ IL
Sbjct: 1   MTVEILVPDLPESVADATVATWHKQPGDAVARDEVLVEIETDKVVLEVPAPEAGILESIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  I   +    P+P  +        + H         +        
Sbjct: 61  ELEGA-TVLSKQLLARIKPGAVAGEPTPDSTASTEPSPDKRHKAVLSEESNDA------- 112

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            SP  RRL  EH ++ + + GSG  GRI + D++  ++                   +  
Sbjct: 113 LSPAVRRLLAEHNVEPAQVKGSGVGGRITREDVDAYLAKNQAAAPT-----------AQP 161

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            +     A  S + +P   +RK +A RL ++K +        + N+  ++ LR+Q     
Sbjct: 162 VSAPLPVAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMELRKQYQDLF 221

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S     ++ H + DIS+AVS P G+VT
Sbjct: 222 EKK---HGIRLGFMSFYVKAVTEALKRYPEVNASIDGQDIVYHNYFDISMAVSTPRGLVT 278

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D  S+ +I   +K+LA + +  KL  EE  GG  +I+N G+ G      +INPP
Sbjct: 279 PVLKDCDMLSLAEIEKGIKELALKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPP 338

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 339 QAAILGMHKIQDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARL 398

Query: 422 LM 423
           L+
Sbjct: 399 LL 400


>gi|254283502|ref|ZP_04958470.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [gamma proteobacterium NOR51-B]
 gi|219679705|gb|EED36054.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [gamma proteobacterium NOR51-B]
          Length = 407

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 106/422 (25%), Positives = 179/422 (42%), Gaps = 17/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I  P+   ++ +G++A W KQEGD +   +++ EIETDK +ME  + + G I +I 
Sbjct: 1   MAIDIKAPAFPESVADGEIATWHKQEGDTVERDELIVEIETDKVVMEVVAPESGTITKIA 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + I   + +  +   +    PS P S E           +  +    +       
Sbjct: 61  FAEG-DTIESEAVLATLEPGAVTAKPSAPASTEATAASDSTPGEAPQMGPAARQLVEEHG 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
             P              S       G  +  +              S   +  +VD    
Sbjct: 120 LDP--------------SAISGTGKGGRLTKEDVMAHLAGAPSGAASAPGAANIVDSPAL 165

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                   +   + +P   +R  IA RL  + Q         + N+  L+ LR+Q     
Sbjct: 166 DESPQPSGERVEKRVPMTRMRARIAERLLDASQQTAMLTTFNEVNMAPLMKLRKQYKEQF 225

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   N ++ H + D+ VAVS   G+V 
Sbjct: 226 EKTHN--GTRLGFMGFFVKACCEALKRFPEVNASIDGNDVVYHGYQDVGVAVSTNDGLVV 283

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI+R AD  SI DI   ++ L  +AK +KL  ++  GGT ++SN G+ G      ++NPP
Sbjct: 284 PILRDADFMSIADIEAAIRDLGLKAKDKKLTMDDMTGGTFTLSNGGVFGSLLSTPILNPP 343

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   +++ V  + ++ +  +M   LS DHR +DG  A + L   K  IE+P  +
Sbjct: 344 QTGILGMHTIQERPVAIDGQVVIQPMMYLALSYDHRLIDGKTAVQFLVTVKGLIEDPARI 403

Query: 422 LM 423
           L+
Sbjct: 404 LL 405


>gi|323525734|ref|YP_004227887.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia sp. CCGE1001]
 gi|323382736|gb|ADX54827.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia sp. CCGE1001]
          Length = 425

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 106/427 (24%), Positives = 188/427 (44%), Gaps = 8/427 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL EIETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           +   G + +  +  I  I  +      +     +         + +           N  
Sbjct: 61  IANDG-DTVTADQVIAKIDTEGKAGAAAVEAEVKPAPVAAPAPAAAPAAQAASAAGANTA 119

Query: 121 IASPLARRLAGEH----GIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLV 176
            +    + +A +      +  +   G    G ++ +      +               L 
Sbjct: 120 ASPAAGKLMAEKGLSAGDVAGTGRDGRITKGDVLTAGAPAAKAAAPAPAAAPKAAKPSLP 179

Query: 177 DESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
           D    A+          + +P   +R  IA RL +S+QT        + N+  ++ LR +
Sbjct: 180 DVKAPASADQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMDLRNK 239

Query: 237 MNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIP 296
                +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P
Sbjct: 240 YKDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSP 296

Query: 297 GGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCA 356
            G+V PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G      
Sbjct: 297 RGLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTP 356

Query: 357 VINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIE 416
           +INPPQS IL + A +++ V +N +I +  +    LS DHR +DG  A   L   K+ +E
Sbjct: 357 IINPPQSAILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDALE 416

Query: 417 NPVWMLM 423
           +P  +L+
Sbjct: 417 DPARLLL 423


>gi|159044703|ref|YP_001533497.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Dinoroseobacter shibae DFL 12]
 gi|157912463|gb|ABV93896.1| dihydrolipoyllysine-residue acetyltransferase component of pyruvate
           dehydrogenase complex [Dinoroseobacter shibae DFL 12]
          Length = 420

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 188/423 (44%), Positives = 266/423 (62%), Gaps = 6/423 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+VD+GII +IL
Sbjct: 1   MATEILMPALSPTMEEGTLAKWMVKEGDSVSSGDLLAEIETDKATMEFEAVDDGIIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK-NRP 120
           V AGT+++ VN+ I  +L +  E+    P  +       ++ +              +R 
Sbjct: 61  VAAGTDDVKVNTLIAILLEEGEELGAEKPAEQPPEPASVQQEAAPQETAKAPPPKTGDRV 120

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
            ASPLARRLA + G+DLS + GSGPHGRIVK+D++         +  +  Q+        
Sbjct: 121 FASPLARRLAKQKGLDLSEIRGSGPHGRIVKADVDAAEQPAAVPEQAAAPQTRQPEGPKS 180

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
            +++ ++FA   +  +  D +RKTIA RL ++KQTIPHFY+    N+D LL+ R ++N  
Sbjct: 181 ASSVASIFADRPFTEVSLDGMRKTIAARLTEAKQTIPHFYLRRAANLDALLTFRTELNAQ 240

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
           L         K+SVND ++KA A A+  VP AN  W  + +++ +  D++VAV+I GG+ 
Sbjct: 241 LAPS----GKKLSVNDFVIKACARALQSVPHANAVWAEDRILQMQRSDVAVAVAIEGGLF 296

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP+I+ ADQKSI  +S E+K LA RA++RKL P EY GGT +ISN+GM GI +F AVINP
Sbjct: 297 TPVIKDADQKSISALSEEMKDLAARARERKLAPSEYVGGTFAISNLGMFGIENFDAVINP 356

Query: 361 PQSTILAIGAGEKKVVFQ-NEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPV 419
           P   ILA+GAG KK     +  + VAT M+ TLS DHR +DG++ + LLA+    +ENP+
Sbjct: 357 PHGAILAVGAGVKKPTVDADGAVTVATQMSMTLSVDHRVIDGSVGAALLAEIVSGLENPL 416

Query: 420 WML 422
            +L
Sbjct: 417 LLL 419


>gi|239948174|ref|ZP_04699927.1| dihydrolipoamide acetyltransferase component [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239922450|gb|EER22474.1| dihydrolipoamide acetyltransferase component [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 401

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 108/422 (25%), Positives = 179/422 (42%), Gaps = 23/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +PSL  ++TE  +AKW K++GD +   ++L EIET+K  +E  +   G I +I 
Sbjct: 1   MSVKIIVPSLGESVTEATIAKWYKKKGDSVKTDELLLEIETEKVTLEVNAPCNGTIGKIS 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G  N+AV   I  I   +                V +  S          ++   P 
Sbjct: 61  KTDGA-NVAVGEEIGEINEGAAANTAGTNNESAKAQAVTQPTSEKPVEKPAVANNTLAPS 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              L      +      +          V   I T                      +  
Sbjct: 120 VQKLVTENKLDPNNIKGTGRDGRITKGDVLETINT-------------------PPTATS 160

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A  ++   ++  + +    +RKTIA RL+ S+ T        + ++  +++LR Q     
Sbjct: 161 APAISKSNEERVQRVRMSRLRKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEF 220

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +      S K+      +KA   A+  +P  N     + ++   + DI VAV    G+V 
Sbjct: 221 EKK---HSVKLGFMSFFVKATIEALKLIPLVNAEIDGDDLVYKNYYDIGVAVGTEQGLVV 277

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD+    ++   +  LA++A++ KL   +  GGT SISN G+ G      +INPP
Sbjct: 278 PVVRDADKMGFAEVEKTIGILAKKAREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPP 337

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   E++ V  + +I++  +M   LS DHR +DG      L K K+ IENP  +
Sbjct: 338 QSGILGLHKTEERAVVIDGKIEIRPMMYIALSYDHRIIDGKEGVSFLVKIKQLIENPEKL 397

Query: 422 LM 423
           L+
Sbjct: 398 LL 399


>gi|153870195|ref|ZP_01999644.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Beggiatoa sp. PS]
 gi|152073336|gb|EDN70353.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Beggiatoa sp. PS]
          Length = 417

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 107/421 (25%), Positives = 180/421 (42%), Gaps = 5/421 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  I +P LS ++ +  L  W KQ G+ +  G+IL EIETDK I+E  +   G + EI
Sbjct: 1   MAIEKIKVPVLSESVADATLLNWQKQPGEAVQEGEILVEIETDKVILEINAPQSGTLTEI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           + P G E +     I  +  ++T    S P+S + +         + P        K   
Sbjct: 61  IKPEG-ELVQSEEIIAILDTNATPTVVSKPVSDKTVTTTVTHLEATPPTKTSPAVRKIAA 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                   +  +      +             D+ T         ++++         S 
Sbjct: 120 EQQLEPAFVPHQGDRVTKADMLQQDSKMSESRDLNTQNVNVYKTTEFTSPAQNTPSSVSK 179

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
           +     L  +   E +P   +RK +A RL  ++          + N+  ++ LR++    
Sbjct: 180 EQPKDTLS-QRPRERVPMTRLRKRVADRLLHAQHEHAILTTFNEINMKAIVDLRQKYKEV 238

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        K+       KA  +A+ + P  N S   + +I H + DI +AVS P G+V
Sbjct: 239 FEKK---HGVKLGFMSFFTKAVVVALQKFPIINASTEGDDIIYHGYYDIGIAVSSPRGLV 295

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            PI+R  +  S  DI   +    +RA+  +L  EE  GGT +I+N G+ G      ++NP
Sbjct: 296 VPILRDVNAMSFSDIEKAIGDFGRRARDVQLSIEELTGGTFTITNGGVFGSMLSTPILNP 355

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL +    ++ V +N ++ +  +M   LS DHR +DG  A + L   K  IE+P  
Sbjct: 356 PQSAILGMHNIVERPVAENGQVVIRPVMYVALSYDHRLIDGRDAVQFLVTIKNVIEDPAR 415

Query: 421 M 421
           +
Sbjct: 416 L 416


>gi|296103344|ref|YP_003613490.1| dihydrolipoamide acetyltransferase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295057803|gb|ADF62541.1| dihydrolipoamide acetyltransferase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 406

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 97/423 (22%), Positives = 176/423 (41%), Gaps = 19/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +G++D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVKRDEVLVEIETDKVVLEVPASADGVLDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    S   S+E      +    S              
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKESSAKSEEKASTPAQRQQASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                           L +     P           L     +                 
Sbjct: 107 --EEQTNDALSPAIRRLLAEHSLDPAAIKGTGVGGRLTREDIDKHLAKAPAQAEAKAPVA 164

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                      S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 165 APAAQPALGARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDA 224

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 225 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 281

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI   +K+LA + +  KL  ++  GG  +I+N G+ G      +INP
Sbjct: 282 TPVLRDVDTLGMADIEKNIKELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINP 341

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 342 PQSAILGMHAIKDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTR 401

Query: 421 MLM 423
           +L+
Sbjct: 402 LLL 404


>gi|291295917|ref|YP_003507315.1| 2-oxoglutarate dehydrogenase E2 subunit, dihydrolipoamide
           succinyltransferase [Meiothermus ruber DSM 1279]
 gi|290470876|gb|ADD28295.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Meiothermus ruber DSM 1279]
          Length = 395

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 110/422 (26%), Positives = 193/422 (45%), Gaps = 29/422 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P++  ++TE ++ +W+K+EGD +   + L E+ TDKA +E  +   G + +IL
Sbjct: 1   MALELKIPAVGESITEVEIGQWLKKEGDTVKVDEPLVELVTDKATLELPAPVAGRLTKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +P+G     V   +  +   + E     P                               
Sbjct: 61  IPSGQ--AKVGDVVALLEEGAAEASSGAPSQSTPAPSQAAATESKVMPAAERL------- 111

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A + G+  SS+ GSGP GR++K D++  ++T       +         +   
Sbjct: 112 --------AAQAGLQASSIPGSGPGGRVLKEDVQRAVTTPPPTPQPTPSAPPAPPVQKG- 162

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                   +   +V+P   +R+ IA RL  +KQ         + ++  ++ LR++     
Sbjct: 163 --------ERREDVVPMTPLRRRIAERLLAAKQNTAMLTTFNEADMSAVMELRKEYGEAF 214

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           Q        K+      +KA   A+ ++P+ N       ++ H++ DI +AV    G+V 
Sbjct: 215 QKK---YGFKLGFMSFFVKAVVQALQEIPQLNAEIRGTDIVYHRYYDIGIAVGGGEGLVV 271

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR AD+ S+  I   +     R +++K+KPEE  GGT +I+N G+ G  +   ++NPP
Sbjct: 272 PVIRDADRLSMAQIEAVIADFGARVREKKIKPEELMGGTFTITNGGIYGSLNSTPILNPP 331

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q  IL + A  ++ V +N  + +  +MN  LS DHR VDG  A   L + KE IENPV +
Sbjct: 332 QVGILGMHAIVERPVAKNGAVVIRPMMNLALSYDHRIVDGREAVTFLKRIKELIENPVRL 391

Query: 422 LM 423
            +
Sbjct: 392 TL 393


>gi|229586422|ref|YP_002844923.1| dihydrolipoamide succinyltransferase [Rickettsia africae ESF-5]
 gi|228021472|gb|ACP53180.1| Dihydrolipoamide acetyltransferase component [Rickettsia africae
           ESF-5]
          Length = 395

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 107/422 (25%), Positives = 178/422 (42%), Gaps = 29/422 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +PSL  ++TE  +AKW K+EGD +   ++L EIET+K  +E  +   G I +I 
Sbjct: 1   MRVKIIVPSLGESITEATIAKWYKKEGDSVKTDELLLEIETEKVTLEVNAPCNGTIGKIS 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G  N+AV   I  I   ++               V +  S    V            
Sbjct: 61  KTDGA-NVAVGEEIGEINEGASANTAGTNNESAKTQAVTQPTSEKPAVANNTL------- 112

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                                        K D   +  T  + +         +   +  
Sbjct: 113 ------------------APSVQKLVTENKLDPNNIKGTGRDGRITKGDVLATINTTTTS 154

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A  ++   ++  + +    +RKTIA RL+ S+ T        + ++  +++LR Q     
Sbjct: 155 APAISKSNEERVQRVRMSRLRKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEF 214

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +      + K+      +KA   A+  +P  N     + ++   + DI VAV    G+V 
Sbjct: 215 EKK---HAVKLGFMSFFVKATIEALKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVV 271

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD+    ++   +  LA++A+  KL   +  GGT SISN G+ G      +INPP
Sbjct: 272 PVVRDADKMGFAEVEKTIGILAKQARDGKLSMADLSGGTFSISNGGVYGSLLSTPIINPP 331

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   E++ V  + +I++  +M   LS DHR +DG      L K K+ IENP  +
Sbjct: 332 QSGILGLHKTEERAVVIDGKIEIRPMMYIALSYDHRIIDGKEGVSFLVKIKQLIENPEKL 391

Query: 422 LM 423
           L+
Sbjct: 392 LL 393


>gi|209520205|ref|ZP_03268976.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia sp. H160]
 gi|209499364|gb|EDZ99448.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia sp. H160]
          Length = 422

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 109/424 (25%), Positives = 191/424 (45%), Gaps = 5/424 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL EIETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           +   G + +  +  I  I  + T    +     +         + ++   V    +    
Sbjct: 61  ISNDG-DTVTADQVIAKIDTEGTAGAAAVEAEVKPAPVAAAAPAPAAQAAVATGSNTAAS 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
            A+       G    D++     G   +          +        +   +   + +  
Sbjct: 120 PAAGKLMAEKGLAAGDVAGTGRDGRITKGDVLTAGAPAAKAAPAPAAAPKAAKPSLPDVK 179

Query: 181 DANILNLFAKDSYE-VIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
                + + KD  E  +P   +R  IA RL +S+QT        + N+  ++ LR +   
Sbjct: 180 APASADQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMDLRNKYKD 239

Query: 240 TLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGI 299
             +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P G+
Sbjct: 240 KFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGL 296

Query: 300 VTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVIN 359
           V PI+R ADQ S+ DI  ++ +  Q+AK  KL  EE  GGT SISN G+ G      +IN
Sbjct: 297 VVPILRNADQLSLADIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIIN 356

Query: 360 PPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPV 419
           PPQS IL + A +++ V +N +I +  +    LS DHR +DG  A   L   K+ +E+P 
Sbjct: 357 PPQSAILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDALEDPA 416

Query: 420 WMLM 423
            +L+
Sbjct: 417 RLLL 420


>gi|83720041|ref|YP_443072.1| dihydrolipoamide succinyltransferase [Burkholderia thailandensis
           E264]
 gi|83653866|gb|ABC37929.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia thailandensis E264]
          Length = 425

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 118/427 (27%), Positives = 201/427 (47%), Gaps = 8/427 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL E+ETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSK-ENIVEVREEHSHSSPVVVREKHSKNR 119
           L   G + +  +  I  I  ++     +      E         + +         + + 
Sbjct: 61  LQNDG-DTVVADQVIATIDTEAKAGAAAAAAGAAEVQPAAAPAAAPAPAAQPAAAAASST 119

Query: 120 PIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDES 179
             ASP A +L  E G+  + ++GSG  GRI K D+ +  S        +  ++       
Sbjct: 120 ASASPAASKLMAEKGLGAADVAGSGRDGRITKGDVLSAGSAPKAAPAAAPAKAAAKPSLP 179

Query: 180 I---DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
                A+          + +P   +R  IA RL +S+QT        + N+  ++ LR +
Sbjct: 180 DVKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAK 239

Query: 237 MNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIP 296
                +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P
Sbjct: 240 YKDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSP 296

Query: 297 GGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCA 356
            G+V PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G      
Sbjct: 297 RGLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTP 356

Query: 357 VINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIE 416
           +INPPQS IL + A +++ V +N +I +  I    LS DHR +DG  A   L   K+ +E
Sbjct: 357 IINPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALE 416

Query: 417 NPVWMLM 423
           +P  +L+
Sbjct: 417 DPARLLL 423


>gi|294677240|ref|YP_003577855.1| pyruvate dehydrogenase complex E2 component
           dihydrolipoyllysine-residue acetyltransferase
           [Rhodobacter capsulatus SB 1003]
 gi|294476060|gb|ADE85448.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoyllysine-residue acetyltransferase
           [Rhodobacter capsulatus SB 1003]
          Length = 418

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 190/422 (45%), Positives = 265/422 (62%), Gaps = 6/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +  G I+ EIETDKA MEFE+VDEG+I ++L
Sbjct: 1   MAVEILMPALSPTMEEGTLAKWLVKEGDAVKSGQIIAEIETDKATMEFEAVDEGVIGKLL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  GT  + VN+ I  ++ +      +P         V      +    V  K +  R  
Sbjct: 61  VAEGTSGVKVNAAIAVLIEEGGSAEVAPVAKAAAPAPVAAPAVATPAAPVVPKAAGARIF 120

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           ASPLARR+A + G+DL+++SGSGPHGRIVK+D+E     K        + +         
Sbjct: 121 ASPLARRIAADKGLDLAAISGSGPHGRIVKADVEG-AVAKPAPAAAPVLVAAPAPAPVSA 179

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A +  L+   +Y  IP D +R+ IA RL ++KQTIPHFY+  +  +D LLS RE++NR L
Sbjct: 180 ATVAKLYEGRAYTEIPLDGMRRVIAARLTEAKQTIPHFYLRREVRLDALLSFREELNRQL 239

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
                    K+SVND I+KA ALA+  +P AN  W  + +++ +  D++VAV+I GG+ T
Sbjct: 240 SAR----GVKLSVNDFIIKASALALQAIPAANAVWAGDRVLQMQASDVAVAVAIEGGLFT 295

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++ AD KS+  +S ++K LA+RA+ RKL P EYQGG+ +ISN+GM+GI SF AVINPP
Sbjct: 296 PVLQDADTKSLSQLSAQMKDLAKRARDRKLAPHEYQGGSFAISNLGMMGIESFDAVINPP 355

Query: 362 QSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
              ILA+GAG KK V   +  I+VAT+M  TLS DHR +DGA+ ++LLA     +ENP+ 
Sbjct: 356 HGAILAVGAGVKKPVVSASGTIEVATMMALTLSVDHRVIDGALGAELLAAIVSNLENPMA 415

Query: 421 ML 422
           ML
Sbjct: 416 ML 417


>gi|114328731|ref|YP_745888.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316905|gb|ABI62965.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Granulibacter
           bethesdensis CGDNIH1]
          Length = 470

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 94/448 (20%), Positives = 180/448 (40%), Gaps = 29/448 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +PSL  ++T   +AKW+K+ GD ++  + + E+ETDK  +E  +   G++    
Sbjct: 24  MPTDIKVPSLGESVTTAVVAKWLKKAGDAVAADEAVVELETDKVTVEVNAPAAGVLSAQF 83

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E ++V + +  +  +      +      +     +E    +      K   N P 
Sbjct: 84  AAEGEE-VSVGAVLGELGAEGDGEGDAASRPAPSAPAPAKEEPVKTEAAANPKSGINPPP 142

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSF-------- 173
                         D+++   +     I ++    L + +  + +     S         
Sbjct: 143 RPSGPVSRPATPPADIAAHPPAVSDPSIRENGPAPLPAAQKMLTENHVDASALGSGSGKD 202

Query: 174 ------------------GLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQT 215
                                  S     +        E +    +R+TIA RL++++ T
Sbjct: 203 GRITKGDVLDFLSRPAAAPSAPVSAQRAPVVAEDAAREERVKMTRLRRTIAQRLKEAQNT 262

Query: 216 IPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVS 275
                   + ++  +++LR++     +        ++      ++A   A+ + P  N  
Sbjct: 263 AAMLTTFNEVDMSAVMALRKEYKDLFEKKHS--GVRLGFMSFFVRACVSALKEFPAVNAE 320

Query: 276 WTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
              + ++    + + +AV    G+V P++R AD      I   V    +RA+   LK +E
Sbjct: 321 IDGDEVVYKNFVHMGIAVGGSNGLVVPVLRDADSLDFAQIEQRVADFGKRARDGALKLDE 380

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSAD 395
             GGT SI+N G+ G      ++NPPQS IL +   + + V  + +I++  +M   LS D
Sbjct: 381 LTGGTFSITNGGVYGSLMSTPILNPPQSGILGMHKIQDRPVVVDGKIEIRPMMYLALSYD 440

Query: 396 HRSVDGAIASKLLAKFKEYIENPVWMLM 423
           HR VDG  A   L + KE IE+P  +L+
Sbjct: 441 HRIVDGKEAVSFLVRVKEGIEDPRRLLL 468


>gi|34580821|ref|ZP_00142301.1| dihydrolipoamide acetyltransferase component [Rickettsia sibirica
           246]
 gi|28262206|gb|EAA25710.1| dihydrolipoamide acetyltransferase component [Rickettsia sibirica
           246]
          Length = 395

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 107/422 (25%), Positives = 179/422 (42%), Gaps = 29/422 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +PSL  ++TE  +AKW K+EGD +   ++L EIET+K  +E  +   G I +I 
Sbjct: 1   MRVKIIVPSLGESITEATIAKWYKKEGDSVKTDELLLEIETEKVTLEVNAPCNGTIGKIS 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G  N+AV   I  I   ++               V +  S    V            
Sbjct: 61  KTDGA-NVAVGEEIGEINEGASANTAGTNNESAKAQAVTQPTSEKPAVANNTL------- 112

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                                        K D   +  T  + +         +   +  
Sbjct: 113 ------------------APSVQKLVTENKLDPNNIKGTGRDGRITKGDVLATINTTTTS 154

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A  ++   ++  + +    +RKTIA RL+ S+ T        + ++  +++LR Q     
Sbjct: 155 APAISKSNEERVQRVRMSRLRKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEF 214

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +      + K+      +KA   A+  +P  N     + ++   + DI VAV    G+V 
Sbjct: 215 EKK---HAVKLGFMSFFVKATIEALKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVV 271

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD+    ++   +  LA++A++ KL   +  GGT SISN G+ G      +INPP
Sbjct: 272 PVVRDADKMGFAEVEKTIGILAKQAREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPP 331

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   E++ V  + +I++  +M   LS DHR +DG      L K K+ IENP  +
Sbjct: 332 QSGILGLHKTEERAVVIDGKIEIRPMMYIALSYDHRIIDGKEGVSFLVKIKQLIENPEKL 391

Query: 422 LM 423
           L+
Sbjct: 392 LL 393


>gi|163802535|ref|ZP_02196427.1| dihydrolipoamide acetyltransferase [Vibrio sp. AND4]
 gi|159173618|gb|EDP58437.1| dihydrolipoamide acetyltransferase [Vibrio sp. AND4]
          Length = 402

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 95/422 (22%), Positives = 182/422 (43%), Gaps = 22/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W KQ GD +   ++L +IETDK ++E  + + G+++ I+
Sbjct: 1   MTIEILVPDLPESVADATVATWHKQPGDVVERDEVLVDIETDKVVLEVPAPEAGVLEAII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     I  +   +    P+   +++      + H  +      +  S     
Sbjct: 61  EEEGA-TVLSKQLIAKLKPGAVAGEPTTDSTEDKQASPDKRHKAALAEESNDSLSPAVRR 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A +          +     +  ++ ++    +                    
Sbjct: 120 LLAEHGLEASQVKGSGVGGRITREDIEVHLANAKSASKAEAPAV---------------- 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
             +    A  S + +P   +RKT+A RL ++K          + N+  ++ LR+Q     
Sbjct: 164 --VEAPAAARSQKRVPMTRLRKTVANRLLEAKNNTAMLTTFNEVNMKPIMDLRKQYKDQF 221

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 222 EER---HGTRLGFMSFYVKAVTEALKRYPEVNASIDGDEIVYHNYFDISMAVSTPRGLVT 278

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D     DI   +K+LA + +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 279 PVLKDCDTLGFADIEKGIKELAIKGRDGKLTVDELMGGNFTITNGGVFGSLMSTPIINPP 338

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 339 QSAILGMHKIQDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARL 398

Query: 422 LM 423
           L+
Sbjct: 399 LL 400


>gi|295676270|ref|YP_003604794.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia sp. CCGE1002]
 gi|295436113|gb|ADG15283.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia sp. CCGE1002]
          Length = 422

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 108/424 (25%), Positives = 190/424 (44%), Gaps = 5/424 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL EIETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           +   G + +  +  I  I  + T    +     +         + ++        +    
Sbjct: 61  ISNDG-DTVTADQVIAKIDTEGTAGAAAVEAEVKPAPVAAAAPAPAAQAATATGSNTAAS 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
            A+       G    D++     G   +          +        +   +   + +  
Sbjct: 120 PAAGKLMAEKGLAAGDVAGTGRDGRITKGDVLTAGAPAAKAAPAPAAAPKAAKPSLPDVK 179

Query: 181 DANILNLFAKDSYE-VIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
                + + KD  E  +P   +R  IA RL +S+QT        + N+  ++ LR +   
Sbjct: 180 APASADQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNKYKD 239

Query: 240 TLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGI 299
             +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P G+
Sbjct: 240 KFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGL 296

Query: 300 VTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVIN 359
           V PI+R ADQ S+ DI  ++ +  Q+AK  KL  EE  GGT SISN G+ G      +IN
Sbjct: 297 VVPILRNADQLSLADIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIIN 356

Query: 360 PPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPV 419
           PPQS IL + A +++ V +N +I +  +    LS DHR +DG  A   L   K+ +E+P 
Sbjct: 357 PPQSAILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDALEDPA 416

Query: 420 WMLM 423
            +L+
Sbjct: 417 RLLL 420


>gi|258542310|ref|YP_003187743.1| dihydrolipoamide acetyltransferase component [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256633388|dbj|BAH99363.1| dihydrolipoamide acetyltransferase component [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256636447|dbj|BAI02416.1| dihydrolipoamide acetyltransferase component [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256639500|dbj|BAI05462.1| dihydrolipoamide acetyltransferase component [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256642556|dbj|BAI08511.1| dihydrolipoamide acetyltransferase component [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256645611|dbj|BAI11559.1| dihydrolipoamide acetyltransferase component [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256648664|dbj|BAI14605.1| dihydrolipoamide acetyltransferase component [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256651717|dbj|BAI17651.1| dihydrolipoamide acetyltransferase component [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256654708|dbj|BAI20635.1| dihydrolipoamide acetyltransferase component [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 414

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 175/422 (41%), Positives = 248/422 (58%), Gaps = 8/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEGKLA+W+K+EGD ++ GD+L EIETDKA ME E+++EGI+  IL
Sbjct: 1   MATEILMPALSPTMTEGKLARWLKKEGDTVNSGDVLAEIETDKATMEVEAIEEGILGRIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +  G E +AVN+PI  ++ +   +P +    K                      +     
Sbjct: 61  IQEGAEGVAVNTPIAILVEEGEAVPDNIDTPKNVASAEPAPVPQPVASAPVAAQAAPAQR 120

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A     R+         +   +     I  +                 +++      S  
Sbjct: 121 ADKPVGRVVASPLARRIARQKNIDLAAIKGTGP-------NGRIVKRDVEAALNKAPSAG 173

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                L A      +PH  +RK IA RL +SK TIPHFYVSID  +D LL+LR Q+N   
Sbjct: 174 QVASALPASGGSSAVPHTTMRKVIARRLSESKATIPHFYVSIDVELDALLALRAQLNAMS 233

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
                + + K+SVND+++KA A+A+ QVPE N S+T +AMI H+  DISVAVS+  G++T
Sbjct: 234 PAEGAD-AFKLSVNDMLIKASAVALKQVPEVNASYTEDAMILHEDADISVAVSLDDGLIT 292

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI++QAD+KS+ DIS E K L  RA+  KLKPEE+QGGT SISNMGM G+  F A++NPP
Sbjct: 293 PIVKQADRKSLKDISQEAKDLIARARAGKLKPEEFQGGTFSISNMGMYGVKDFAAIVNPP 352

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ ILAI AG+K+ V +  E+ +AT+M  TLS DHR VDGA A++ L+ F+  +E+P+ +
Sbjct: 353 QAAILAIAAGKKQAVVKGNELAIATVMTVTLSVDHRVVDGAAAARWLSAFRTAVESPLSL 412

Query: 422 LM 423
           ++
Sbjct: 413 VL 414


>gi|262166196|ref|ZP_06033933.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio mimicus
           VM223]
 gi|262404436|ref|ZP_06080991.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio sp. RC586]
 gi|262025912|gb|EEY44580.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio mimicus
           VM223]
 gi|262349468|gb|EEY98606.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio sp. RC586]
          Length = 404

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 94/422 (22%), Positives = 186/422 (44%), Gaps = 20/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD ++  +++ EIETDK ++E  + + G+++ IL
Sbjct: 1   MTIEILVPDLPESVADATVATWHKRPGDSVARDEVIVEIETDKVVLEVPAPEAGVLEAIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  + + +    P+            + H  S               
Sbjct: 61  EEEGA-TVLSKQLLARLKLGAVAGEPTQDTPDATEPSPDKRHKASL-------------- 105

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A    +       +    ++  S +   I+ +      ++ ++         
Sbjct: 106 --TEESNDALSPAVRRLLAEHNLEAHQVKGSGVGGRITREDIEAHLASNKAKPAAKAEAP 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
              +   A  + + +P   +RK IA RL ++K +        + N+  ++ +R+Q     
Sbjct: 164 VAAIAPVAGRTEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVNMKPIMDMRKQYQDVF 223

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S     ++ H + D+S+AVS P G+VT
Sbjct: 224 EKR---HGIRLGFMSFYVKAVTEALKRYPEVNASIDGEDLVYHNYFDVSIAVSTPRGLVT 280

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D  S+  I   +K+LA++ +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 281 PVLKNCDTLSLAQIEKGIKELAEKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINPP 340

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   + + +  + +I++  +M   LS DHRS+DG  +   L   KE +E+P  +
Sbjct: 341 QAAILGMHKIQDRAMVVDGKIEILPMMYLALSYDHRSIDGRESVGFLVTVKELLEDPARL 400

Query: 422 LM 423
           L+
Sbjct: 401 LL 402


>gi|126735934|ref|ZP_01751678.1| Dihydrolipoamide acetyltransferase, long form [Roseobacter sp.
           CCS2]
 gi|126714491|gb|EBA11358.1| Dihydrolipoamide acetyltransferase, long form [Roseobacter sp.
           CCS2]
          Length = 441

 Score =  294 bits (751), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 181/444 (40%), Positives = 263/444 (59%), Gaps = 27/444 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW  +EGD +S GDI+ EIETDKA MEFE+VDEG++ +I+
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWHVKEGDTVSSGDIMAEIETDKATMEFEAVDEGVMGKIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPS-------------------PPLSKENIVEVREE 102
           V  GTE + VN  I  +L D                             +       R E
Sbjct: 61  VAEGTEGVKVNDVIAVLLEDGESADDIGDVSAKSDDASSNAAPAKASDKTAPEQGYGRGE 120

Query: 103 HSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKT 162
              +      +     R  A+PLARR+A + G+DL+ + GSGPHGRI+K+D+E     + 
Sbjct: 121 TDATPAPASSKGADGKRIFATPLARRIAADKGLDLADIEGSGPHGRIIKADVENAKPGEK 180

Query: 163 NVKDYSTIQSFGLVDESIDAN---ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
                +  ++      +   +   ++  +A   +E +  D +RKTIA RL ++KQ++PHF
Sbjct: 181 PATASAKPEAAATPAMAAGPSTDAVMKTYADRPFEEVQLDGMRKTIAARLTEAKQSVPHF 240

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN 279
           Y+  D  +D LL  R Q+N+ L+        K+SVND I+KA ALA+ Q PEAN  W  +
Sbjct: 241 YLRRDIQLDALLKFRSQLNKQLETR----GVKLSVNDFIIKACALALQQEPEANAVWAGD 296

Query: 280 AMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
             ++ +  D++VAV+I GG+ TP+++ A+ KS+  +S E+K LA RA+ RKL P EY GG
Sbjct: 297 RTLKFEKSDVAVAVAIEGGLFTPVLKDAEMKSLSALSAEMKDLATRARDRKLAPHEYVGG 356

Query: 340 TTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHRS 398
           + +ISN+GM GI++F A+INPP + ILA+GAG KK +   + E+ V T+M+ TLS DHR 
Sbjct: 357 SFAISNLGMFGIDNFDAIINPPHAAILAVGAGTKKPIVGADGELTVGTVMSTTLSVDHRV 416

Query: 399 VDGAIASKLLAKFKEYIENPVWML 422
           +DGA+ + LL   K+ +ENP+ ML
Sbjct: 417 IDGALGANLLNAIKDNLENPMTML 440


>gi|82751004|ref|YP_416745.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus RF122]
 gi|123549164|sp|Q2YY06|ODO2_STAAB RecName: Full=Dihydrolipoyllysine-residue succinyltransferase
           component of 2-oxoglutarate dehydrogenase complex;
           AltName: Full=2-oxoglutarate dehydrogenase complex
           component E2; Short=OGDC-E2; AltName:
           Full=Dihydrolipoamide succinyltransferase component of
           2-oxoglutarate dehydrogenase complex
 gi|82656535|emb|CAI80957.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus RF122]
          Length = 422

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 94/421 (22%), Positives = 172/421 (40%), Gaps = 5/421 (1%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            + +P L+ ++TEG +A+W+K  GD +  G+ + E+ETDK  +E  S + G++ E L   
Sbjct: 3   EVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLASE 62

Query: 65  GTENIAVNSPILNI-LMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIAS 123
           G + + V   I  I          +   +     E        +     +    N+    
Sbjct: 63  G-DTVEVGQAIAVIGEGSGNASKENSNDNTPQQNEETNNKKEETTNKSADNAEVNQTNDY 121

Query: 124 PLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDAN 183
              R  A       +  +G        K++           +             + +  
Sbjct: 122 NQQRVNATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQAPAKEEK 181

Query: 184 ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQF 243
             N +             +KT A +L +            + ++ N++ LR++       
Sbjct: 182 KYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFMK 241

Query: 244 HREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPI 303
             +    K+       KA   A+ + PE N     + MI  ++ DI VAVS   G++ P 
Sbjct: 242 DHD--GTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPF 299

Query: 304 IRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQS 363
           +R  D+K+  +I  E+  LA +A+++KL  ++   G+ +I+N G+ G      +IN  Q+
Sbjct: 300 VRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQA 359

Query: 364 TILAIGAGEKKVVFQN-EEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
            IL + +   + +  + + I+   +M   LS DHR +DG  A   L   KE IENP  +L
Sbjct: 360 AILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLL 419

Query: 423 M 423
           +
Sbjct: 420 L 420


>gi|262276213|ref|ZP_06054022.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Grimontia hollisae
           CIP 101886]
 gi|262220021|gb|EEY71337.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Grimontia hollisae
           CIP 101886]
          Length = 404

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 97/422 (22%), Positives = 183/422 (43%), Gaps = 20/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W KQ GD +S  ++L +IETDK ++E  + D+GI++ I+
Sbjct: 1   MTIEILVPDLPESVADATVATWHKQPGDAVSRDEVLVDIETDKVVLEVPAPDDGILEAII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  I   +    P+      +     + H+ S               
Sbjct: 61  EEEGA-TVLSKQLLAKIKPGAVAGEPTQDAPASSEASPDKRHTASL-------------- 105

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A    +            +I  + +   I+ +          +         
Sbjct: 106 --TEESNDALSPAVRRLLAENDLTPDQIKGTGVGGRITREDVDGFLKNGGAKAAPAPVAA 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                     S + +P   +RK +A RL ++K +        + N+  ++ +R+Q     
Sbjct: 164 KEETPALGHRSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDIRKQYKDVF 223

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H   D+S+AVS P G+VT
Sbjct: 224 EER---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDIVYHNFFDVSMAVSTPRGLVT 280

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ +I   +K+LA + +  KL  EE  GG  +I+N G+ G      +INPP
Sbjct: 281 PVLRDCDRLSLAEIEKGIKELAIKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPP 340

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   +++ +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 341 QAAILGMHKIQERPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTVKELLEDPTRL 400

Query: 422 LM 423
           L+
Sbjct: 401 LL 402


>gi|238027575|ref|YP_002911806.1| dihydrolipoamide succinyltransferase [Burkholderia glumae BGR1]
 gi|237876769|gb|ACR29102.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia glumae BGR1]
          Length = 423

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 109/425 (25%), Positives = 189/425 (44%), Gaps = 6/425 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL E+ETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLSQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G + +  +  I  I  ++     +    K  +       + +           +  
Sbjct: 61  LQNDG-DTVLADQVIATIDTEAKAGAVAAAAGKAEVQPAAAPVAVAPAAQPAAAAGSSHA 119

Query: 121 IASPLARRLAGEHGIDLS--SLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDE 178
            +   A+ LA +             G   +          +        +  +   L D 
Sbjct: 120 ASPAAAKLLAEKGVDASQVAGTGRDGRITKGDALAANAAPAKAAAAPAAAAPKKAALPDV 179

Query: 179 SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMN 238
            + A+          + +P   +R  IA RL +S+QT        + N+  ++ LR +  
Sbjct: 180 KVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKYK 239

Query: 239 RTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGG 298
              +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P G
Sbjct: 240 DKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRG 296

Query: 299 IVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVI 358
           +V PI+R ADQ S+ DI  ++ +  Q+AK  KL  EE  GGT SISN G+ G      +I
Sbjct: 297 LVVPILRNADQLSLADIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPII 356

Query: 359 NPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENP 418
           NPPQS IL + A +++ V +N +I +  I    LS DHR +DG  A   L   K+ +E+P
Sbjct: 357 NPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDP 416

Query: 419 VWMLM 423
             +L+
Sbjct: 417 ARLLL 421


>gi|206559882|ref|YP_002230646.1| dihydrolipoamide succinyltransferase [Burkholderia cenocepacia
           J2315]
 gi|198035923|emb|CAR51815.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Burkholderia cenocepacia J2315]
          Length = 425

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 116/427 (27%), Positives = 198/427 (46%), Gaps = 8/427 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL E+ETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G + +  +  I  I  ++             +       + +         + +  
Sbjct: 61  LQNDG-DTVVADQIIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAAPAAQPAAATASSSA 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDE-- 178
            ASP A +L  E G+    ++GSG  GR+ K D     S        +  ++        
Sbjct: 120 AASPAAAKLLAEKGLSTGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKTAAAKPSLP 179

Query: 179 --SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
              + A+          + +P   +R  IA RL +S+QT        + N+  ++ LR +
Sbjct: 180 EVKVPASAATWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNK 239

Query: 237 MNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIP 296
                +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P
Sbjct: 240 YKDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSP 296

Query: 297 GGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCA 356
            G+V PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G      
Sbjct: 297 RGLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTP 356

Query: 357 VINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIE 416
           +INPPQS IL + A +++ V +N +I +  I    LS DHR +DG  A   L   K+ +E
Sbjct: 357 IINPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALE 416

Query: 417 NPVWMLM 423
           +P  +L+
Sbjct: 417 DPARLLL 423


>gi|260776538|ref|ZP_05885433.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607761|gb|EEX34026.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 401

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 97/422 (22%), Positives = 182/422 (43%), Gaps = 23/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W KQ GD +   ++L +IETDK ++E  + + G+++ I+
Sbjct: 1   MTIEILVPDLPESVADATVATWHKQPGDAVERDEVLVDIETDKVVLEVPAPEAGVLEAII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     I  +   +    P+   ++E      + H  S      +  S     
Sbjct: 61  EEEGA-TVLSKQLIAKLKPGAVAGEPTKDTTEEAEASPDKRHKASLSEESNDALSPAVRR 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A +                        +    T     + + +     ++  
Sbjct: 120 LLAEHNLEASQ-------------------VKGTGVGGRITREDIEAHLANAKAAPKADA 160

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                  A  S + +P   +RKT+A RL ++K          + N+  ++ LR+Q     
Sbjct: 161 PVAEAPAAARSQKRVPMTRLRKTVANRLLEAKNNTAMLTTFNEVNMKPIMDLRKQYKDQF 220

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 221 EER---HGIRLGFMSFYVKAVTEALKRYPEVNASIDGDDIVYHNYFDISMAVSTPRGLVT 277

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D     D+   +K+LA + +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 278 PVLKDCDTLGFADVEKGIKELAIKGRDGKLTVDELMGGNFTITNGGVFGSLMSTPIINPP 337

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 338 QSAILGMHKIQERPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARL 397

Query: 422 LM 423
           L+
Sbjct: 398 LL 399


>gi|297530808|ref|YP_003672083.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Geobacillus sp. C56-T3]
 gi|297254060|gb|ADI27506.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Geobacillus sp. C56-T3]
          Length = 420

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 99/423 (23%), Positives = 175/423 (41%), Gaps = 6/423 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L+ ++TEG +A+W+K+ GD +  G+ +CE+ETDK  +E  + + G++ ++L
Sbjct: 1   MA-EIKVPELAESITEGTIAQWLKKPGDYVEKGESICELETDKVNVEIMAEESGVLQQLL 59

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + +AV   I  I   +     +   + +   E        S      +       
Sbjct: 60  ANEG-DTVAVGQAIAIIGEGAAAPTAALQAAPQTADETETVAPADSNEQPAPQPVAVAQA 118

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            S           +                          +     +             
Sbjct: 119 PSQRPIASPAARKMAREKGIDLTQVPTADPLGRVRKQDVASFAAQPAAAPQPAPQASPTP 178

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A +    A            R+TIA RL +  QT        + ++  ++ LR++     
Sbjct: 179 AAVPAAEAGKPVIREKMSRRRQTIAKRLLEVTQTTAMLTTFNEIDMSAVIDLRKRKKDKF 238

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
                    ++      +KA   A+ + P  N     + ++  K+ DI VAVS   G+V 
Sbjct: 239 FEE---HDVRLGFMSFFVKAAVAALKKYPYVNAEIQGDEILLKKYYDIGVAVSTDEGLVV 295

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+K+  +I  ++ +LA +A+  KL   + QGGT +I+N G+ G      ++N P
Sbjct: 296 PVVRDCDRKNFAEIERDIAELATKARSNKLSLADLQGGTFTITNGGVFGSLLSTPLLNGP 355

Query: 362 QSTILAIGAGEKKVVFQNEE-IKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           Q  IL + + + + V  +EE I+   +M   LS DHR +DG  A   L   K+ IENP  
Sbjct: 356 QVGILGMHSIKLRPVAVDEERIENRPMMYVALSYDHRIIDGKEAVGFLKTVKDLIENPED 415

Query: 421 MLM 423
           +L+
Sbjct: 416 LLL 418


>gi|89054179|ref|YP_509630.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Jannaschia
           sp. CCS1]
 gi|88863728|gb|ABD54605.1| Dihydrolipoamide acetyltransferase long form [Jannaschia sp. CCS1]
          Length = 441

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 189/444 (42%), Positives = 267/444 (60%), Gaps = 27/444 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + MP+LSPTM EG LAKW+ +EGD ++ GD+L EIETDKA MEFE+VDEGII +IL
Sbjct: 1   MPIELLMPALSPTMEEGTLAKWLVKEGDTVNSGDLLAEIETDKATMEFEAVDEGIIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKN--- 118
           VP GTEN+ VN+ I  I  +  +   +P    E+                    +     
Sbjct: 61  VPEGTENVKVNTAIALIGEEGDDFSAAPAAPAEDAAAEEASPEAEEVTPSEAAPAAASSA 120

Query: 119 ----------RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYS 168
                     R  ASPLARR+A + G+DLS + GSGPHGRIVK D+E   +   +    +
Sbjct: 121 PAAPVTKDGGRIFASPLARRIAKDKGLDLSQIKGSGPHGRIVKVDVEGASAAPKSEAPTA 180

Query: 169 TIQSFGLVDE---------SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
             ++                    +L ++    +E +  + +RKT+A RL ++KQTIPHF
Sbjct: 181 KSEAPKAAAPAGGGAMPTGPSAEQVLKMYEGREFEEVKLNGMRKTVAARLTEAKQTIPHF 240

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN 279
           Y+  D  +D LL  R Q+N+ L+        K+SVND ++KA ALA+  VP+AN  W  +
Sbjct: 241 YLRRDIQLDALLKFRSQLNKQLEGR----GVKLSVNDFVIKACALALQAVPDANAVWAGD 296

Query: 280 AMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
            MI+ K  D++VAV++ GG+ TP+++ +D KS+  +S E+K LA RA+  KL P EY GG
Sbjct: 297 RMIKLKPSDVAVAVAVDGGLFTPVLKDSDSKSLSALSAEMKDLATRARDGKLAPHEYVGG 356

Query: 340 TTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHRS 398
           + +ISN+GM+GI +F AVINPP   ILA+GAG KK V   + E+ VAT+M+ TLS DHR 
Sbjct: 357 SFAISNLGMMGIENFDAVINPPHGAILAVGAGVKKPVVGADGELAVATVMSTTLSVDHRV 416

Query: 399 VDGAIASKLLAKFKEYIENPVWML 422
           +DGA+ ++LLA  K+ +ENP+ ML
Sbjct: 417 IDGALGAELLAAIKDNLENPMVML 440


>gi|15602143|ref|NP_245215.1| hypothetical protein PM0278 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720509|gb|AAK02362.1| SucB [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 404

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 103/423 (24%), Positives = 181/423 (42%), Gaps = 21/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I  P L  ++ +  +  W K+ GD +   +IL EIETDK ++E  +  +G+++ I
Sbjct: 1   MSNFEIITPDLPESVADATVVTWHKKVGDVVKRDEILVEIETDKVVLEVPAQSDGVLEAI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           +   G   I+    +  +   +     +            + H  +         S +  
Sbjct: 61  IEAEGATVISK-QLLGKLSATAVAGGVTKETVVTQEPTPADRHHANLSTESVGSDSVSPG 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           +   +A        I  S + G      + K   +                       + 
Sbjct: 120 VRRLIAEHDLNAEDIKGSGVGGRITREDVEKVIAQKANKA-----------------PNK 162

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
            A    +      + +P   +RK IA RL ++K +        + ++  ++ LR+     
Sbjct: 163 PAEPAFVVGNREEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMAPIMKLRKTYGEK 222

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + +I H + DIS+AVS P G+V
Sbjct: 223 FEKQ---HGTRLGFMSFYIKAVVEALKRYPEVNASIDGDDIIYHNYFDISIAVSTPRGLV 279

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D+ S++DI  E+K LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 280 TPVLRNCDKLSMVDIEKEIKALADKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 339

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + V  N E+ +  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 340 PQSAILGMHAIKDRPVAVNGEVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 399

Query: 421 MLM 423
           +L+
Sbjct: 400 LLL 402


>gi|197284467|ref|YP_002150339.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Proteus mirabilis HI4320]
 gi|194681954|emb|CAR41368.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Proteus mirabilis HI4320]
          Length = 402

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 108/424 (25%), Positives = 183/424 (43%), Gaps = 25/424 (5%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD I   ++L EIETDK ++E  + + G++D I
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDSIQRDEVLVEIETDKVVLEVPASEAGVLDSI 60

Query: 61  LVPAGTENIAVNSPILNI-LMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNR 119
           L   G   +     +  I L DST IP     +++     R+     +           R
Sbjct: 61  LEEEGA-TVGSRQLLGRIRLGDSTGIPADVKPAQDTTPAQRQSADIVAKESNDALSPTAR 119

Query: 120 PIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDES 179
            + +      A   G  +            V ++                         +
Sbjct: 120 RLVAEHDINPADVKGSGVGGRLTRQDIESHVANNKSAA--------------------AA 159

Query: 180 IDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
                    +  S + +P   +RK +A RL ++K T        + N+  + +LR Q   
Sbjct: 160 TAEVSQAPLSHRSEKRVPMTRLRKRVAERLLEAKNTTAMLTTFNEINMQPIKNLRAQYGE 219

Query: 240 TLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGI 299
             +        ++      +KA   A+ + PE N S     ++ H + DIS+AVS P G+
Sbjct: 220 AFEKR---HGVRLGFMSFYIKAVVEALKRYPEVNASIDGTDVVYHNYFDISIAVSTPRGL 276

Query: 300 VTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVIN 359
           VTP++R AD  S+ DI   +K LA + +  KL  E+  GG  +I+N G+ G      +IN
Sbjct: 277 VTPVLRDADAMSMADIEKNIKALAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIIN 336

Query: 360 PPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPV 419
           PPQS IL + A + + +  + ++ +  +M   LS DHR +DG  +   L   KE +E+P 
Sbjct: 337 PPQSAILGMHAIKDRPMAVDGQVVILPMMYLALSYDHRLIDGRESVGFLVTVKEMLEDPA 396

Query: 420 WMLM 423
            +L+
Sbjct: 397 RLLL 400


>gi|300312272|ref|YP_003776364.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex protein [Herbaspirillum
           seropedicae SmR1]
 gi|124483588|emb|CAM32667.1| Dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex protein [Herbaspirillum
           seropedicae]
 gi|300075057|gb|ADJ64456.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex protein [Herbaspirillum
           seropedicae SmR1]
          Length = 413

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 111/423 (26%), Positives = 184/423 (43%), Gaps = 12/423 (2%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    + +P LS ++ E  L +W K+ G+ +S  + L +IETDK ++E  S D G+I +I
Sbjct: 1   MAQIEVKVPQLSESVAEATLLQWHKKVGEPVSRDENLIDIETDKVVLELPSPDAGVITQI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           +   G   +     I  +  D++       +      +   E +  +   +  K      
Sbjct: 61  IKADGA-TVVAGEVIAILDTDASAQVAPTEVKAAPAPQATNEPTPVAAPELASK------ 113

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
               +A   A +   D +  +             +  +    +    +   +       +
Sbjct: 114 --GDVAMPAAAKLLADNNLSTSQVTGTGKDGRVTKGDVLGALSAPAAAPAAAAKPALAQV 171

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
            A +         + +P   +R  +A RL QS+ T        + N+  ++ LR +    
Sbjct: 172 AAPVKAGLESRPEQRVPMSRLRARVAERLVQSQSTNAILTTFNEINMQPVIDLRNKYKDK 231

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        K+      +KA   A+ + P  N S   N ++ H + DI VAV  P G+V
Sbjct: 232 FEKE---HGVKLGFMSFFVKAVVHALKKYPIVNASVDGNDIVYHGYFDIGVAVGSPRGLV 288

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            PI+R ADQ SI DI  ++ +  Q+AK  KL  EE  GGT ++SN G  G      +INP
Sbjct: 289 VPILRDADQMSIADIEKKIGEFGQKAKDGKLSIEELSGGTFTVSNGGTFGSMLSTPIINP 348

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL I A +++ V +N ++ V  I    LS DHR +DG  A   L   KE +E+P  
Sbjct: 349 PQSAILGIHATKERAVVENGQVVVRPINYFALSYDHRIIDGREAVLSLVAIKEALEDPAR 408

Query: 421 MLM 423
           +L+
Sbjct: 409 LLL 411


>gi|328951362|ref|YP_004368697.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Marinithermus hydrothermalis DSM
           14884]
 gi|328451686|gb|AEB12587.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Marinithermus hydrothermalis DSM
           14884]
          Length = 422

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 109/424 (25%), Positives = 197/424 (46%), Gaps = 6/424 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P    ++ E ++ +W+K EG+++   + + E+ TDKA ME  +   G++ ++L
Sbjct: 1   MAIEIRVPEAGESIVEVEVGEWLKAEGERVEKDEPIVELVTDKATMELPAPAAGVLGKVL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVR--EKHSKNR 119
            P+G   + V   I  +  +     P  P+ +    + + E +     V     +     
Sbjct: 61  KPSGA-LVKVGEVIAYLETEGAAAAPKAPVQEPAAAQPQPEAAREEVPVAPAARRLMAEH 119

Query: 120 PIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDES 179
            ++    +       I    +  +    +   S  E   +     +     +       +
Sbjct: 120 GLSPRDVKGSGPGGRILKEDVLRAIEAKKARPSAPEPAPAPAPTPQPAPAPRQAPPPPPA 179

Query: 180 IDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
             A           E +P   +R+ IA RL +++QT+       + ++  +L+LR ++  
Sbjct: 180 PAAPAGYDAPWRYEEAVPMSPLRRRIAQRLVEAQQTMAMLTTFNEADMSAVLALRRELGE 239

Query: 240 TLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGI 299
             +        K+ +    +KA   A+ ++PE N     N +I  ++ DI +A+ +   +
Sbjct: 240 RFKEK---YGVKLGIMSFFVKAVIQALKEIPELNAEIRDNHIIYKRYYDIGIAIGVGEAL 296

Query: 300 VTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVIN 359
           V P++R AD+ S  DI   +   A+RA+ +KL+PEE QGGT SI+N G+ G  +   +IN
Sbjct: 297 VVPVLRDADRMSFADIERAIADFAERARAKKLRPEELQGGTFSITNGGVFGSLNSTPIIN 356

Query: 360 PPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPV 419
           PPQ  IL + A +++ V +N EI +  +MN  LS DHR VDG  A   L + KE IENP 
Sbjct: 357 PPQVGILGMHAIQERPVGRNGEIVLRPMMNLALSYDHRIVDGREAVTFLRRVKECIENPA 416

Query: 420 WMLM 423
            +L+
Sbjct: 417 RLLI 420


>gi|302333025|gb|ADL23218.1| dihydrolipoamide succinyltransferase E2 component of 2-oxoglutarate
           dehydrogenase complex [Staphylococcus aureus subsp.
           aureus JKD6159]
          Length = 422

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 94/421 (22%), Positives = 172/421 (40%), Gaps = 5/421 (1%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            + +P L+ ++TEG +A+W+K  GD +  G+ + E+ETDK  +E  S + G++ E L   
Sbjct: 3   EVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLASE 62

Query: 65  GTENIAVNSPILNI-LMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIAS 123
           G + + V   I  I          +   +     E        +     +    N+    
Sbjct: 63  G-DTVEVGQAIAVIGEGSGNASKENSNDNTPQQNEETNNKKEETTNKSADNAEVNQTNDD 121

Query: 124 PLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDAN 183
              R  A       +  +G        K++           +             + +  
Sbjct: 122 NQQRVNATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQAPAKEEK 181

Query: 184 ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQF 243
             N +             +KT A +L +            + ++ N++ LR++       
Sbjct: 182 KYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKDQFMK 241

Query: 244 HREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPI 303
             +    K+       KA   A+ + PE N     + MI  ++ DI VAVS   G++ P 
Sbjct: 242 DHD--GTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPF 299

Query: 304 IRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQS 363
           +R  D+K+  +I  E+  LA +A+++KL  ++   G+ +I+N G+ G      +IN  Q+
Sbjct: 300 VRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQA 359

Query: 364 TILAIGAGEKKVVFQN-EEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
            IL + +   + +  + + I+   +M   LS DHR +DG  A   L   KE IENP  +L
Sbjct: 360 AILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLL 419

Query: 423 M 423
           +
Sbjct: 420 L 420


>gi|157803371|ref|YP_001491920.1| dihydrolipoamide succinyltransferase [Rickettsia canadensis str.
           McKiel]
 gi|157784634|gb|ABV73135.1| dihydrolipoamide acetyltransferase [Rickettsia canadensis str.
           McKiel]
          Length = 401

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 109/422 (25%), Positives = 178/422 (42%), Gaps = 23/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +PSL  ++TE  +AKW K+EGD +   D+L EIET+K  +E  +   G I +IL
Sbjct: 1   MSIKIIVPSLGESVTEATIAKWYKKEGDSVKTDDLLLEIETEKVTLEVNAPCNGTIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G  N+ V   I  I   +            N     +  S          ++   P 
Sbjct: 61  KTDGA-NVEVGEEIGEINEGAVANTAGTNNESANSQAATQPTSEKPIEKPAVANNTLAPS 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              L      +      +          V   + T  +  T                   
Sbjct: 120 VQKLVTENKLDPNNIKGTGRDGRITKGDVLETLNTPPAATTAPAM--------------- 164

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
               +   +D  + +    +RKTIA RL+ S+ T        + ++  +++LR Q     
Sbjct: 165 ----SKANEDRVQRVRMSRLRKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEF 220

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +      + K+      +KA   A+  +P  N     N ++   + DI VAV    G+V 
Sbjct: 221 EKK---HAVKLGFMSFFVKATIEALKLIPSVNAEIDGNDLVYKNYYDIGVAVGTELGLVV 277

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD+    ++   +  LA++A++ KL   +  GGT SISN G+ G      +INPP
Sbjct: 278 PVVRGADKMEFAEVEKAIGTLAKKAREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPP 337

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   E++ V  + +I+V  +M   LS DHR +DG      L K K+ IE+P  +
Sbjct: 338 QAGILGLHKTEERPVVIDGKIEVRPMMYIALSYDHRIIDGKEGVSFLIKIKQLIEHPEKL 397

Query: 422 LM 423
           L+
Sbjct: 398 LL 399


>gi|121997876|ref|YP_001002663.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Halorhodospira halophila SL1]
 gi|121589281|gb|ABM61861.1| 2-oxoglutarate dehydrogenase E2 component [Halorhodospira halophila
           SL1]
          Length = 429

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 105/431 (24%), Positives = 195/431 (45%), Gaps = 13/431 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  +++E  +  W KQ G+ ++    L ++ETDK ++E  +  +G+++ I 
Sbjct: 1   MSVEIKVPALPESVSEATVVAWHKQPGEAVTQDQNLVDLETDKVVLEVPAPADGVLEAID 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + +  +  +  +   +         +        E    S+              
Sbjct: 61  RAVG-DTVTPDDVLGRVEAGAAPAAEVASAAAAGGQASAESAPGSAGDAASGAAPPAAEA 119

Query: 122 ASPLA---------RRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQS 172
            +P A         RRL  EHG+D + +  S   GR+ K D+   +  +   +   T  +
Sbjct: 120 PAPAASLDGLSPAVRRLVREHGLDPAQIESSSGDGRLTKEDVLRHLERRAEAEAAPTAAT 179

Query: 173 FGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232
                 + ++           + +P   +R+ IA RL +++Q         + N+  ++ 
Sbjct: 180 APQSAPAEESAAAAPLGGRPEQRVPMTRLRQRIAERLVEAQQNAAMLTTFNEVNMQPVMD 239

Query: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVA 292
           LR +     +        ++      +KA   A+ + P  N S     +I H + DI +A
Sbjct: 240 LRARYRERFEKA---HDVRLGFMSFFVKAAVEALKRYPAVNASIDGQDIIYHGYYDIGIA 296

Query: 293 VSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGIN 352
           VS P G+V P++R AD+ S  +I  ++ +L +RA+Q KL  +E  GGT +++N G+ G  
Sbjct: 297 VSSPRGLVVPVLRDADRLSFAEIEAQINELGKRAQQGKLSMDELTGGTFTVTNGGIFGSL 356

Query: 353 SFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFK 412
               +INPPQS IL +   +++ V ++ EI V  +M    + DHR +DG  A + L   K
Sbjct: 357 LSTPIINPPQSGILGMHKIQERPVVEDGEIVVRPMMYLAHTYDHRLIDGREAVQFLVTIK 416

Query: 413 EYIENPVWMLM 423
           + IE+P  +L+
Sbjct: 417 DCIEDPARLLL 427


>gi|115351444|ref|YP_773283.1| dihydrolipoamide succinyltransferase [Burkholderia ambifaria AMMD]
 gi|172060483|ref|YP_001808135.1| dihydrolipoamide succinyltransferase [Burkholderia ambifaria
           MC40-6]
 gi|115281432|gb|ABI86949.1| 2-oxoglutarate dehydrogenase E2 component [Burkholderia ambifaria
           AMMD]
 gi|171993000|gb|ACB63919.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia ambifaria MC40-6]
          Length = 425

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 116/427 (27%), Positives = 198/427 (46%), Gaps = 8/427 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL E+ETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G + +  +  I  I  ++             +       + +         + +  
Sbjct: 61  LQNDG-DTVVADQIIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAAPAAQPAAAVASSSA 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDE-- 178
            ASP A +L  E G+    ++GSG  GR+ K D     S        +  ++        
Sbjct: 120 AASPAASKLLAEKGLSAGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKTAAAKPALP 179

Query: 179 --SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
              + A+          + +P   +R  IA RL +S+QT        + N+  ++ LR +
Sbjct: 180 EVKVPASAATWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNK 239

Query: 237 MNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIP 296
                +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P
Sbjct: 240 YKDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSP 296

Query: 297 GGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCA 356
            G+V PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G      
Sbjct: 297 RGLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTP 356

Query: 357 VINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIE 416
           +INPPQS IL + A +++ V +N +I +  I    LS DHR +DG  A   L   K+ +E
Sbjct: 357 IINPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALE 416

Query: 417 NPVWMLM 423
           +P  +L+
Sbjct: 417 DPARLLL 423


>gi|49474813|ref|YP_032855.1| dihydrolipoamide acetyltransferase [Bartonella quintana str.
           Toulouse]
 gi|81827573|sp|Q6FYD4|ODO2_BARQU RecName: Full=Dihydrolipoyllysine-residue succinyltransferase
           component of 2-oxoglutarate dehydrogenase complex;
           AltName: Full=2-oxoglutarate dehydrogenase complex
           component E2; Short=OGDC-E2; AltName:
           Full=Dihydrolipoamide succinyltransferase component of
           2-oxoglutarate dehydrogenase complex
 gi|49240317|emb|CAF26799.1| Dihydrolipoamide succinyltransferase [Bartonella quintana str.
           Toulouse]
          Length = 410

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 95/422 (22%), Positives = 179/422 (42%), Gaps = 14/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW K+ G+ ++  + L E+ETDK  +E  S   G + EI+
Sbjct: 1   MTTGIRVPTLGESVTEATIGKWFKKLGEAVAVDEPLVELETDKVTVEVPSPVMGKLTEII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + VN+ +  +   +  I  S   S                     + S +   
Sbjct: 61  AKEG-DIVEVNAVLGFVESGAAGISQSFSPSAT----------SIPEAPSELEQSPSSSA 109

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A      ++  + +           + L           T  S  +   +  
Sbjct: 110 TPSGTMPPAPSAAKLMAENNIAKSDISGSGKRGQILKEDVLGALAQGTKASTSVATLTAS 169

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           ++      +   E +    +R+TIA RL+ ++ T        + ++  ++ LR++     
Sbjct: 170 SSSAAPIQEMREERVRMTKLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMDLRKRYKDLF 229

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA   A+ + P  N       ++   +++  +AV    G+V 
Sbjct: 230 EKK---HGVKLGFMGFFTKAVCHALKEFPTVNAEIDGTDIVYKNYVNAGIAVGTDKGLVV 286

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ S+ +I  E+ +L + A+  KL   + QGGT +I+N G+ G      ++N P
Sbjct: 287 PVVRDADQMSLAEIEKEISRLGRLARDGKLAVSDMQGGTFTITNGGVYGSLMSTPILNAP 346

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +    +I +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 347 QSGILGMHAIKERAMVVGGQIIICPMMYLALSYDHRIVDGQEAVTFLVRVKESLEDPERL 406

Query: 422 LM 423
           ++
Sbjct: 407 VL 408


>gi|299067322|emb|CBJ38519.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Ralstonia
           solanacearum CMR15]
          Length = 425

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 115/424 (27%), Positives = 191/424 (45%), Gaps = 9/424 (2%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P  S ++ EG L  W K+ G+ ++  ++L EIETDK ++E  +   G++ E+
Sbjct: 8   MAIVDVKVPQFSESVEEGTLISWKKKPGEAVAVDEVLVEIETDKVVLEVPAPSAGVLAEV 67

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           LV  G   +     +  I  +      +P  +             ++             
Sbjct: 68  LVADGA-TVTSEQLLAKIDTEGKAGAAAPAAAAPAPAAAAPAPVAAASAAAAATGGVAM- 125

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
              P A +L  E  +    ++G+G  GRI K D+   ++        +  Q+     + +
Sbjct: 126 ---PSAAKLMAEANLSAGQVAGTGRDGRITKGDVLGAVAGGAKPAPAAAPQAARPALQQV 182

Query: 181 DANI-LNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
            A +          E +P   +R  IA RL QS+ T        + N+  ++ LR +   
Sbjct: 183 AAPVDFAALGDRPEERVPMSRLRARIAERLVQSQSTNAILTTFNEVNMKPVMDLRAKFKD 242

Query: 240 TLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGI 299
             +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P G+
Sbjct: 243 QFEKT---HGVKLGFMSFFVKAAVHALKKYPVINASVDGNDIVYHGYFDIGIAVGSPRGL 299

Query: 300 VTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVIN 359
           V PI+R ADQ S+ DI  ++ +  Q+AK  KL  ++  GGT SISN G  G      +IN
Sbjct: 300 VVPILRNADQMSLADIEKKIAEFGQKAKDGKLTLDDLTGGTFSISNGGTFGSMLSTPIIN 359

Query: 360 PPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPV 419
           PPQS IL + A + + V +N ++ V  +    +S DHR +DG  A   L   KE +E+P 
Sbjct: 360 PPQSAILGVHATKDRAVVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPA 419

Query: 420 WMLM 423
            +L+
Sbjct: 420 RLLL 423


>gi|298694707|gb|ADI97929.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus ED133]
          Length = 422

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 94/421 (22%), Positives = 172/421 (40%), Gaps = 5/421 (1%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            + +P L+ ++TEG +A+W+K  GD +  G+ + E+ETDK  +E  S + G++ E L   
Sbjct: 3   EVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLASE 62

Query: 65  GTENIAVNSPILNILMD-STEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIAS 123
           G + + V   I  I          +   +     E        +     +    N+    
Sbjct: 63  G-DTVEVGQAIAVIGEGSGNASKENSNDNTPQQNEETNNKKEETTNKSADNAEVNQTNDD 121

Query: 124 PLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDAN 183
              R  A       +  +G        K++           +             + +  
Sbjct: 122 NQQRVNATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQAPAKEEK 181

Query: 184 ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQF 243
             N +             +KT A +L +            + ++ N++ LR++       
Sbjct: 182 KYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFMK 241

Query: 244 HREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPI 303
             +    K+       KA   A+ + PE N     + MI  ++ DI VAVS   G++ P 
Sbjct: 242 DHD--GTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPF 299

Query: 304 IRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQS 363
           +R  D+K+  +I  E+  LA +A+++KL  ++   G+ +I+N G+ G      +IN  Q+
Sbjct: 300 VRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQA 359

Query: 364 TILAIGAGEKKVVFQN-EEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
            IL + +   + +  + + I+   +M   LS DHR +DG  A   L   KE IENP  +L
Sbjct: 360 AILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLL 419

Query: 423 M 423
           +
Sbjct: 420 L 420


>gi|56697105|ref|YP_167468.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Ruegeria
           pomeroyi DSS-3]
 gi|56678842|gb|AAV95508.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Ruegeria pomeroyi DSS-3]
          Length = 437

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 185/440 (42%), Positives = 269/440 (61%), Gaps = 23/440 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+VDEGI+ +IL
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWLVKEGDSVSSGDLLAEIETDKATMEFEAVDEGIVGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEI-------------PPSPPLSKENIVEVREEHSHSSP 108
           VP GTE + VN+PI  +L +                   +P  +           + ++ 
Sbjct: 61  VPEGTEGVKVNTPIAVLLDEGESAGDIASASSGATAPSSAPAAASAEKAPQGAAEAPAAA 120

Query: 109 VVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYS 168
               +     R  ASPLARR+A + G+DLS ++GSGPHGRIVK+D+    +        +
Sbjct: 121 PAAPKAADGARVFASPLARRIAADKGLDLSQIAGSGPHGRIVKADVIGATAPAAAPASAA 180

Query: 169 TIQSFGLVDESIDA-----NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
              +      +  +      +  ++    YE +  D +RKTIA RL ++KQTIPHFY+  
Sbjct: 181 PAPAAAAAPAAAPSGPGADMVARMYEGREYEEVKLDGMRKTIAARLSEAKQTIPHFYLRR 240

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           D  +D L+  R Q+N+ L+        K+SVND I+KA A A+ QVP+ N  W  + +++
Sbjct: 241 DIKLDALMKFRAQLNKQLEGR----GVKLSVNDFIIKAVANALQQVPDCNAVWAGDRVLK 296

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
            K  D++VAV+I GG+ TP+++ AD KS+  +S E+K LA RA+ RKL P EYQGG+ +I
Sbjct: 297 LKPSDVAVAVAIEGGLFTPVLKDADMKSLSALSTEMKDLATRARDRKLAPHEYQGGSFAI 356

Query: 344 SNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHRSVDGA 402
           SN+GM GI++F A++NPP + ILA+G+G KK V   + E+ VAT+M+ T+S DHR +DGA
Sbjct: 357 SNLGMFGIDNFDAIVNPPHAGILAVGSGVKKPVVGADGELTVATVMSVTMSVDHRVIDGA 416

Query: 403 IASKLLAKFKEYIENPVWML 422
           + ++LL    + +ENP+ ML
Sbjct: 417 LGAQLLQAIVDNLENPMVML 436


>gi|157146667|ref|YP_001453986.1| dihydrolipoamide succinyltransferase [Citrobacter koseri ATCC
           BAA-895]
 gi|157083872|gb|ABV13550.1| hypothetical protein CKO_02433 [Citrobacter koseri ATCC BAA-895]
          Length = 406

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 96/423 (22%), Positives = 176/423 (41%), Gaps = 19/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDSVQRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S      +  S    
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSSGKETSAKSEEKASTPAQRQQASLSEQNNDALSPAIR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A                          +                       
Sbjct: 120 RLLGEHNLDA---------------SAIKGTGVGGRITREDVEKHLAKAPAKAEAKAPEA 164

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                      S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 165 VPAAQPALGARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDA 224

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 225 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 281

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  ++  GG  +I+N G+ G      +INP
Sbjct: 282 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINP 341

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 342 PQSAILGMHAIKDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTR 401

Query: 421 MLM 423
           +L+
Sbjct: 402 LLL 404


>gi|325914049|ref|ZP_08176405.1| 2-oxoglutarate dehydrogenase E2 component [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325539818|gb|EGD11458.1| 2-oxoglutarate dehydrogenase E2 component [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 403

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 103/421 (24%), Positives = 182/421 (43%), Gaps = 21/421 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++++  +A W K+ G+ +   + L ++ETDK ++E  S  +G++ EI 
Sbjct: 1   MATEVKVPVLPESVSDATIASWHKKAGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             AG+  +  N  +                            + +       + +     
Sbjct: 61  FEAGS-TVTSNQIL-----------------AIIEEGAAAAAAPAEEKKAEVQVAAAPAP 102

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A+  A   A       SS     P  R          S          +    +V+ +  
Sbjct: 103 AATPAAAAAAPAAASKSSADALPPGARFSAITQGVDPSQVEGTGRRGAVTKEDIVNFAKA 162

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
             +         E +P   +RKTIA RL +SK +        + N+    + R+++    
Sbjct: 163 GGVGKASGARPEERVPMTRVRKTIAKRLMESKNSTAMLTTFNEVNLAKFSAARKELQDEF 222

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           Q        K+      +KA A A+ + P  N S   + +I H + DIS+AVS   G+VT
Sbjct: 223 QKA---HGIKLGFMSFFVKAAANALQRFPLVNASIDGDDIIYHGYSDISIAVSTEKGLVT 279

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  +++S  ++   +   A +A+  KL  ++ QGGT +I+N G  G      +INPP
Sbjct: 280 PVLRNVERQSFAEVEQGIADYAAKARAGKLGLDDLQGGTFTITNGGTFGSLLSTPIINPP 339

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ + +N ++ +A +M   LS DHR +DG  + + L   K  +ENP  M
Sbjct: 340 QSAILGMHAIKERPIAENGQVVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRM 399

Query: 422 L 422
           L
Sbjct: 400 L 400


>gi|294666497|ref|ZP_06731739.1| dihydrolipoamide acetyltransferase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292603728|gb|EFF47137.1| dihydrolipoamide acetyltransferase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 404

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 105/421 (24%), Positives = 182/421 (43%), Gaps = 20/421 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++++  +A W K+ G+ +   + L ++ETDK ++E  S  +G++ EI 
Sbjct: 1   MATEVKVPVLPESVSDATIASWHKKAGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G+  +  N  +  I                    V                +   P 
Sbjct: 61  FDTGS-TVTSNQILAIIE----------------EGAVAAAAPAEEKQAAAPAATAAAPA 103

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A+P     A       S+     P  R          S          +    +V+ +  
Sbjct: 104 AAPAPAAAAAPAAASKSAADSLPPGARFSAITQGVDPSQVEGTGRRGAVTKEDIVNFAKA 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
             +         E +P   +RKTIA RL +SK +        + N+  + + R+++    
Sbjct: 164 GGVGKASGARPEERVPMTRVRKTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKELQDEF 223

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           Q        K+      +KA A A+ + P  N S   + +I H + DIS+AVS   G+VT
Sbjct: 224 QKA---HGIKLGFMSFFVKAAANALQRFPLVNASIDGDDIIYHGYSDISIAVSTDKGLVT 280

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  +++S  D+   +   A +A+  KL  ++ QGGT +I+N G  G      +INPP
Sbjct: 281 PVLRNVERQSFADVEQGIADYAAKARAGKLGLDDLQGGTFTITNGGTFGSLLSTPIINPP 340

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ + +N +++ A +M   LS DHR +DG  + + L   K  +ENP  M
Sbjct: 341 QSAILGMHAIKERPIAENGQVEKAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRM 400

Query: 422 L 422
           L
Sbjct: 401 L 401


>gi|114766444|ref|ZP_01445409.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Pelagibaca bermudensis HTCC2601]
 gi|114541301|gb|EAU44350.1| pyruvate dehydrogenase complex, E2 component, dihydrolipoamide
           acetyltransferase [Roseovarius sp. HTCC2601]
          Length = 446

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 186/449 (41%), Positives = 264/449 (58%), Gaps = 32/449 (7%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD ++ GDIL EIETDKA MEFE+VDEG I +IL
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWLVKEGDTVNSGDILAEIETDKATMEFEAVDEGTIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDST------------------EIPPSPPLSKENIVEVREEH 103
           +  GTE + VN+PI  +L +                    E         +         
Sbjct: 61  IEDGTEGVKVNTPIAVLLEEGESADDIDSASASPAPAPAAEDKAPAKDEAKAAAATPAAA 120

Query: 104 SHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
           S S+     +     R  A+PLARR+A + G+DL+ + GSGPHGRIVK+D+E+       
Sbjct: 121 SASAAPAAPQGSDGKRIFATPLARRIAADKGLDLAQIKGSGPHGRIVKADVESAKPGAAE 180

Query: 164 VKDYSTIQSFG---------LVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQ 214
               +   +           +        +L ++    +E +  D +R+T+  RL +SKQ
Sbjct: 181 APKSAEAPAAKAAPAASGGGMPTGPSAEQVLKMYEGRDFEEVKLDGMRRTVGARLTESKQ 240

Query: 215 TIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANV 274
           TIPHFY+  D  +D LL  R Q+N+ L+        K+SVND I+KA ALA+  VP+AN 
Sbjct: 241 TIPHFYLRRDIKLDALLKFRSQLNKQLEGR----GVKLSVNDFIIKACALALQAVPDANA 296

Query: 275 SWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPE 334
            W  + M++ K  D++VAV+I GG+ TP+++ A+ KS+  +S E+K LA RA+ +KL P 
Sbjct: 297 VWAGDRMLKLKPSDVAVAVAIDGGLFTPVLKDAEMKSLSALSTEMKDLASRARGKKLAPH 356

Query: 335 EYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLS 393
           EY GG+ +ISN+GM GI++F AVINPP   ILA+GAG KK +   + E+ VAT+M+ TLS
Sbjct: 357 EYVGGSFAISNLGMFGIDNFDAVINPPHGAILAVGAGVKKPIVGDDGELTVATVMSVTLS 416

Query: 394 ADHRSVDGAIASKLLAKFKEYIENPVWML 422
            DHR +DGA+ ++LL    E +ENP+ ML
Sbjct: 417 VDHRVIDGALGAELLKAIVENLENPMVML 445


>gi|187923633|ref|YP_001895275.1| dihydrolipoamide succinyltransferase [Burkholderia phytofirmans
           PsJN]
 gi|187714827|gb|ACD16051.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia phytofirmans PsJN]
          Length = 428

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 106/430 (24%), Positives = 182/430 (42%), Gaps = 11/430 (2%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL EIETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           +   G + +  +  I  I  +      +     +   E     + ++        +    
Sbjct: 61  IANDG-DTVTADQVIAKIDTEGKAGAAAVEAEVKPAPEAAPAPAAAAAPAAHAASATGAN 119

Query: 121 IASPLARRLAGEHG-------IDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSF 173
            A+  A                             +         +              
Sbjct: 120 TAASPAAGKLMAEKGLGAGDVSGTGRDGRITKGDVLTAGAPAAKAAPAPAPAAAPKAAKP 179

Query: 174 GLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSL 233
            L D    A+          + +P   +R  IA RL +S+QT        + N+  ++ L
Sbjct: 180 SLPDVKAPASADQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMDL 239

Query: 234 REQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAV 293
           R +     +        K+      +KA   A+ + P  N S   N ++ H + DI +AV
Sbjct: 240 RNKYKDRFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAV 296

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
             P G+V PI+R ADQ S+ DI  ++ +  Q+AK  KL  EE  GGT SISN G+ G   
Sbjct: 297 GSPRGLVVPILRNADQLSLADIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSML 356

Query: 354 FCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKE 413
              +INPPQS IL + A +++ V +N +I +  +    LS DHR +DG  A   L   K+
Sbjct: 357 STPIINPPQSAILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKD 416

Query: 414 YIENPVWMLM 423
            +E+P  +L+
Sbjct: 417 ALEDPARLLL 426


>gi|83592550|ref|YP_426302.1| 2-oxoglutarate dehydrogenase E2 component [Rhodospirillum rubrum
           ATCC 11170]
 gi|83575464|gb|ABC22015.1| 2-oxoglutarate dehydrogenase E2 component [Rhodospirillum rubrum
           ATCC 11170]
          Length = 431

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 104/433 (24%), Positives = 177/433 (40%), Gaps = 15/433 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  +++E  +AKW K+ GD ++  + L E+ETDK  +E  +   G + EI+
Sbjct: 1   MATEIIVPQLGESVSEATVAKWFKKVGDAVAADEPLVELETDKVTVEVPAPAAGTLSEII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +AV + +  +        P+ P +     +   E    +      +       
Sbjct: 61  AAEGAE-VAVGAVLALLAGAGEGAAPAKPAAAPAEKKAEPEKKPEAEKKAGPEKKAEPVA 119

Query: 122 ASPLARRLAGEHGIDLSSLSG----------SGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
           A+      A        ++              P            +         +   
Sbjct: 120 AAAPKAASAPLDYPLPPAVRKLVDDNALDPARIPATGKDGRLTRDDVVAFLKAGAPAGAP 179

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
           +      S  A      A    E +    +R+ IA RL++++ T        + ++ NL+
Sbjct: 180 ASAPAPASAPAAGPAREAGPREEKVKMTRLRRRIAERLKEAQNTAAILTTFNEVDMTNLM 239

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISV 291
           +LR Q   + +        K+      +KA   A+ ++P  N   + +++I   + DI V
Sbjct: 240 ALRNQYKESFEKK---HGVKLGFMSFFVKACVKALQEMPAVNSEISGDSLIYKNYYDIGV 296

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGI 351
           AV    G+V P++R  D KS   I  ++    ++A+   L  EE  GGT ++SN G+ G 
Sbjct: 297 AVGGAQGLVVPVVRDCDAKSFATIEADIAGYGKKARDGSLTMEEMAGGTFTVSNGGVYGS 356

Query: 352 NSFCAVINPPQSTILAIGAGEKKV-VFQNEEIKVATIMNATLSADHRSVDGAIASKLLAK 410
                +INPPQS IL +     +  V  +  I    +M   LS DHR VDG  A   L +
Sbjct: 357 LMSTPIINPPQSAILGMHKTMMRPMVMPDGSIAARPMMYLALSYDHRIVDGKEAVTFLVR 416

Query: 411 FKEYIENPVWMLM 423
            KE IE+P  +L+
Sbjct: 417 VKECIEDPARLLL 429


>gi|254229706|ref|ZP_04923115.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio sp. Ex25]
 gi|262394882|ref|YP_003286736.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio sp. Ex25]
 gi|151937751|gb|EDN56600.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio sp. Ex25]
 gi|262338476|gb|ACY52271.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio sp. Ex25]
          Length = 402

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 96/422 (22%), Positives = 182/422 (43%), Gaps = 22/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W KQ GD +   ++L +IETDK ++E  + + G+++ I+
Sbjct: 1   MTIEILVPDLPESVADATVATWHKQPGDAVERDEVLVDIETDKVVLEVPAPEAGVLEAIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     I  +   +    P+   ++       + H  +      +  S     
Sbjct: 61  EEEGA-TVLSKQIIAKLKPGAVAGEPTADKTEGTEASPDKRHKAALSEESNDALSPAVRR 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A +          +        ++ +                      E   
Sbjct: 120 LLAEHSLEASQVKGTGVGGRITREDIEAHLANAKAATK------------------EEAP 161

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A +    A  S + +P   +RKT+A RL ++K          + N+  ++ LR+Q     
Sbjct: 162 AVVDVPAAARSQKRVPMTRLRKTVANRLLEAKNNTAMLTTFNEVNMKPIMDLRKQYKDQF 221

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 222 EER---HGIRLGFMSFYVKAVTEALKRYPEVNASIDGDDIVYHNYFDISMAVSTPRGLVT 278

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D+    D+   +K+LA + +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 279 PVLKDCDKLGFADVEKGIKELAIKGRDGKLTVDELMGGNFTITNGGVFGSLMSTPIINPP 338

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 339 QSAILGMHKIQERPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARL 398

Query: 422 LM 423
           L+
Sbjct: 399 LL 400


>gi|260433370|ref|ZP_05787341.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417198|gb|EEX10457.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 437

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 184/440 (41%), Positives = 267/440 (60%), Gaps = 23/440 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+VDEG++ +IL
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWLVKEGDTVSSGDLLAEIETDKATMEFEAVDEGVVGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKN--- 118
           +P GTE + VN+PI  +L +         +  +         + +         +     
Sbjct: 61  IPEGTEGVKVNTPIAVLLEEGESADDIAAVPAKAPEAAPAADAGNEAAAPAASEAPAPAS 120

Query: 119 -----------RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDY 167
                      R  ASPLARR+A + G+DL+ + GSGPHGRIVK+D+E   +        
Sbjct: 121 ATAAPVKADGGRIFASPLARRIAAQKGLDLAQIKGSGPHGRIVKADVEGATAPAAAPAPA 180

Query: 168 STIQSFGLVDESIDANILN----LFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
           +   +      +      +    ++    Y+ +  D +RKTIA RL ++KQTIPHFY+  
Sbjct: 181 AAASAAPAPAAAPAGPSADMVARMYEGREYQEVKLDGMRKTIAARLAEAKQTIPHFYLRR 240

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           D  +D LL  R Q+N+ L+        K+SVND I+KA A A+ QVPE N  W  + +++
Sbjct: 241 DIKLDALLKFRSQLNKQLESR----GVKLSVNDFIIKAVANALQQVPECNAVWAGDRVLQ 296

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
            K  D++VAV+I GG+ TP+++ AD KS+  +S E+K LA RA++RKL P EYQGGT +I
Sbjct: 297 LKPSDVAVAVAIEGGLFTPVLQDADTKSLSALSTEMKDLAARARERKLAPHEYQGGTFAI 356

Query: 344 SNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHRSVDGA 402
           SN+GM GI++F A++NPP + ILA+G G KK V  ++ E+ VAT+M+ T+S DHR +DGA
Sbjct: 357 SNLGMYGIDNFDAIVNPPHAGILAVGTGAKKPVVGEDGELTVATVMSVTMSVDHRVIDGA 416

Query: 403 IASKLLAKFKEYIENPVWML 422
           + ++LL    + +ENP+ ML
Sbjct: 417 LGAQLLQAIVDNLENPMVML 436


>gi|283470627|emb|CAQ49838.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Staphylococcus aureus subsp. aureus ST398]
          Length = 423

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 94/422 (22%), Positives = 173/422 (40%), Gaps = 6/422 (1%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            + +P L+ ++TEG +A+W+K  GD +  G+ + E+ETDK  +E  S + G++ E L   
Sbjct: 3   EVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLASE 62

Query: 65  GTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASP 124
           G + + V   I  I   S                    ++       +          + 
Sbjct: 63  G-DTVEVGQAIAVIGEGSGNASKENSNDNTPQQNDETTNNKKEETTNKSADKAEVNQTND 121

Query: 125 LARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANI 184
             ++              +G +   V      ++  +   K      S     ++     
Sbjct: 122 DNQQRVNATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQAPAKEE 181

Query: 185 LNLFAKDSYEVI--PHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
                  +  VI       +KT A +L +            + ++ N++ LR++      
Sbjct: 182 KKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFM 241

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
              +    K+       KA   A+ + PE N     + MI  ++ DI VAVS   G++ P
Sbjct: 242 KDHD--GTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVP 299

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
            +R  D+K+  +I  E+  LA +A+++KL  ++   G+ +I+N G+ G      +IN  Q
Sbjct: 300 FVRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQ 359

Query: 363 STILAIGAGEKKVVFQN-EEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           + IL + +   + +  + + I+   +M   LS DHR +DG  A   L   KE IENP  +
Sbjct: 360 AAILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDL 419

Query: 422 LM 423
           L+
Sbjct: 420 LL 421


>gi|15924402|ref|NP_371936.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|15926992|ref|NP_374525.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus N315]
 gi|148267900|ref|YP_001246843.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150393963|ref|YP_001316638.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156979731|ref|YP_001441990.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253315265|ref|ZP_04838478.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253732049|ref|ZP_04866214.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus USA300_TCH959]
 gi|255006201|ref|ZP_05144802.2| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257795533|ref|ZP_05644512.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus A9781]
 gi|258413341|ref|ZP_05681617.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus A9763]
 gi|258420552|ref|ZP_05683494.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus A9719]
 gi|258434676|ref|ZP_05688750.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus A9299]
 gi|258444748|ref|ZP_05693077.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus A8115]
 gi|258447417|ref|ZP_05695561.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus A6300]
 gi|258449258|ref|ZP_05697361.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus A6224]
 gi|258454638|ref|ZP_05702602.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus A5937]
 gi|269203035|ref|YP_003282304.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282892906|ref|ZP_06301141.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus A8117]
 gi|282927937|ref|ZP_06335546.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus A10102]
 gi|295406359|ref|ZP_06816166.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus A8819]
 gi|296275272|ref|ZP_06857779.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297244588|ref|ZP_06928471.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus A8796]
 gi|81705702|sp|Q7A5N4|ODO2_STAAN RecName: Full=Dihydrolipoyllysine-residue succinyltransferase
           component of 2-oxoglutarate dehydrogenase complex;
           AltName: Full=2-oxoglutarate dehydrogenase complex
           component E2; Short=OGDC-E2; AltName:
           Full=Dihydrolipoamide succinyltransferase component of
           2-oxoglutarate dehydrogenase complex
 gi|81781610|sp|Q99U75|ODO2_STAAM RecName: Full=Dihydrolipoyllysine-residue succinyltransferase
           component of 2-oxoglutarate dehydrogenase complex;
           AltName: Full=2-oxoglutarate dehydrogenase complex
           component E2; Short=OGDC-E2; AltName:
           Full=Dihydrolipoamide succinyltransferase component of
           2-oxoglutarate dehydrogenase complex
 gi|13701209|dbj|BAB42504.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus N315]
 gi|14247183|dbj|BAB57574.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|147740969|gb|ABQ49267.1| 2-oxoglutarate dehydrogenase E2 component [Staphylococcus aureus
           subsp. aureus JH9]
 gi|149946415|gb|ABR52351.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Staphylococcus aureus subsp. aureus
           JH1]
 gi|156721866|dbj|BAF78283.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253724211|gb|EES92940.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus USA300_TCH959]
 gi|257789505|gb|EEV27845.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus A9781]
 gi|257839905|gb|EEV64373.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus A9763]
 gi|257843500|gb|EEV67907.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus A9719]
 gi|257849037|gb|EEV73019.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus A9299]
 gi|257850241|gb|EEV74194.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus A8115]
 gi|257853608|gb|EEV76567.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus A6300]
 gi|257857246|gb|EEV80144.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus A6224]
 gi|257863021|gb|EEV85785.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus A5937]
 gi|262075325|gb|ACY11298.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282590234|gb|EFB95314.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus A10102]
 gi|282764903|gb|EFC05028.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus A8117]
 gi|285817090|gb|ADC37577.1| Dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Staphylococcus
           aureus 04-02981]
 gi|294968947|gb|EFG44969.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus A8819]
 gi|297178618|gb|EFH37864.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus A8796]
 gi|312829807|emb|CBX34649.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315131221|gb|EFT87205.1| dihydrolipoamide acetyltransferase [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|329727092|gb|EGG63548.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus 21172]
          Length = 422

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 95/421 (22%), Positives = 173/421 (41%), Gaps = 5/421 (1%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            + +P L+ ++TEG +A+W+K  GD +  G+ + E+ETDK  +E  S + G++ E L   
Sbjct: 3   EVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLASE 62

Query: 65  GTENIAVNSPILNILMD-STEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIAS 123
           G + + V   I  I          +   +     E        +     +K   N+    
Sbjct: 63  G-DTVEVGQAIAIIGEGSGNASKENSNDNTPQQNEETNNKKEETTNNSVDKAEVNQANDD 121

Query: 124 PLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDAN 183
              R  A       +  +G        K++           +             + +  
Sbjct: 122 NQQRINATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQAPAKEEK 181

Query: 184 ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQF 243
             N +             +KT A +L +            + ++ N++ LR++       
Sbjct: 182 KYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFMK 241

Query: 244 HREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPI 303
             +    K+       KA   A+ + PE N     + MI  ++ DI VAVS   G++ P 
Sbjct: 242 DHD--GTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPF 299

Query: 304 IRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQS 363
           +R  D+K+  +I  E+  LA +A+++KL  ++   G+ +I+N G+ G      +IN  Q+
Sbjct: 300 VRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQA 359

Query: 364 TILAIGAGEKKVVFQN-EEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
            IL + +   + +  + + I+   +M   LS DHR +DG  A   L   KE IENP  +L
Sbjct: 360 AILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLL 419

Query: 423 M 423
           +
Sbjct: 420 L 420


>gi|15892149|ref|NP_359863.1| dihydrolipoamide acetyltransferase [Rickettsia conorii str. Malish
           7]
 gi|32129824|sp|Q92J43|ODO2_RICCN RecName: Full=Dihydrolipoyllysine-residue succinyltransferase
           component of 2-oxoglutarate dehydrogenase complex;
           AltName: Full=2-oxoglutarate dehydrogenase complex
           component E2; Short=OGDC-E2; AltName:
           Full=Dihydrolipoamide succinyltransferase component of
           2-oxoglutarate dehydrogenase complex
 gi|15619278|gb|AAL02764.1| dihydrolipoamide acetyltransferase component [Rickettsia conorii
           str. Malish 7]
          Length = 395

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 106/422 (25%), Positives = 179/422 (42%), Gaps = 29/422 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +PSL  ++TE  +AKW K++GD +   ++L EIET+K  +E  +   G I +I 
Sbjct: 1   MRVKIIVPSLGESITEATIAKWYKKQGDSVKTDELLLEIETEKVTLEVNAPCNGTIGKIS 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G  N+AV   I  I   ++               V +  S    V            
Sbjct: 61  KTEGA-NVAVGEEIGEINEGASANTAGTNNESAKAQAVTQPTSEKPAVANNTL------- 112

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                                        K D   +  T  + +         +   +  
Sbjct: 113 ------------------APSVQKLVTENKLDPNNIKGTGRDGRITKGDVLATINTTTTS 154

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A  ++   ++  + +    +RKTIA RL+ S+ T        + ++  +++LR Q     
Sbjct: 155 APAISKSNEERVQRVRMSRLRKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEF 214

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +      + K+      +KA   A+  +P  N     + ++   + DI VAV    G+V 
Sbjct: 215 EKK---HAVKLGFMSFFVKATIEALKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVV 271

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD+    ++   +  LA++A++ KL   +  GGT SISN G+ G      +INPP
Sbjct: 272 PVVRDADKMGFAEVEKTIGILAKQAREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPP 331

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   E++ V  + +I++  +M   LS DHR +DG      L K K+ IENP  +
Sbjct: 332 QSGILGLHKTEERAVVIDGKIEIRPMMYIALSYDHRIIDGKEGVSFLVKIKQLIENPEKL 391

Query: 422 LM 423
           L+
Sbjct: 392 LL 393


>gi|91228429|ref|ZP_01262354.1| dihydrolipoamide acetyltransferase [Vibrio alginolyticus 12G01]
 gi|269967960|ref|ZP_06182000.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio alginolyticus 40B]
 gi|91188013|gb|EAS74320.1| dihydrolipoamide acetyltransferase [Vibrio alginolyticus 12G01]
 gi|269827483|gb|EEZ81777.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio alginolyticus 40B]
          Length = 402

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 96/422 (22%), Positives = 183/422 (43%), Gaps = 22/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W KQ GD +   ++L +IETDK ++E  + + G+++ I+
Sbjct: 1   MTIEILVPDLPESVADATVATWHKQPGDAVERDEVLVDIETDKVVLEVPAPEAGVLEAIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     I  +   +    P+   ++       + H  +      +  S     
Sbjct: 61  EAEGA-TVLSKQIIAKLKPGAVAGEPTADKTEGTEASPDKRHKAALSEESNDALSPAVRR 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A +          +        ++ ++                     E   
Sbjct: 120 LLAEHGLEASQVKGTGVGGRITREDIEAHLANAKSASK------------------EDSP 161

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A +    A  S + +P   +RKT+A RL ++K          + N+  ++ LR+Q     
Sbjct: 162 AVVDVPAAARSQKRVPMTRLRKTVANRLLEAKNNTAMLTTFNEVNMKPIMDLRKQYKDQF 221

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 222 EER---HGIRLGFMSFYVKAVTEALKRYPEVNASIDGDDIVYHNYFDISMAVSTPRGLVT 278

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D+    D+   +K+LA + +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 279 PVLKDCDKLGFADVEKGIKELAIKGRDGKLTVDELMGGNFTITNGGVFGSLMSTPIINPP 338

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 339 QSAILGMHKIQERPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARL 398

Query: 422 LM 423
           L+
Sbjct: 399 LL 400


>gi|28897622|ref|NP_797227.1| dihydrolipoamide succinyltransferase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153838606|ref|ZP_01991273.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio parahaemolyticus AQ3810]
 gi|260365987|ref|ZP_05778472.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Vibrio parahaemolyticus K5030]
 gi|260878223|ref|ZP_05890578.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Vibrio parahaemolyticus AN-5034]
 gi|260895660|ref|ZP_05904156.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Vibrio parahaemolyticus Peru-466]
 gi|260901288|ref|ZP_05909683.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Vibrio parahaemolyticus AQ4037]
 gi|28805834|dbj|BAC59111.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149748024|gb|EDM58883.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio parahaemolyticus AQ3810]
 gi|308088164|gb|EFO37859.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Vibrio parahaemolyticus Peru-466]
 gi|308090164|gb|EFO39859.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Vibrio parahaemolyticus AN-5034]
 gi|308109826|gb|EFO47366.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Vibrio parahaemolyticus AQ4037]
 gi|308111256|gb|EFO48796.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Vibrio parahaemolyticus K5030]
 gi|328473394|gb|EGF44242.1| dihydrolipoamide succinyltransferase [Vibrio parahaemolyticus
           10329]
          Length = 401

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 95/422 (22%), Positives = 183/422 (43%), Gaps = 23/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W KQ GD +   ++L +IETDK ++E  + + G+++ IL
Sbjct: 1   MTIEILVPDLPESVADATVATWHKQPGDTVERDEVLVDIETDKVVLEVPAPEAGVLEAIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  +   +    P+   ++       + H  +      +  S     
Sbjct: 61  EVEGA-TVLSKQLLAKLKAGAVAGEPTADKTEATEASPDKRHKATLTEESNDALSPAVRR 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A +                        +    T     + + +     ++  
Sbjct: 120 LLAEHGLEAHQ-------------------VKGTGVGGRITREDIEAHLANAKAAPKADA 160

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
             +       S + +P   +RKT+A RL ++K +        + N+  ++ LR+Q     
Sbjct: 161 PAVEAPATARSEKRVPMTRLRKTVANRLLEAKNSTAMLTTFNEVNMKPIMDLRKQYKDQF 220

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 221 EER---HGIRLGFMSFYVKAVTEALKRYPEVNASIDGDDIVYHNYFDISMAVSTPRGLVT 277

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D+    D+   +K+LA + +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 278 PVLKDCDKLGFADVEKGIKELAIKGRDGKLTVDELMGGNFTITNGGVFGSLMSTPIINPP 337

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 338 QSAILGMHKIQERPMAVNGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARL 397

Query: 422 LM 423
           L+
Sbjct: 398 LL 399


>gi|294676282|ref|YP_003576897.1| dihydrolipoyllysine-residue succinyltransferase [Rhodobacter
           capsulatus SB 1003]
 gi|294475102|gb|ADE84490.1| dihydrolipoyllysine-residue succinyltransferase
           (succinyl-transferring), E2 component [Rhodobacter
           capsulatus SB 1003]
          Length = 517

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 100/421 (23%), Positives = 175/421 (41%), Gaps = 11/421 (2%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  + +P+L  ++ E  ++ W K+ GD ++  +ILCE+ETDK  +E  +   G++ EIL 
Sbjct: 106 MTDVMVPALGESVAEATVSTWFKKPGDAVAQDEILCELETDKVSVEVPAPAAGVLSEILA 165

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
           P G  ++A    +  +   S   P     +                    +K      + 
Sbjct: 166 PEGA-SVAAGGRLAILAAGSAAAPAPAAAAAAPAPAPAAPAKDVEHAPAAKKAMAEAGLT 224

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
                    +  I    ++ +        +           V              ++  
Sbjct: 225 PDQVTGTGRDGRIMKEDVAAAAAAPAAAPAPAAPAPVATAQVSIAPPP-------ATVPR 277

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
             +        E +    +R TIA RL+ ++ T        + ++  ++ LR       +
Sbjct: 278 APVPAEDAAREERVKMTRLRATIARRLKDAQNTAAMLTTYNEVDMSGVMDLRNVYKDQFE 337

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                   K+      +KA   A+ ++PE N       +I   ++ + VAV  P G+V P
Sbjct: 338 KK---HGVKLGFMGFFVKACCHALKEIPEVNAEIDGGDIIYKNYVHMGVAVGTPSGLVVP 394

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R ADQK    I  E+ +L +R +  KL  +E QGG+ +ISN G+ G      ++NPPQ
Sbjct: 395 VVRDADQKGFAHIEREIAELGKRGRDGKLTMQEMQGGSFTISNGGVYGSLMSSPILNPPQ 454

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL +   + + V  N +I +  +M   LS DHR VDG  A   L + KE +E+P  +L
Sbjct: 455 SGILGMHKIQDRPVVVNGQIVIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRLL 514

Query: 423 M 423
           M
Sbjct: 515 M 515



 Score =  115 bits (286), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 46/88 (52%), Gaps = 1/88 (1%)

Query: 3  IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
          +  I +P L  +++E  +A W  + G+ +    +LCE+ETDK  +E  +   G++ EI+ 
Sbjct: 1  MTEIRVPGLGESVSEATVATWFVKPGEMVVADAMLCELETDKVTVEVRAPSAGVLSEIVA 60

Query: 63 PAGTENIAVNSPILNILMDSTEIPPSPP 90
            G E +AVN+ +  +L      P  P 
Sbjct: 61 KEG-ETVAVNALLAVLLSAGAMPPAQPK 87


>gi|282916679|ref|ZP_06324437.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus subsp. aureus D139]
 gi|283770483|ref|ZP_06343375.1| dihydrolipoyllysine-residue succinyltransferase 2-oxoglutarate
           dehydrogenase complex component [Staphylococcus aureus
           subsp. aureus H19]
 gi|282319166|gb|EFB49518.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus subsp. aureus D139]
 gi|283460630|gb|EFC07720.1| dihydrolipoyllysine-residue succinyltransferase 2-oxoglutarate
           dehydrogenase complex component [Staphylococcus aureus
           subsp. aureus H19]
          Length = 423

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 94/422 (22%), Positives = 173/422 (40%), Gaps = 6/422 (1%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            + +P L+ ++TEG +A+W+K  GD +  G+ + E+ETDK  +E  S + G++ E L   
Sbjct: 3   EVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLASE 62

Query: 65  GTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASP 124
           G + + V   I  I   S                    ++       +          + 
Sbjct: 63  G-DTVEVGQAIAVIGEGSGNASKENSNDNTPQQNDETTNNKKEETTNKSADKAEVNQTND 121

Query: 125 LARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANI 184
             ++              +G +   V      ++  +   K      S     ++     
Sbjct: 122 DNQQRVNATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQEPASTQTTQQAPAKEE 181

Query: 185 LNLFAKDSYEVI--PHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
                  +  VI       +KT A +L +            + ++ N++ LR++      
Sbjct: 182 KKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFM 241

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
              +    K+       KA   A+ + PE N     + MI  ++ DI VAVS   G++ P
Sbjct: 242 KDHD--GTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVP 299

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
            +R  D+K+  +I  E+  LA +A+++KL  ++   G+ +I+N G+ G      +IN  Q
Sbjct: 300 FVRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQ 359

Query: 363 STILAIGAGEKKVVFQN-EEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           + IL + +   + +  + + I+   +M   LS DHR +DG  A   L   KE IENP  +
Sbjct: 360 AAILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDL 419

Query: 422 LM 423
           L+
Sbjct: 420 LL 421


>gi|78066120|ref|YP_368889.1| dihydrolipoamide acetyltransferase [Burkholderia sp. 383]
 gi|77966865|gb|ABB08245.1| 2-oxoglutarate dehydrogenase E2 component [Burkholderia sp. 383]
          Length = 424

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 105/426 (24%), Positives = 187/426 (43%), Gaps = 7/426 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL E+ETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G + +  +  I  I  ++             +       + +         + +  
Sbjct: 61  LQNDG-DTVVADQIIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAAPAAQPVAAAASSTT 119

Query: 121 IASPLARRLAGEHGIDLS---SLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
            +   ++ LA +         S            +      +        +      L +
Sbjct: 120 ASPAASKLLAEKGLSAGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKTAAAKPALPE 179

Query: 178 ESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
             + A+          + +P   +R  IA RL +S+QT        + N+  ++ LR + 
Sbjct: 180 VKVPASAATWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNKY 239

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
               +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P 
Sbjct: 240 KDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPR 296

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G+V PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G      +
Sbjct: 297 GLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPI 356

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           INPPQS IL + A +++ V +N +I +  I    LS DHR +DG  A   L   K+ +E+
Sbjct: 357 INPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALED 416

Query: 418 PVWMLM 423
           P  +L+
Sbjct: 417 PARLLL 422


>gi|156934781|ref|YP_001438697.1| dihydrolipoamide succinyltransferase [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156533035|gb|ABU77861.1| hypothetical protein ESA_02621 [Cronobacter sakazakii ATCC BAA-894]
          Length = 407

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 96/423 (22%), Positives = 177/423 (41%), Gaps = 18/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +G++D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVKRDEVLVEIETDKVVLEVPASADGVLDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G+  +     +  +   ++    S    +       +    S      +  S    
Sbjct: 61  LEDEGS-TVTSRQILGRLREGNSAGKESSAKPEAKESTPAQRQQASLEEQNNDALSPAIR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A                 +                   +         E  
Sbjct: 120 RLLAEHNLDA--------------AAIKGTGVGGRLTREDVEKHLAKANGSESAKAPEQA 165

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
            A         S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 166 AAAPQPQLGSRSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDA 225

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 226 FEKR---HGIRLGFMSFYVKAVVEALKRFPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 282

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 283 TPVLRDVDVLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 342

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 343 PQSAILGMHAIKDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 402

Query: 421 MLM 423
           +L+
Sbjct: 403 LLL 405


>gi|149913854|ref|ZP_01902386.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Roseobacter sp. AzwK-3b]
 gi|149812138|gb|EDM71969.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Roseobacter sp. AzwK-3b]
          Length = 446

 Score =  292 bits (748), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 189/449 (42%), Positives = 265/449 (59%), Gaps = 32/449 (7%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD++S GD+L EIETDKA MEFE+VD+G I +IL
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWLVKEGDEVSSGDLLAEIETDKATMEFEAVDDGTIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDST---------------------EIPPSPPLSKENIVEVR 100
           +  GTE + VN+PI  +L +                       E P              
Sbjct: 61  IAEGTEGVKVNTPIAVLLDEGESADDIDSTSGDTGGDVKAAASEAPAKTGGEGSGKDAPT 120

Query: 101 EEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST 160
            + S +      +  S NR  ASPLARR+A + G+DL+ + GSGPHGRIVK+D++   + 
Sbjct: 121 AKASDTKAPAAPQDDSGNRIFASPLARRIAADKGVDLAQIKGSGPHGRIVKADVQGAKAG 180

Query: 161 KTNVKDYSTIQSFGLVDE------SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQ 214
                D                       +  ++   +Y  +  D +RKTIA RL ++KQ
Sbjct: 181 TAAAADAPAAAPAAKQAAPVAPTGPSADAVAAMYKDRAYTEVKLDGMRKTIAARLTEAKQ 240

Query: 215 TIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANV 274
           T+PHFY+  D  +D LL  R ++N  L+        K+SVND I+KA ALA+  VP+AN 
Sbjct: 241 TVPHFYLRRDIRLDALLKFRGELNAQLEER----GVKLSVNDFIIKACALALQAVPDANA 296

Query: 275 SWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPE 334
            W    +++    D++VAV+I GG+ TP+++ A+ KS+  +S E+K LA+RA+ RKL PE
Sbjct: 297 VWAGERVLKLAPSDVAVAVAIEGGLFTPVLKDAEAKSLSALSAEMKDLAKRARDRKLSPE 356

Query: 335 EYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLS 393
           EYQGGT +ISN+GM GI +F AVINPP   ILA+GAG KK V  ++ E+ VAT+M+ TLS
Sbjct: 357 EYQGGTFAISNLGMFGIENFDAVINPPHGAILAVGAGIKKPVVGKDGELSVATVMSVTLS 416

Query: 394 ADHRSVDGAIASKLLAKFKEYIENPVWML 422
            DHR +DGA+ ++LL    + +ENP+ ML
Sbjct: 417 VDHRVIDGALGAELLQHIVDNLENPLVML 445


>gi|149191113|ref|ZP_01869372.1| dihydrolipoamide acetyltransferase [Vibrio shilonii AK1]
 gi|148835041|gb|EDL52019.1| dihydrolipoamide acetyltransferase [Vibrio shilonii AK1]
          Length = 401

 Score =  292 bits (748), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 94/422 (22%), Positives = 181/422 (42%), Gaps = 23/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ G+ ++  +++ +IETDK ++E  + D G+++EI+
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKPGEAVARDEVIVDIETDKVVLEVPAPDAGVLEEII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     I  +   +    P+   +        + H  S      +  S     
Sbjct: 61  EEEGA-TVLSKQLIAKLKPGAVAGEPTSDTTDSTEASPDKRHKASLTEESNDALSPAVRR 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A +                        +    T     + + +     ++  
Sbjct: 120 LLAENDLTAND-------------------VTGTGVGGRITREDIEAHLAAAKAAPKAEA 160

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
              +      S + +P   +RK +A RL ++K +        + N+  ++ LR+Q     
Sbjct: 161 EVAVAPVLARSQKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYKDQF 220

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 221 EER---HGTRLGFMSFYVKAVTEALKRYPEVNASIDGDDIVYHNYFDISMAVSTPRGLVT 277

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D     DI   +K+LA + +  KL  EE  GG  +I+N G+ G      +INPP
Sbjct: 278 PVLKDCDTLGFADIEKGIKELAIKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPP 337

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 338 QAAILGMHKIQDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARL 397

Query: 422 LM 423
           L+
Sbjct: 398 LL 399


>gi|76810150|ref|YP_333324.1| dihydrolipoamide succinyltransferase [Burkholderia pseudomallei
           1710b]
 gi|237812052|ref|YP_002896503.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Burkholderia pseudomallei MSHR346]
 gi|254188618|ref|ZP_04895129.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia pseudomallei Pasteur
           52237]
 gi|254261728|ref|ZP_04952782.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia pseudomallei 1710a]
 gi|76579603|gb|ABA49078.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia pseudomallei 1710b]
 gi|157936297|gb|EDO91967.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia pseudomallei Pasteur
           52237]
 gi|237504515|gb|ACQ96833.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Burkholderia pseudomallei MSHR346]
 gi|254220417|gb|EET09801.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia pseudomallei 1710a]
          Length = 425

 Score =  292 bits (748), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 118/427 (27%), Positives = 200/427 (46%), Gaps = 8/427 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL E+ETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSK-ENIVEVREEHSHSSPVVVREKHSKNR 119
           L   G + +  +  I  I  ++     +      +         + +         + + 
Sbjct: 61  LQNDG-DTVVADQVIATIDTEAKAGAAAAAAGAADVQPAAAPVAAPAPAAQPAAAAASST 119

Query: 120 PIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDES 179
             ASP A +L  E GI    ++GSG  GRI K D+ +  S        +  ++       
Sbjct: 120 AAASPAASKLMAEKGIGAGDVAGSGRDGRITKGDVLSAGSAPAAAPAAAPAKAAAKPALP 179

Query: 180 I---DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
                A+          + +P   +R  IA RL +S+QT        + N+  ++ LR +
Sbjct: 180 EVKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAK 239

Query: 237 MNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIP 296
                +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P
Sbjct: 240 YKDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSP 296

Query: 297 GGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCA 356
            G+V PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G      
Sbjct: 297 RGLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTP 356

Query: 357 VINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIE 416
           +INPPQS IL + A +++ V +N +I +  I    LS DHR +DG  A   L   K+ +E
Sbjct: 357 IINPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALE 416

Query: 417 NPVWMLM 423
           +P  +L+
Sbjct: 417 DPARLLL 423


>gi|53719522|ref|YP_108508.1| dihydrolipoamide succinyltransferase [Burkholderia pseudomallei
           K96243]
 gi|126439664|ref|YP_001058790.1| dihydrolipoamide succinyltransferase [Burkholderia pseudomallei
           668]
 gi|134282201|ref|ZP_01768906.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia pseudomallei 305]
 gi|254179972|ref|ZP_04886571.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia pseudomallei 1655]
 gi|254197773|ref|ZP_04904195.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia pseudomallei S13]
 gi|52209936|emb|CAH35908.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Burkholderia pseudomallei K96243]
 gi|126219157|gb|ABN82663.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia pseudomallei 668]
 gi|134246239|gb|EBA46328.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia pseudomallei 305]
 gi|169654514|gb|EDS87207.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia pseudomallei S13]
 gi|184210512|gb|EDU07555.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia pseudomallei 1655]
          Length = 425

 Score =  292 bits (748), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 118/427 (27%), Positives = 200/427 (46%), Gaps = 8/427 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL E+ETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSK-ENIVEVREEHSHSSPVVVREKHSKNR 119
           L   G + +  +  I  I  ++     +      +         + +         + + 
Sbjct: 61  LQNDG-DTVVADQVIATIDTEAKAGAAAAAAGAADVQPAAAPVAAPAPAAQPAAAAASST 119

Query: 120 PIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDES 179
             ASP A +L  E GI    ++GSG  GRI K D+ +  S        +  ++       
Sbjct: 120 AAASPAASKLMAEKGIGAGDVAGSGRDGRITKGDVLSAGSAPKAAPAAAPAKAAAKPALP 179

Query: 180 I---DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
                A+          + +P   +R  IA RL +S+QT        + N+  ++ LR +
Sbjct: 180 EVKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAK 239

Query: 237 MNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIP 296
                +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P
Sbjct: 240 YKDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSP 296

Query: 297 GGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCA 356
            G+V PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G      
Sbjct: 297 RGLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTP 356

Query: 357 VINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIE 416
           +INPPQS IL + A +++ V +N +I +  I    LS DHR +DG  A   L   K+ +E
Sbjct: 357 IINPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALE 416

Query: 417 NPVWMLM 423
           +P  +L+
Sbjct: 417 DPARLLL 423


>gi|307730018|ref|YP_003907242.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia sp. CCGE1003]
 gi|307584553|gb|ADN57951.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia sp. CCGE1003]
          Length = 427

 Score =  292 bits (747), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 107/429 (24%), Positives = 189/429 (44%), Gaps = 10/429 (2%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL EIETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           +   G + +  +  I  I  + T    +     +         + ++    +   +    
Sbjct: 61  IANDG-DTVTADQVIAKIDTEGTAGAAAVEAEVKPAPVAAPAPAPAAAPAAQAASATGAN 119

Query: 121 IASPLARRLAGEH------GIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFG 174
            A+  A              +  +   G    G ++ +      +               
Sbjct: 120 TAASPAAGKLMAEKGLAAGDVAGTGRDGRITKGDVLSAGAPAAKTAAPAPAAAPRAAKPA 179

Query: 175 LVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLR 234
           L D    A+          + +P   +R  IA RL +S+QT        + N+  ++ LR
Sbjct: 180 LPDVKAPASAEQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMDLR 239

Query: 235 EQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVS 294
            +     +        K+      +KA   A+ + P  N S   N ++ H + DI +AV 
Sbjct: 240 NKYKDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVG 296

Query: 295 IPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSF 354
            P G+V PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G    
Sbjct: 297 SPRGLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLS 356

Query: 355 CAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEY 414
             +INPPQS IL + A +++ V +N +I +  +    LS DHR +DG  A   L   K+ 
Sbjct: 357 TPIINPPQSAILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDA 416

Query: 415 IENPVWMLM 423
           +E+P  +L+
Sbjct: 417 LEDPARLLL 425


>gi|323498616|ref|ZP_08103608.1| dihydrolipoamide succinyltransferase [Vibrio sinaloensis DSM 21326]
 gi|323316314|gb|EGA69333.1| dihydrolipoamide succinyltransferase [Vibrio sinaloensis DSM 21326]
          Length = 402

 Score =  292 bits (747), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 96/422 (22%), Positives = 178/422 (42%), Gaps = 22/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W KQ GD +   ++L +IETDK ++E  + + G+++ I+
Sbjct: 1   MTIEILVPDLPESVADATVATWHKQPGDAVERDEVLVDIETDKVVLEVPAPEAGVLEAII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     I  +   +    P+   ++       + H  S      +  S     
Sbjct: 61  EEEGA-TVLSKQLIAKLKPGAVAGEPTTDTTESTEASPDKRHKASLTEESNDALSPAVRR 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A +                                 +     +         
Sbjct: 120 LLAEHSLEAHQ------------------VKGTGVGGRITREDIEAHLANAKAAPKAEAP 161

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A +    A  S + +P   +RKT+A RL ++K          + N+  ++ LR+Q     
Sbjct: 162 AAVEAPAAARSQKRVPMTRLRKTVANRLLEAKNNTAMLTTFNEVNMKPIMDLRKQYKDQF 221

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 222 EER---HGIRLGFMSFYVKAVTEALKRYPEVNASIDGDDIVYHNYFDISMAVSTPRGLVT 278

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D     D+   +K+LA + +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 279 PVLKDCDTLGFADVEKGIKELAIKGRDGKLTVDELMGGNFTITNGGVFGSLMSTPIINPP 338

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 339 QSAILGMHKIQERPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARL 398

Query: 422 LM 423
           L+
Sbjct: 399 LL 400


>gi|261341313|ref|ZP_05969171.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Enterobacter
           cancerogenus ATCC 35316]
 gi|288316617|gb|EFC55555.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Enterobacter
           cancerogenus ATCC 35316]
          Length = 408

 Score =  292 bits (747), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 97/423 (22%), Positives = 181/423 (42%), Gaps = 17/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDSVKRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    S   ++E      +    S      +  S    
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKESSAKTEEKASTPAQRQQASLEEQSNDALSPAIR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A                         T    + ++    +         + 
Sbjct: 120 RLLAEHTLDA-------------SAIKGTGVGGRLTREDVEKHLAKAPSEAKAEAKAPAA 166

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                      S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 167 APAAQPALGARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDA 226

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 227 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 283

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  ++  GG  +I+N G+ G      +INP
Sbjct: 284 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINP 343

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 344 PQSAILGMHAIKDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTR 403

Query: 421 MLM 423
           +L+
Sbjct: 404 LLL 406


>gi|163793251|ref|ZP_02187227.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide
           acyltransferase (E2) component, and related enzyme
           [alpha proteobacterium BAL199]
 gi|159181897|gb|EDP66409.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide
           acyltransferase (E2) component, and related enzyme
           [alpha proteobacterium BAL199]
          Length = 429

 Score =  292 bits (747), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 198/435 (45%), Positives = 272/435 (62%), Gaps = 19/435 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M  +I MP+LSPTM+EG LAKW  +EGD IS GD++ EIETDKA ME E+V+EG I +I+
Sbjct: 1   MPISILMPALSPTMSEGNLAKWHVKEGDTISAGDVIAEIETDKATMEVEAVEEGKIGKIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPL-----------SKENIVEVREEHSHSSPVV 110
           V  GTE +AVN+ I  +L +       P             +        E     +P  
Sbjct: 61  VAEGTEGVAVNAVIAWLLEEGESAGDIPSDGGHAPAPAAEAATPQPAAKAEPAKTDAPAA 120

Query: 111 VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
              K S+ R  ASPLA+R+A + GIDL ++ GSGP+GRIVK+DIE  +S     K  +  
Sbjct: 121 SAPKASEGRVFASPLAKRMAEQAGIDLGAVKGSGPNGRIVKADIEAAVSGGAPKKAVAAA 180

Query: 171 QSFGLVDESI--DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNID 228
                        A   ++     Y+ +P+  +RK IA RL +SKQ  PHFY++IDC ID
Sbjct: 181 APTPAAAAPSLGQAPSADVPGMPEYDEVPNSGMRKVIAKRLTESKQFAPHFYLTIDCEID 240

Query: 229 NLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHID 288
            LL +R+ +N            K+SVND++++A ALA+ +VP AN SWT  A+  +K +D
Sbjct: 241 ELLKVRKDLNTKGDDF------KLSVNDLVIRAAALALKKVPAANASWTEKAIRIYKQVD 294

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           ISVAV+I  G++TP+I+ A  K +  IS E+K LA RA+ RKLKPEE+QGGT SISN+GM
Sbjct: 295 ISVAVAIDDGLITPVIKDAGSKGLKQISAEMKDLATRARDRKLKPEEFQGGTFSISNLGM 354

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLL 408
            GI  F AVINPPQ  ILA+GAGE++ V ++  + +AT+M+ TLS DHR VDGAI ++ L
Sbjct: 355 FGIKDFAAVINPPQGAILAVGAGEQRAVVKDGALAIATVMSCTLSVDHRVVDGAIGAQFL 414

Query: 409 AKFKEYIENPVWMLM 423
           A FK+ +E+P+ ML+
Sbjct: 415 AAFKKLVEDPLTMLL 429


>gi|258422555|ref|ZP_05685463.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus A9635]
 gi|257847312|gb|EEV71318.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus A9635]
          Length = 423

 Score =  292 bits (747), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 94/422 (22%), Positives = 173/422 (40%), Gaps = 6/422 (1%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            + +P L+ ++TEG +A+W+K  GD +  G+ + E+ETDK  +E  S + G++ E L   
Sbjct: 3   EVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLASE 62

Query: 65  GTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASP 124
           G + + V   I  I   S                    ++       +          + 
Sbjct: 63  G-DTVEVGQAIAVIGEGSGNASKENSNDNTPQQNDETTNNKKEETTNKSADKAEVNQTND 121

Query: 125 LARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANI 184
             ++              +G +   V      ++  +   K      S     ++     
Sbjct: 122 DNQQRVNATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTPTSQQAPAKEE 181

Query: 185 LNLFAKDSYEVI--PHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
                  +  VI       +KT A +L +            + ++ N++ LR++      
Sbjct: 182 KKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFM 241

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
              +    K+       KA   A+ + PE N     + MI  ++ DI VAVS   G++ P
Sbjct: 242 KDHD--GTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVP 299

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
            +R  D+K+  +I  E+  LA +A+++KL  ++   G+ +I+N G+ G      +IN  Q
Sbjct: 300 FVRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQ 359

Query: 363 STILAIGAGEKKVVFQN-EEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           + IL + +   + +  + + I+   +M   LS DHR +DG  A   L   KE IENP  +
Sbjct: 360 AAILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDL 419

Query: 422 LM 423
           L+
Sbjct: 420 LL 421


>gi|227356645|ref|ZP_03841031.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Proteus mirabilis ATCC 29906]
 gi|227163153|gb|EEI48084.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Proteus mirabilis ATCC 29906]
          Length = 402

 Score =  292 bits (747), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 108/424 (25%), Positives = 183/424 (43%), Gaps = 25/424 (5%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD I   ++L EIETDK ++E  + + G++D I
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDSIQRDEVLVEIETDKVVLEVPASEAGVLDSI 60

Query: 61  LVPAGTENIAVNSPILNI-LMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNR 119
           L   G   +     +  I L DST IP     +++     R+     +           R
Sbjct: 61  LEEEGA-TVGSRQLLGRIRLGDSTGIPADVKPAQDTTPAQRQSADIVAKESNDALSPTAR 119

Query: 120 PIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDES 179
            + +      A   G  +            V ++                         +
Sbjct: 120 RLVAEHDINPADVKGSGVGGRLTRQDIESHVANNKSA--------------------TAA 159

Query: 180 IDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
                    +  S + +P   +RK +A RL ++K T        + N+  + +LR Q   
Sbjct: 160 TAEVSQAPLSHRSEKRVPMTRLRKRVAERLLEAKNTTAMLTTFNEINMQPIKNLRAQYGE 219

Query: 240 TLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGI 299
             +        ++      +KA   A+ + PE N S     ++ H + DIS+AVS P G+
Sbjct: 220 AFEKR---HGVRLGFMSFYIKAVVEALKRYPEVNASIDGTDVVYHNYFDISIAVSTPRGL 276

Query: 300 VTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVIN 359
           VTP++R AD  S+ DI   +K LA + +  KL  E+  GG  +I+N G+ G      +IN
Sbjct: 277 VTPVLRDADAMSMADIEKNIKALAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIIN 336

Query: 360 PPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPV 419
           PPQS IL + A + + +  + ++ +  +M   LS DHR +DG  +   L   KE +E+P 
Sbjct: 337 PPQSAILGMHAIKDRPMAVDGQVVILPMMYLALSYDHRLIDGRESVGFLVTVKEMLEDPA 396

Query: 420 WMLM 423
            +L+
Sbjct: 397 RLLL 400


>gi|323438697|gb|EGA96439.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus O11]
 gi|323444066|gb|EGB01677.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus O46]
          Length = 422

 Score =  292 bits (747), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 95/421 (22%), Positives = 172/421 (40%), Gaps = 5/421 (1%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            + +P L+ ++TEG +A+W+K  GD +  G+ + E+ETDK  +E  S + G++ E L   
Sbjct: 3   EVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLASE 62

Query: 65  GTENIAVNSPILNILMD-STEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIAS 123
           G + + V   I  I          +   +     E        +     +    N+    
Sbjct: 63  G-DTVEVGQAIAVIGEGSGNASKENSNDNTPQQNEETNNKKEETTNKSADNAEVNQTNDD 121

Query: 124 PLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDAN 183
              R  A       +  +G        K++           +             + +  
Sbjct: 122 NQQRVNATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQAPAKEEK 181

Query: 184 ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQF 243
             N +             +KT A +L +            + ++ N++ LR++       
Sbjct: 182 KYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFMK 241

Query: 244 HREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPI 303
             +    K+       KA   A+ + PE N     + MI  ++ DI VAVS   G++ P 
Sbjct: 242 DHD--GTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPF 299

Query: 304 IRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQS 363
           +R  D+K+  +I  E+  LA +A+++KL  ++   G+ +I+N G+ G      +IN  Q+
Sbjct: 300 VRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQA 359

Query: 364 TILAIGAGEKKVVFQN-EEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
            IL + +   + +  + E I+   +M   LS DHR +DG  A   L   KE IENP  +L
Sbjct: 360 AILGMHSIITRPIAIDQETIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLL 419

Query: 423 M 423
           +
Sbjct: 420 L 420


>gi|260597125|ref|YP_003209696.1| dihydrolipoamide succinyltransferase [Cronobacter turicensis z3032]
 gi|260216302|emb|CBA29273.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydro [Cronobacter turicensis z3032]
          Length = 406

 Score =  292 bits (747), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 97/423 (22%), Positives = 176/423 (41%), Gaps = 19/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +G++D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWRKKPGDAVKRDEVLVEIETDKVVLEVPASADGVLDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G+  +     +  +   ++    S    +       +    S      +  S    
Sbjct: 61  LEDEGS-TVTSRQILGRLREGNSAGKESSAKPEAKESTPAQRQQASLEEQNNDALSPAIR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A                          L              S        
Sbjct: 120 RLLAEHNLDA---------------AAIKGTGVGGRLTREDVEKHLAKANGSESAKAPEQ 164

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
            A         S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 165 AAAPQPQLGARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDA 224

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 225 FEKR---HGIRLGFMSFYVKAVVEALKRFPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 281

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 282 TPVLRDVDVLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 341

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 342 PQSAILGMHAIKDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 401

Query: 421 MLM 423
           +L+
Sbjct: 402 LLL 404


>gi|114764885|ref|ZP_01444067.1| dihydrolipoamide acetyltransferase [Pelagibaca bermudensis
           HTCC2601]
 gi|114542771|gb|EAU45794.1| dihydrolipoamide acetyltransferase [Roseovarius sp. HTCC2601]
          Length = 512

 Score =  292 bits (747), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 95/423 (22%), Positives = 170/423 (40%), Gaps = 21/423 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
               + +P+L  +++E  ++ W K+ GD +   ++LCE+ETDK  +E  +   G + EIL
Sbjct: 108 APVDVMVPTLGESVSEATVSTWFKKVGDSVEQDEMLCELETDKVSVEVPAPASGTLTEIL 167

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  +   +         +         E + S               
Sbjct: 168 AEEGA-TVEAGGKLAVMSGGAGGAAKGAVEAPAPSSASAAEPTTSG-------------- 212

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A      ++         +    D   +    +     +          +  
Sbjct: 213 --RGDVEDAPSAKKAMAEAGLDPKDVKGTGKDGRVMKEDVSAAIAAAKSAPAASSAPAQP 270

Query: 182 ANILNLFAKD-SYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
               +        E +    +R+TIA RL+ ++ T        + ++   ++LR+Q    
Sbjct: 271 QRAPSPAEDAAREERVKMTRLRQTIARRLKDAQNTAAMLTTYNEVDMTETMALRKQYKDL 330

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++       KA   A+ +VPE N     N ++    + + +A   P G+V
Sbjct: 331 FEKK---HGVRLGFMSFFTKACVHALKEVPEVNAEIDGNEVVYKNFVHMGIAAGTPQGLV 387

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            P++R   +KS  +I  E+ +  +RA+  KL   E QGGT +ISN G+ G      ++NP
Sbjct: 388 VPVLRDVHEKSFAEIEGEIAEKGKRARDGKLSMAEMQGGTFTISNGGVYGSLMSSPILNP 447

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL +   + + +  N EIK+  +M   LS DHR VDG  A   L + KE +E+P  
Sbjct: 448 PQSGILGMHKIQDRPMVVNGEIKIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRR 507

Query: 421 MLM 423
           +LM
Sbjct: 508 LLM 510



 Score =  130 bits (325), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 47/83 (56%), Gaps = 1/83 (1%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   + +P+L  ++TE  +A W K+ GD +   ++LCE+ETDK  +E  S   G++++I+
Sbjct: 1  MTTEVRVPTLGESVTEATVATWFKKPGDSVDVDEMLCELETDKVTVEVPSPVAGVLEDIV 60

Query: 62 VPAGTENIAVNSPILNILMDSTE 84
             G + + V++ + NI      
Sbjct: 61 ANEG-DTVGVDALLANIAPAGEA 82


>gi|261210015|ref|ZP_05924314.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio sp. RC341]
 gi|260840961|gb|EEX67498.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio sp. RC341]
          Length = 404

 Score =  292 bits (747), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 97/422 (22%), Positives = 184/422 (43%), Gaps = 20/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD I+  +++ EIETDK ++E  + + G+++ IL
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKPGDVIARDEVIVEIETDKVVLEVPAPEAGVLETIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  +                    V  E +  +P        K    
Sbjct: 61  EQEGA-TVLSKQLLARL----------------KPGVVAGEPTQDTPDATEPSPDKRHKA 103

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           +       A    +       +    ++  S +   I+ +      +  ++         
Sbjct: 104 SLTEESNDALSPAVRRLLAEHNLEASQVKGSGVGGRITREDIEAHLAANKAKPAAKAEAP 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
              L      S + +P   +RK IA RL ++K          + N+  ++ +R+Q     
Sbjct: 164 VAALAPVVGRSEKRVPMTRLRKRIAERLLEAKNNTAMLTTFNEVNMKPIMDMRKQYQDVF 223

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+VT
Sbjct: 224 EKR---HGIRLGFMSFYVKAVTEALKRYPEVNASIDGDDLVYHNYFDVSIAVSTPRGLVT 280

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D  S+  I   +K+LA++ +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 281 PVLKNCDTLSLAQIEKGIKELAEKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINPP 340

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   + + +  + +I++  +M   LS DHRS+DG  +   L   KE +E+P  +
Sbjct: 341 QAAILGMHKIQDRAMVVDGKIEILPMMYLALSYDHRSIDGRESVGFLVTVKELLEDPARL 400

Query: 422 LM 423
           L+
Sbjct: 401 LL 402


>gi|194289968|ref|YP_002005875.1| dihydrolipoamide succinyltransferase [Cupriavidus taiwanensis LMG
           19424]
 gi|193223803|emb|CAQ69810.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Cupriavidus
           taiwanensis LMG 19424]
          Length = 416

 Score =  292 bits (747), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 103/423 (24%), Positives = 180/423 (42%), Gaps = 9/423 (2%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS ++ E  +  W K+ G+ ++  +IL EIETDK ++E  +   G++ +I
Sbjct: 1   MAIVDVKVPQLSESVAEATMLNWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLSQI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           +   G + +  +  I  I  ++T    +P  +           + ++        +    
Sbjct: 61  VKNDG-DTVVADEVIAKIDTEATAGAAAPAAAAPAPAAAAPAPAAAAAPAAAGAVAMP-- 117

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                A+ +A                       +    +     K      +   + +  
Sbjct: 118 ---SAAKLMAEAGLSAGQVAGTGKDGRITKGDVLGAAAAPAPAAKAAPAPAAKPALQQVS 174

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                        E +P   +R  IA RL QS+ T        + N+  ++ LR +    
Sbjct: 175 APVDFAALGDRPEERVPMSRLRARIAERLLQSQATNAILTTFNEVNMKPVMDLRNKYKDR 234

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P G+V
Sbjct: 235 FEKE---HGVKLGFMSFFVKAAVHALKKFPLINASIDGNDIVYHGYFDIGIAVGSPRGLV 291

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            PI+R ADQ S+ DI  ++ +   +A+  KL  EE  GGT SISN G+ G      +INP
Sbjct: 292 VPILRNADQMSLADIEKKIAEFGVKARDGKLSLEELSGGTFSISNGGVFGSMLSTPIINP 351

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + V ++ +I +  +    +S DHR +DG  A   L   K+ +E+P  
Sbjct: 352 PQSAILGVHATKDRPVVEDGQIVIRPMNYLAMSYDHRIIDGREAVLGLVAMKDALEDPAR 411

Query: 421 MLM 423
           +L+
Sbjct: 412 LLL 414


>gi|84500193|ref|ZP_00998459.1| dihydrolipoamide acetyltransferase [Oceanicola batsensis HTCC2597]
 gi|84392127|gb|EAQ04395.1| dihydrolipoamide acetyltransferase [Oceanicola batsensis HTCC2597]
          Length = 520

 Score =  292 bits (747), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 108/421 (25%), Positives = 188/421 (44%), Gaps = 17/421 (4%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
              + +PSL  +++E  +A W K+EG+ +   ++LCE+ETDK  +E  +   G++ +IL 
Sbjct: 115 TVKVMVPSLGESVSEATVATWFKKEGESVEADEMLCELETDKVSVEVPAPAAGVLSKILK 174

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G E +     +  +             +K       E     +      + S++    
Sbjct: 175 NEG-ETVEAGGQLAELNSGDGG-----GSAKAAPAVQDEGAEGEAYETKPNRGSRSDTED 228

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
           +P A++   E G+    ++G+G  GR++K D+   IS   +               + DA
Sbjct: 229 APSAKKAMAEAGLSRDQVTGTGRDGRVMKEDVAKAISAAKSAPAPEAKAPPRAPVPADDA 288

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
                      E +    +R+TIA RL+ ++ T        + ++  ++ LR+      +
Sbjct: 289 A--------REERVKMTRLRQTIARRLKDAQNTAAILTTYNEVDMTAVMELRKTYKEEFE 340

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                   ++       KA   A+ +VPE N       ++    + + +A   P G+V P
Sbjct: 341 KK---HGVRLGFMSFFTKACCHALNEVPEVNAEIDGTDIVYKNFVHMGIATGTPQGLVVP 397

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           +IR AD  S   I   + +  +RA+  KL   E QGGT +ISN G+ G      ++NPPQ
Sbjct: 398 VIRDADSLSFAGIEKAINEKGKRARDGKLSMAEMQGGTFTISNGGVYGSLMSSPILNPPQ 457

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL +   +++ +  N EI +  +M   LS DHR VDG  A   L + KE +E+P  +L
Sbjct: 458 SGILGMHKIQERPMVVNGEIVIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPQRLL 517

Query: 423 M 423
           M
Sbjct: 518 M 518



 Score =  134 bits (336), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   I +P+L  ++TE  +A W K+ GD +   ++LCE+ETDK  +E  S   G++ +I+
Sbjct: 1  MTTEIRVPTLGESVTEATVATWFKKPGDTVEVDEMLCELETDKVTVEVPSPAAGVLADIV 60

Query: 62 VPAGTENIAVNSPILNILMDSTE 84
             G E + V++ + NI      
Sbjct: 61 AAEG-ETVGVDALLGNISESGNA 82


>gi|221213151|ref|ZP_03586127.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia multivorans CGD1]
 gi|221167364|gb|EED99834.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia multivorans CGD1]
          Length = 430

 Score =  292 bits (746), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 106/432 (24%), Positives = 183/432 (42%), Gaps = 13/432 (3%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL E+ETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G + +  +  I  I  ++             +       +           + +  
Sbjct: 61  LQNDG-DTVVADQVIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAPVAQPAAATAAASTT 119

Query: 121 IASPLARRLAGEHGIDLS---------SLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
            AS      A    +            S            +      +            
Sbjct: 120 AASSGTASPAAAKLLAEKGLSAGDVAGSGRDGRVTKGDALAAGSAPKAAAPAAAPAKAAA 179

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
              L +  + A+          + +P   +R  IA RL +S+QT        + N+  ++
Sbjct: 180 KPALPEVKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVM 239

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISV 291
            LR +     +        K+      +KA   A+ + P  N S   N ++ H + DI +
Sbjct: 240 DLRAKYKDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGI 296

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGI 351
           AV  P G+V PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G 
Sbjct: 297 AVGSPRGLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGS 356

Query: 352 NSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKF 411
                +INPPQS IL + A +++ V +N +I +  I    LS DHR +DG  A   L   
Sbjct: 357 MLSTPIINPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAM 416

Query: 412 KEYIENPVWMLM 423
           K+ +E+P  +L+
Sbjct: 417 KDALEDPARLLL 428


>gi|332288476|ref|YP_004419328.1| dihydrolipoamide succinyltransferase [Gallibacterium anatis UMN179]
 gi|330431372|gb|AEC16431.1| dihydrolipoamide succinyltransferase [Gallibacterium anatis UMN179]
          Length = 403

 Score =  292 bits (746), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 100/421 (23%), Positives = 183/421 (43%), Gaps = 23/421 (5%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           I  I +P L  ++ +  +A W K+ G+ +   ++L EIETDK ++E  +  +G++D I+ 
Sbjct: 4   IEEIVVPDLPESVADATVATWHKKAGEFVKRDEVLVEIETDKVVLEVPAPIDGVLDAIVE 63

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G   +     +  +         +  ++K                        +    
Sbjct: 64  EEGA-TVVSKQLLGKLRAVKEGEETNASVNKTEPTP-------------------SDRQQ 103

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
           + +    + +          +       K     +    T     + + S         A
Sbjct: 104 AAIEPESSNDALSPAVRRLLAENDLDPSKIKGSGVGGRLTREDVEAYLASASKAPAEAVA 163

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
               + A  S + +P   +RK IA RL ++K +        + ++  +  LR+Q     +
Sbjct: 164 EPAPILAARSEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNELDMTPIKKLRKQYGEQFE 223

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                   ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VTP
Sbjct: 224 KK---HGVRLGFMSFYVKAVVEALKRYPEINASLDGDDIVYHNYFDISIAVSTPRGLVTP 280

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R  DQ S+ +I  ++K LA++ +  KL  E+  GG  +I+N G+ G      +INPPQ
Sbjct: 281 VLRDCDQLSMAEIEKQIKSLAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQ 340

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL + A + + V  N ++++  +M   LS DHR VDG  +   L   KE +E+P  +L
Sbjct: 341 SAILGMHAIKDRPVAVNGQVEIRPMMYLALSYDHRLVDGRESVGFLVTIKELLEDPTRIL 400

Query: 423 M 423
           +
Sbjct: 401 L 401


>gi|21283031|ref|NP_646119.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49486253|ref|YP_043474.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|57651913|ref|YP_186300.1| dihydrolipoamide acetyltransferase [Staphylococcus aureus subsp.
           aureus COL]
 gi|87162109|ref|YP_494002.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88195142|ref|YP_499943.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|151221537|ref|YP_001332359.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|161509577|ref|YP_001575236.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221142645|ref|ZP_03567138.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|253733341|ref|ZP_04867506.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus TCH130]
 gi|258452756|ref|ZP_05700753.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus A5948]
 gi|282927660|ref|ZP_06335275.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus A9765]
 gi|284024412|ref|ZP_06378810.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus 132]
 gi|294850784|ref|ZP_06791500.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus A9754]
 gi|297207931|ref|ZP_06924364.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus ATCC 51811]
 gi|300912015|ref|ZP_07129458.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus TCH70]
 gi|81649323|sp|Q6G9E9|ODO2_STAAS RecName: Full=Dihydrolipoyllysine-residue succinyltransferase
           component of 2-oxoglutarate dehydrogenase complex;
           AltName: Full=2-oxoglutarate dehydrogenase complex
           component E2; Short=OGDC-E2; AltName:
           Full=Dihydrolipoamide succinyltransferase component of
           2-oxoglutarate dehydrogenase complex
 gi|81694512|sp|Q5HG07|ODO2_STAAC RecName: Full=Dihydrolipoyllysine-residue succinyltransferase
           component of 2-oxoglutarate dehydrogenase complex;
           AltName: Full=2-oxoglutarate dehydrogenase complex
           component E2; Short=OGDC-E2; AltName:
           Full=Dihydrolipoamide succinyltransferase component of
           2-oxoglutarate dehydrogenase complex
 gi|81762511|sp|Q8NWR7|ODO2_STAAW RecName: Full=Dihydrolipoyllysine-residue succinyltransferase
           component of 2-oxoglutarate dehydrogenase complex;
           AltName: Full=2-oxoglutarate dehydrogenase complex
           component E2; Short=OGDC-E2; AltName:
           Full=Dihydrolipoamide succinyltransferase component of
           2-oxoglutarate dehydrogenase complex
 gi|122539580|sp|Q2FYM2|ODO2_STAA8 RecName: Full=Dihydrolipoyllysine-residue succinyltransferase
           component of 2-oxoglutarate dehydrogenase complex;
           AltName: Full=2-oxoglutarate dehydrogenase complex
           component E2; Short=OGDC-E2; AltName:
           Full=Dihydrolipoamide succinyltransferase component of
           2-oxoglutarate dehydrogenase complex
 gi|123485965|sp|Q2FH26|ODO2_STAA3 RecName: Full=Dihydrolipoyllysine-residue succinyltransferase
           component of 2-oxoglutarate dehydrogenase complex;
           AltName: Full=2-oxoglutarate dehydrogenase complex
           component E2; Short=OGDC-E2; AltName:
           Full=Dihydrolipoamide succinyltransferase component of
           2-oxoglutarate dehydrogenase complex
 gi|21204470|dbj|BAB95167.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49244696|emb|CAG43130.1| dihydrolipoamide succinyltransferase E2 component of 2-oxoglutarate
           dehydrogenase complex [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|57286099|gb|AAW38193.1| 2-oxoglutarate dehydrogenase, E2 component, dihydroipoamide
           succinyltransferase [Staphylococcus aureus subsp. aureus
           COL]
 gi|87128083|gb|ABD22597.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87202700|gb|ABD30510.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|150374337|dbj|BAF67597.1| dihydrolipoamide succinyltransferase E2 component of 2-oxoglutarate
           dehydrogenase complex [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|160368386|gb|ABX29357.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus USA300_TCH1516]
 gi|253728693|gb|EES97422.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus TCH130]
 gi|257859569|gb|EEV82420.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus A5948]
 gi|282592049|gb|EFB97076.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus A9765]
 gi|294822359|gb|EFG38812.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus A9754]
 gi|296887505|gb|EFH26405.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus ATCC 51811]
 gi|300886261|gb|EFK81463.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus TCH70]
 gi|302751242|gb|ADL65419.1| dihydrolipoamide succinyltransferase E2 component of 2-oxoglutarate
           dehydrogenase complex [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|315195875|gb|EFU26242.1| dihydrolipoamide acetyltransferase [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320139562|gb|EFW31432.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Staphylococcus
           aureus subsp. aureus MRSA131]
 gi|320142170|gb|EFW33988.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Staphylococcus
           aureus subsp. aureus MRSA177]
 gi|329314090|gb|AEB88503.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Staphylococcus
           aureus subsp. aureus T0131]
 gi|329730556|gb|EGG66942.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus 21189]
 gi|329733435|gb|EGG69767.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus 21193]
          Length = 422

 Score =  292 bits (746), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 95/421 (22%), Positives = 173/421 (41%), Gaps = 5/421 (1%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            + +P L+ ++TEG +A+W+K  GD +  G+ + E+ETDK  +E  S + G++ E L   
Sbjct: 3   EVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLASE 62

Query: 65  GTENIAVNSPILNI-LMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIAS 123
           G + + V   I  I          +   +     E        +     +K   N+    
Sbjct: 63  G-DTVEVGQAIAIIGEGSGNASKENSNDNTPQQNEETNNKKEETTNNSVDKAEVNQANDD 121

Query: 124 PLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDAN 183
              R  A       +  +G        K++           +             + +  
Sbjct: 122 NQQRINATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQASAKEEK 181

Query: 184 ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQF 243
             N +             +KT A +L +            + ++ N++ LR++       
Sbjct: 182 KYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFMK 241

Query: 244 HREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPI 303
             +    K+       KA   A+ + PE N     + MI  ++ DI VAVS   G++ P 
Sbjct: 242 DHD--GTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPF 299

Query: 304 IRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQS 363
           +R  D+K+  +I  E+  LA +A+++KL  ++   G+ +I+N G+ G      +IN  Q+
Sbjct: 300 VRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQA 359

Query: 364 TILAIGAGEKKVVFQN-EEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
            IL + +   + +  + + I+   +M   LS DHR +DG  A   L   KE IENP  +L
Sbjct: 360 AILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLL 419

Query: 423 M 423
           +
Sbjct: 420 L 420


>gi|113868299|ref|YP_726788.1| dihydrolipoamide succinyltransferase [Ralstonia eutropha H16]
 gi|1709441|sp|P52993|ODO2_RALEH RecName: Full=Dihydrolipoyllysine-residue succinyltransferase
           component of 2-oxoglutarate dehydrogenase complex;
           AltName: Full=2-oxoglutarate dehydrogenase complex
           component E2; Short=OGDC-E2; AltName:
           Full=Dihydrolipoamide succinyltransferase component of
           2-oxoglutarate dehydrogenase complex
 gi|1279202|emb|CAA62981.1| dihydrolipoamide S-succinyltransferase (E2) [Ralstonia eutropha
           H16]
 gi|113527075|emb|CAJ93420.1| Dihydrolipoamide S-succinyltransferase (E2) [Ralstonia eutropha
           H16]
 gi|1588695|prf||2209294C dihydrolipoamide succinyltransferase
          Length = 416

 Score =  292 bits (746), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 113/423 (26%), Positives = 190/423 (44%), Gaps = 9/423 (2%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS ++ E  +  W K+ G+ ++  +IL EIETDK ++E  +   G++  I
Sbjct: 1   MAIVDVKVPQLSESVAEATMLNWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLS-I 59

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           +V    + +  +  I  I  ++T    +P  +           + +              
Sbjct: 60  IVKNDGDTVVADEIIAKIDTEATAGAAAPAAAAPAPAAAAPAPAAAVAAPAAAGGV---- 115

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
            A P A +L  E G+    ++G+G  GRI K D     +        +   +   + +  
Sbjct: 116 -AMPSAAKLMAEAGLSAGQVAGTGKDGRITKGDALAAAAAPAAKAAPAPAAAKPALQQVS 174

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                        E +P   +R  IA RL QS+ T        + N+  ++ LR +    
Sbjct: 175 APVDFAALGDRPEERVPMSRLRARIAERLLQSQSTNAILTTFNEVNMKPVMDLRNKYKDR 234

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P G+V
Sbjct: 235 FEKE---HGVKLGFMSFFVKAAVHALKKFPLINASIDGNDIVYHGYFDIGIAVGSPRGLV 291

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            PI+R ADQ S+ DI  ++ +   +A+  KL  EE  GGT SISN G+ G      +INP
Sbjct: 292 VPILRNADQMSLADIEKKIAEFGVKARDGKLSLEELTGGTFSISNGGVFGSMLSTPIINP 351

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + V ++ +I +  +    +S DHR +DG  A   L   K+ +E+P  
Sbjct: 352 PQSAILGVHATKDRPVVEDGQIVIRPMNYLAMSYDHRIIDGREAVLGLVAMKDALEDPAR 411

Query: 421 MLM 423
           +L+
Sbjct: 412 LLL 414


>gi|304381010|ref|ZP_07363666.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus ATCC BAA-39]
 gi|304340454|gb|EFM06392.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus ATCC BAA-39]
          Length = 422

 Score =  292 bits (746), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 95/421 (22%), Positives = 173/421 (41%), Gaps = 5/421 (1%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            + +P L+ ++TEG +A+W+K  GD +  G+ + E+ETDK  +E  S + G++ E L   
Sbjct: 3   EVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLASE 62

Query: 65  GTENIAVNSPILNILMD-STEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIAS 123
           G + + V   I  I          +   +     E        +     +K   N+    
Sbjct: 63  G-DTVEVGQAIAIIGEGSGNASKENSNDNTPQQNEETNNKKEETTNNSVDKAEVNQANDE 121

Query: 124 PLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDAN 183
              R  A       +  +G        K++           +             + +  
Sbjct: 122 NQQRINATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQASAKEEK 181

Query: 184 ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQF 243
             N +             +KT A +L +            + ++ N++ LR++       
Sbjct: 182 KYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFMK 241

Query: 244 HREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPI 303
             +    K+       KA   A+ + PE N     + MI  ++ DI VAVS   G++ P 
Sbjct: 242 DHD--GTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPF 299

Query: 304 IRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQS 363
           +R  D+K+  +I  E+  LA +A+++KL  ++   G+ +I+N G+ G      +IN  Q+
Sbjct: 300 VRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQA 359

Query: 364 TILAIGAGEKKVVFQN-EEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
            IL + +   + +  + + I+   +M   LS DHR +DG  A   L   KE IENP  +L
Sbjct: 360 AILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLL 419

Query: 423 M 423
           +
Sbjct: 420 L 420


>gi|221197768|ref|ZP_03570814.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia multivorans CGD2M]
 gi|221204674|ref|ZP_03577691.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia multivorans CGD2]
 gi|221175531|gb|EEE07961.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia multivorans CGD2]
 gi|221181700|gb|EEE14101.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Burkholderia multivorans CGD2M]
          Length = 430

 Score =  292 bits (746), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 106/432 (24%), Positives = 184/432 (42%), Gaps = 13/432 (3%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL E+ETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G + +  +  I  I  ++             +       +  +        + +  
Sbjct: 61  LQNDG-DTVVADQVIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAPAAQPAAATAAASTT 119

Query: 121 IASPLARRLAGEHGIDLS---------SLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
            AS      A    +            S            +      +            
Sbjct: 120 AASSGTASPAAAKLLAEKGLSAGDVAGSGRDGRVTKGDALAAGSAPKAAAPAAALAKAAA 179

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
              L +  + A+          + +P   +R  IA RL +S+QT        + N+  ++
Sbjct: 180 KPALPEVKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVM 239

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISV 291
            LR +     +        K+      +KA   A+ + P  N S   N ++ H + DI +
Sbjct: 240 DLRAKYKDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGI 296

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGI 351
           AV  P G+V PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G 
Sbjct: 297 AVGSPRGLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGS 356

Query: 352 NSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKF 411
                +INPPQS IL + A +++ V +N +I +  I    LS DHR +DG  A   L   
Sbjct: 357 MLSTPIINPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAM 416

Query: 412 KEYIENPVWMLM 423
           K+ +E+P  +L+
Sbjct: 417 KDALEDPARLLL 428


>gi|88798683|ref|ZP_01114266.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Reinekea sp. MED297]
 gi|88778446|gb|EAR09638.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Reinekea sp. MED297]
          Length = 424

 Score =  292 bits (746), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 103/425 (24%), Positives = 180/425 (42%), Gaps = 6/425 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I  P    ++ +G +A W KQ G+ +S  ++L +IETDK ++E  +  +G I EI+
Sbjct: 1   MAIEIKAPQFPESVADGSIATWHKQPGEPVSRDELLVDIETDKVVLEVVAPADGTIKEII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSH---SSPVVVREKHSKN 118
              G + +     I      + +   S     E+  +     +         +     K 
Sbjct: 61  KGEG-DTVLSQELIGQFEEGAADASGSDDAPAESAKDAEAATAESGADDDTPMSPAARKL 119

Query: 119 RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDE 178
                  A  + G       +            +  +   S   NV          +   
Sbjct: 120 ADENQLSASDIVGTGKGGRITKEDVVKAAAEKPATDKPAASADNNVAHSMPGMMPQMESA 179

Query: 179 SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMN 238
           S   +        S + +P   +RK IA RL  +K +        + N+  ++ LR++  
Sbjct: 180 SSAGSAGIPATARSEKRVPMTRLRKRIAERLLDAKNSTAMLTTFNEVNMQPIMDLRKKYK 239

Query: 239 RTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGG 298
              +        ++      +KA   A+ + PE N S   + ++ H   DI VAVS   G
Sbjct: 240 DQFEKTHN--GTRLGFMSFFVKAATEALRRHPEVNASIDGDDVVYHGFYDIGVAVSSNRG 297

Query: 299 IVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVI 358
           +V PI+R  +Q S+  I   ++   +RA+  +L  +E QGGT +ISN G+ G      ++
Sbjct: 298 LVVPILRDTEQMSLAGIESTIRDFGERAQAGQLGIDEMQGGTFTISNGGVFGSLLSTPIL 357

Query: 359 NPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENP 418
           NPPQ+ IL +   +++ +  N E+KV  +M   LS DHR +DG  A + L   K+ +E+P
Sbjct: 358 NPPQTAILGMHKIQERPMAVNGEVKVLPMMYLALSYDHRLIDGKEAVQFLVAIKDMLEDP 417

Query: 419 VWMLM 423
             +L+
Sbjct: 418 ARILL 422


>gi|153207719|ref|ZP_01946366.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Coxiella burnetii 'MSU Goat Q177']
 gi|165919001|ref|ZP_02219087.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Coxiella burnetii RSA 334]
 gi|212212233|ref|YP_002303169.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Coxiella burnetii
           CbuG_Q212]
 gi|212218995|ref|YP_002305782.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Coxiella burnetii
           CbuK_Q154]
 gi|120576415|gb|EAX33039.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Coxiella burnetii 'MSU Goat Q177']
 gi|165917326|gb|EDR35930.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Coxiella burnetii RSA 334]
 gi|212010643|gb|ACJ18024.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Coxiella burnetii
           CbuG_Q212]
 gi|212013257|gb|ACJ20637.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Coxiella burnetii
           CbuK_Q154]
          Length = 405

 Score =  292 bits (746), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 111/422 (26%), Positives = 199/422 (47%), Gaps = 19/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++++  +AKW K+EGD IS  + L ++ETDK ++E  +  +G++++I+
Sbjct: 1   MAIEIKVPTLPESVSDATVAKWYKKEGDSISRDENLVDLETDKVMLEVPAPKDGVVEKIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +  +  +  +              ++   + +E+         +EK  +    
Sbjct: 61  AKEG-EVVKADQILALLKEGGAVAKEKEKKDEKETKKEKEKKEEKKDKEKKEKTEEKESD 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            SP  RR+  E  +D+  + GSG  GRI K D+E  +  +                E   
Sbjct: 120 LSPAVRRMVSEKDVDVEEIEGSGKGGRITKKDVEDYLEKQK---------------EKPS 164

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                   + + + +P   IR+ IA RL Q +Q         + N+  ++ LR++     
Sbjct: 165 EGKEGPADERTEKRVPLSRIRQRIAERLVQVQQEAALLTTFNEINMQPVMELRKKYREEF 224

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +   +    ++       KA   A+ + P  N S   + +I H + DI +A+    G++ 
Sbjct: 225 EKKFK---VRLGFMSFFTKAVVEALKRFPMVNASIDGSDIIYHNYYDIGIAIGTERGLIV 281

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI+R A++ ++ DI  ++++ A RA++ +L  EE  GGT +I+N G  G      +INPP
Sbjct: 282 PILRNAEKMNMADIEKQIREYASRAQEGRLNIEELTGGTFTITNGGTYGSLLSTPIINPP 341

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +     +   +N E+ V  IM   LS DHR +DG  A   L   KE +E+P  M
Sbjct: 342 QTAILGMHKIMDRPTVENGEVVVRPIMQVALSYDHRVIDGREAVLFLVTIKELLEDPARM 401

Query: 422 LM 423
           ++
Sbjct: 402 IL 403


>gi|161524919|ref|YP_001579931.1| dihydrolipoamide succinyltransferase [Burkholderia multivorans ATCC
           17616]
 gi|189350331|ref|YP_001945959.1| dihydrolipoamide succinyltransferase [Burkholderia multivorans ATCC
           17616]
 gi|160342348|gb|ABX15434.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia multivorans ATCC
           17616]
 gi|189334353|dbj|BAG43423.1| 2-oxoglutarate dehydrogenase E2 component [Burkholderia multivorans
           ATCC 17616]
          Length = 430

 Score =  292 bits (746), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 106/432 (24%), Positives = 184/432 (42%), Gaps = 13/432 (3%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL E+ETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G + +  +  I  I  ++             +       +  +        + +  
Sbjct: 61  LQNDG-DTVVADQVIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAPAAQPAAATAAASTA 119

Query: 121 IASPLARRLAGEHGIDLS---------SLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
            AS      A    +            S            +      +            
Sbjct: 120 TASSGTASPAAAKLLAEKGLSAGDVAGSGRDGRVTKGDALAAGSAPKAAAPAAAPAKAAA 179

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
              L +  + A+          + +P   +R  IA RL +S+QT        + N+  ++
Sbjct: 180 KPALPEVKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVM 239

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISV 291
            LR +     +        K+      +KA   A+ + P  N S   N ++ H + DI +
Sbjct: 240 DLRAKYKDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGI 296

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGI 351
           AV  P G+V PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G 
Sbjct: 297 AVGSPRGLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGS 356

Query: 352 NSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKF 411
                +INPPQS IL + A +++ V +N +I +  I    LS DHR +DG  A   L   
Sbjct: 357 MLSTPIINPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAM 416

Query: 412 KEYIENPVWMLM 423
           K+ +E+P  +L+
Sbjct: 417 KDALEDPARLLL 428


>gi|330816703|ref|YP_004360408.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia gladioli BSR3]
 gi|327369096|gb|AEA60452.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia gladioli BSR3]
          Length = 427

 Score =  292 bits (746), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 120/429 (27%), Positives = 202/429 (47%), Gaps = 10/429 (2%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL E+ETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLSQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK--N 118
           L   G + +  +  I  I  ++     +    +  +       +  +    +   +   +
Sbjct: 61  LQNDG-DTVVADQVIATIDTEAKAGAVAAAAGEAEVRPAPAPVAVEAAPAAQAAAASGSS 119

Query: 119 RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDE 178
              ASP A +L  E G+D S +SG+G  GRI K D     +T           +      
Sbjct: 120 NTTASPAAAKLLAEKGVDPSQVSGTGRDGRITKGDALGANATPVKAASAPAAAAPKKAAA 179

Query: 179 ----SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLR 234
                + A+          + +P   +R  IA RL +S+QT        + N+  ++ LR
Sbjct: 180 LPDVKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLR 239

Query: 235 EQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVS 294
            +     +        K+      +KA   A+ + P  N S   N ++ H + DI +AV 
Sbjct: 240 AKYKDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVG 296

Query: 295 IPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSF 354
            P G+V PI+R ADQ S+ DI  ++ +  Q+AK  KL  EE  GGT SISN G+ G    
Sbjct: 297 SPRGLVVPILRNADQLSLADIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLS 356

Query: 355 CAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEY 414
             +INPPQS IL + A +++ V +N +I +  I    LS DHR +DG  A   L   K+ 
Sbjct: 357 TPIINPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDA 416

Query: 415 IENPVWMLM 423
           +E+P  +L+
Sbjct: 417 LEDPARLLL 425


>gi|254467335|ref|ZP_05080746.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Rhodobacterales bacterium Y4I]
 gi|206688243|gb|EDZ48725.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Rhodobacterales bacterium Y4I]
          Length = 497

 Score =  292 bits (746), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 94/422 (22%), Positives = 166/422 (39%), Gaps = 22/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
               + +P+L  +++E  ++ W K+ GD ++  ++LCE+ETDK  +E  +   G++ EIL
Sbjct: 96  APVPVMVPALGESVSEATVSSWFKKVGDSVAQDEMLCELETDKVSVEVPAPAAGVLTEIL 155

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  +                                           
Sbjct: 156 AEEGA-TVNAGGKLAVLSAGEAGAAGGTDAGPAADAAGGTST------------------ 196

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +    + A      ++         +    D   +          +          +  
Sbjct: 197 GAGAGVKNAPSAEKAMAEAGIDASQVKGTGRDGRIMKEDVAAALAAAKSAPASAPAPAQV 256

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
              +        E +    +R+TIA RL+ ++ T        + ++  +++LR Q     
Sbjct: 257 RGPVTADDAAREERVKMTRLRQTIAKRLKDAQNTAAILTTYNEVDMTEVMALRNQYKDQF 316

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++       KA   A+ +VPE N       ++    + + VA   P G+V 
Sbjct: 317 EKK---HGVRLGFMSFFTKACCHALKEVPEVNAEIDGTDIVYKNFVHMGVAAGTPQGLVV 373

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR AD  S  +I   + +  +RA+  KL   E QGGT +ISN G+ G      ++NPP
Sbjct: 374 PVIRDADAMSFAEIEKAIAEKGKRARDGKLSMAEMQGGTFTISNGGVYGSLMSSPILNPP 433

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   + + +  N EIK+  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 434 QSGILGMHKIQDRPMVINGEIKIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRL 493

Query: 422 LM 423
           LM
Sbjct: 494 LM 495



 Score =  107 bits (266), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 15 MTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSP 74
          MTE  +A W K+ GD ++  ++LCE+ETDK  +E  S   G + EI+   G E + V++ 
Sbjct: 1  MTEATVATWFKKPGDSVNADEMLCELETDKVTVEVPSPAAGTLGEIVAGEG-ETVGVDAL 59

Query: 75 ILNILM 80
          +  +  
Sbjct: 60 LATLTE 65


>gi|85709015|ref|ZP_01040081.1| dihydrolipoamide acetyltransferase [Erythrobacter sp. NAP1]
 gi|85690549|gb|EAQ30552.1| dihydrolipoamide acetyltransferase [Erythrobacter sp. NAP1]
          Length = 408

 Score =  292 bits (746), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 103/422 (24%), Positives = 168/422 (39%), Gaps = 16/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   IT+P L  ++TEG + +W+KQ GD ++  + +  +ETDK  ++  S   G++ E  
Sbjct: 1   MATEITVPQLGESVTEGSIGEWLKQPGDAVAVDEPIASLETDKVAVDVPSPVAGVLSEHR 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + V + I  I   +T                       +     E   K    
Sbjct: 61  AEVG-DTVEVGAVIAVIEEGATGAATKGEEPA------------RAQEKREEGEEKREDQ 107

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A    +    +  S   G      +              +         +  
Sbjct: 108 EVTQTLSPAVRRAVLEHGVDPSTIKGTGKDGRLTKEDVIAAAKAKGDSPAPSPTPTPAPA 167

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                     + E +    +R+TIA RL+ ++          D ++  ++  R +     
Sbjct: 168 PTATATGEGRNEERVKMTRMRQTIAKRLKGAQDNAALLTTFNDVDMTAVIEARTKYKDLF 227

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
                    ++       KA  LA+  VP  N     + ++ H ++DISVAVS P G+V 
Sbjct: 228 AKK---HDIRLGFMGFFAKAACLALKDVPSVNAYIEGDEIVYHDYVDISVAVSAPNGLVV 284

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+K    I  ++    +RAK   L   +  GGT +ISN G+ G      +INPP
Sbjct: 285 PVVRDCDKKGFAQIEKDIADYGKRAKDGTLTMADMTGGTFTISNGGVFGSLMSTPIINPP 344

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS +L +   E + V  N E+K+  +M   LS DHR +DG  A   L   KE IE+P  M
Sbjct: 345 QSAVLGLHRIEDRPVAINGEVKIRPMMYIALSYDHRLIDGREAVTALKIIKEAIEDPTRM 404

Query: 422 LM 423
           L+
Sbjct: 405 LI 406


>gi|186476478|ref|YP_001857948.1| dihydrolipoamide succinyltransferase [Burkholderia phymatum STM815]
 gi|184192937|gb|ACC70902.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia phymatum STM815]
          Length = 423

 Score =  292 bits (746), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 106/425 (24%), Positives = 187/425 (44%), Gaps = 6/425 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL EIETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           +   G + +  +  I  I  +      +     +   +     + ++        S    
Sbjct: 61  IKNDG-DIVTADEVIAKIDTEGKPGAAAVEAEVKPAPQAEPVAAAAAQAAAVAGASTAAS 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
            A+       G    D++     G   +          +        +  ++       +
Sbjct: 120 PAATKILAEKGVAASDVAGTGRDGRITKQDAVAAGAPAAKAAPAPAAAPARAAKPSLPQV 179

Query: 181 DANILNLFA--KDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMN 238
            A             + +P   +R  IA RL +S+QT        + N+  ++ LR +  
Sbjct: 180 GAPASAEQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMDLRNKYK 239

Query: 239 RTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGG 298
              +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P G
Sbjct: 240 DKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRG 296

Query: 299 IVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVI 358
           +V PI+R ADQ S+ DI  ++ +  Q+AK  KL  EE  GGT SISN G+ G      +I
Sbjct: 297 LVVPILRNADQMSLADIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPII 356

Query: 359 NPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENP 418
           NPPQS IL + A +++ V +N +I +  +    LS DHR +DG  A   L   K+ +E+P
Sbjct: 357 NPPQSAILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDALEDP 416

Query: 419 VWMLM 423
             +L+
Sbjct: 417 ARLLL 421


>gi|83950476|ref|ZP_00959209.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Roseovarius
           nubinhibens ISM]
 gi|83838375|gb|EAP77671.1| pyruvate dehydrogenase complex, E2 component,
           dihydrolipoamideacetyltransferase [Roseovarius
           nubinhibens ISM]
          Length = 429

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 191/432 (44%), Positives = 265/432 (61%), Gaps = 21/432 (4%)

Query: 8   MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTE 67
           MP+LSPTM EG LAKW+ +EGD +S GD+L EIETDKA MEFE+VDEG+I +ILV  G+E
Sbjct: 1   MPALSPTMEEGTLAKWLVKEGDTVSSGDLLAEIETDKATMEFEAVDEGVIGKILVAEGSE 60

Query: 68  NIAVNSPILNILMDSTEIPP-----------SPPLSKENIVEVREEHSHSSPVVVREKHS 116
            + VN+PI  +L +                      K +     E    +S      K  
Sbjct: 61  GVKVNTPIAVLLEEGESADDIGEASAPAAEPKAEAPKSDAAPKPEAAPAASAAPAAPKAD 120

Query: 117 KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLV 176
             R  ASPLARR+A + G+DLS +SGSGP GRIVK+D+E    +           +    
Sbjct: 121 GERIFASPLARRIAADKGLDLSQISGSGPRGRIVKADVENAQPSAAKPAAKDQPAAAPAA 180

Query: 177 DE-----SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
                     + ++ ++    YE IP + +RKTIA RL ++KQ+IPHFY+  D  +D LL
Sbjct: 181 AAPAATGPSSSQVIAMYEGREYEEIPLNGMRKTIAARLTEAKQSIPHFYLRRDIRLDALL 240

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISV 291
             R Q+N+ L+      S K+SVND I+KA ALA+  VP AN  W  + +++ K  D++V
Sbjct: 241 KFRGQLNKQLEAR----SVKLSVNDFIIKACALALQTVPAANAVWAGDRVLQLKPSDVAV 296

Query: 292 AVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGI 351
           AV+I GG+ TP+++ A+ KS+  +S E+K LA RA+ RKL P EYQGG+ +ISN+GM GI
Sbjct: 297 AVAIEGGLFTPVLKDAEMKSLSALSSEMKDLASRARDRKLAPHEYQGGSFAISNLGMFGI 356

Query: 352 NSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHRSVDGAIASKLLAK 410
           ++F AVINPP   ILA+GAG KK V   + E+ VAT+M+ TLS DHR +DGA+ ++LL  
Sbjct: 357 DNFDAVINPPHGAILAVGAGVKKPVVGADGELSVATVMSVTLSVDHRVIDGALGAQLLDA 416

Query: 411 FKEYIENPVWML 422
             + +ENP+ ML
Sbjct: 417 IVQNLENPMVML 428


>gi|119386597|ref|YP_917652.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Paracoccus
           denitrificans PD1222]
 gi|119377192|gb|ABL71956.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Paracoccus denitrificans PD1222]
          Length = 434

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 161/437 (36%), Positives = 234/437 (53%), Gaps = 20/437 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD++  GDIL EIETDKA MEFE+VDEG + +IL
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWLVKEGDEVKSGDILAEIETDKATMEFEAVDEGKLGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +  GT  + VN+PI  +L +                   E  +  +        +     
Sbjct: 61  IAEGTAGVKVNTPIAVLLEEGESADDIGAAPAPKPEAKAEADAPKAEAAAAPAAAAAPAP 120

Query: 122 ASPLARRLAGEHGID----------------LSSLSGSGPHGRIVKSDIETLISTKTNVK 165
           A+P +                            S          V+              
Sbjct: 121 AAPKSADGGRIFASPLARRIAAEKGIDLASVAGSGPHGRIVKADVEGAKPGAAKPAAEAP 180

Query: 166 DYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDC 225
             +   +           IL ++A    E +  D +R+TIA RL ++KQTIPHFY+    
Sbjct: 181 KAAPAPAAAAPAGPSAETILKMYADRETEEVALDGMRRTIAARLSEAKQTIPHFYLRRSA 240

Query: 226 NIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHK 285
            +D L+  R  +N+ L+        K+SVND I+KA ALA+ +VP+AN  W  + +++ K
Sbjct: 241 KLDELMKFRAMLNKQLESR----GVKLSVNDFIIKACALALQEVPDANAVWAGDRILKLK 296

Query: 286 HIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISN 345
             D++VAV+I GG+ TP+++ A QK++  +S E+K LA RAK +KL P EYQGG+ +ISN
Sbjct: 297 PSDVAVAVAIEGGLFTPVLKDAQQKTLSALSAEMKDLANRAKTKKLAPHEYQGGSFAISN 356

Query: 346 MGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIAS 405
           +GM GI +F AVINPP   ILA+GAG +  V +N E+ V  +M+ TLS DHR +DGA+ +
Sbjct: 357 LGMFGIENFDAVINPPHGAILAVGAGIQTPVVENGEVVVRNVMSMTLSVDHRVIDGALGA 416

Query: 406 KLLAKFKEYIENPVWML 422
           +LL    +++ENP+ ML
Sbjct: 417 QLLEAIVKHLENPMGML 433


>gi|283833988|ref|ZP_06353729.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Citrobacter youngae
           ATCC 29220]
 gi|291070122|gb|EFE08231.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Citrobacter youngae
           ATCC 29220]
          Length = 407

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 96/423 (22%), Positives = 177/423 (41%), Gaps = 18/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVRRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S      +  S    
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKETSAKSEEKDSTPAQRQQASLAEQNNDALSPAIR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A +               +                   +          + 
Sbjct: 120 RLLGEHNLEASDI--------------KGTGVGGRITREDVEKHLAKAPAAKDEAKAPAA 165

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                        + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 166 APAPQPQLGARGEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDA 225

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 226 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 282

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI   +K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 283 TPVLRDVDLLGMADIEKNIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 342

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 343 PQSAILGMHAIKDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 402

Query: 421 MLM 423
           +L+
Sbjct: 403 LLL 405


>gi|254474869|ref|ZP_05088255.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Ruegeria sp. R11]
 gi|214029112|gb|EEB69947.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Ruegeria sp. R11]
          Length = 516

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 97/422 (22%), Positives = 177/422 (41%), Gaps = 12/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
               + +P+L  +++E  ++ W K+ GD ++  ++LCE+ETDK  +E  S   G++ EI 
Sbjct: 105 AATDVMVPTLGESVSEATVSTWFKKVGDSVAQDEMLCELETDKVSVEVPSPVAGVLTEIT 164

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G+  +  ++ +  I   ++      P   E     +     +      +  +     
Sbjct: 165 AAEGS-TVDASAKLGVISGGASGAVTPTPTKDETAGGAQYTTPPAGQGGPAKDVANAPSA 223

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              +A        +  +   G      + ++      +   +    +          + D
Sbjct: 224 EKAMAEAGLSADQVQGTGRDGRIMKDDVARAVAAAAAAPAASTSAPAAAAPVRAPVAADD 283

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A           E +    +R+TIA RL+ S+ T        + ++  +++LR +     
Sbjct: 284 AA--------REERVKMTRLRQTIAKRLKDSQNTAAMLTTYNEVDMTEVMALRNEYKDLF 335

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
                    K+       KA   A+ +VPE N       ++    + + +A   P G+V 
Sbjct: 336 LKK---HGVKLGFMSFFTKACCHALKEVPEVNAEIDGTDIVYKNFVHMGIAAGTPTGLVV 392

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR AD  S  DI   + +   RA+  KL   E QGGT +ISN G+ G      ++NPP
Sbjct: 393 PVIRDADAMSFADIEKAIAEKGARARDGKLSMAEMQGGTFTISNGGVYGSLMSSPILNPP 452

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   + + +  N ++++  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 453 QSGILGMHKIQDRPMAINGKVEIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRL 512

Query: 422 LM 423
           LM
Sbjct: 513 LM 514



 Score =  132 bits (331), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   + +P+L  ++TE  +A W K+ GD ++  ++LCE+ETDK  +E  +   G + EI+
Sbjct: 1  MTTEVRVPTLGESVTEATVATWFKKPGDAVAADEMLCELETDKVTVEVPAPAAGTLGEIV 60

Query: 62 VPAGTENIAVNSPILNILMDS 82
             G E + V++ +  I    
Sbjct: 61 AGEG-ETVGVDALLATITEGG 80


>gi|154706182|ref|YP_001424004.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Coxiella burnetii
           Dugway 5J108-111]
 gi|154355468|gb|ABS76930.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Coxiella burnetii
           Dugway 5J108-111]
          Length = 405

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 110/422 (26%), Positives = 199/422 (47%), Gaps = 19/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++++  +AKW K+EGD IS  + L ++ETDK ++E  +  +G++++I+
Sbjct: 1   MAIEIKVPTLPESVSDATVAKWYKKEGDSISRDENLVDLETDKVMLEVPAPKDGVVEKIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +  +  +  +              ++   + +E+         +EK  +    
Sbjct: 61  AKEG-EVVKADQILALLKEGGAVAKEKEKKDEKETKKEKEKKEEKKDKEKKEKTEEKESD 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            SP  RR+  E  +D+  + GSG  GRI K D+E  +  +                E   
Sbjct: 120 LSPAVRRMVSEKDVDVEEIEGSGKGGRITKKDVEDYLEKQK---------------EKPS 164

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                   + + + +P   IR+ +A RL Q +Q         + N+  ++ LR++     
Sbjct: 165 EGKEGPADERTEKRVPLSRIRQRVAERLVQVQQEAALLTTFNEINMQPVMELRKKYREEF 224

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +   +    ++       KA   A+ + P  N S   + +I H + DI +A+    G++ 
Sbjct: 225 EKKFK---VRLGFMSFFTKAVVEALKRFPMVNASIDGSDIIYHNYYDIGIAIGTERGLIV 281

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI+R A++ ++ DI  ++++ A RA++ +L  EE  GGT +I+N G  G      +INPP
Sbjct: 282 PILRNAEKMNMADIEKQIREYASRAQEGRLNIEELTGGTFTITNGGTYGSLLSTPIINPP 341

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +     +   +N E+ V  IM   LS DHR +DG  A   L   KE +E+P  M
Sbjct: 342 QTAILGMHKIMDRPTVENGEVVVRPIMQVALSYDHRVIDGREAVLFLVTIKELLEDPARM 401

Query: 422 LM 423
           ++
Sbjct: 402 IL 403


>gi|161504113|ref|YP_001571225.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865460|gb|ABX22083.1| hypothetical protein SARI_02211 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 406

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 97/423 (22%), Positives = 178/423 (42%), Gaps = 19/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S      +  S    
Sbjct: 61  LEEEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A            +        +       +K                   
Sbjct: 120 RLLAEHNLEASAIKGTGVGGRITREDVEKHLAKAPAKDESKA---------------PET 164

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                        + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 165 APAAQPALGARGEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEV 224

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 225 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 281

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 282 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 341

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 342 PQSAILGMHAIKDRPMAIDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 401

Query: 421 MLM 423
           +L+
Sbjct: 402 LLL 404


>gi|288940047|ref|YP_003442287.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Allochromatium vinosum DSM 180]
 gi|288895419|gb|ADC61255.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Allochromatium vinosum DSM 180]
          Length = 421

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 100/423 (23%), Positives = 180/423 (42%), Gaps = 5/423 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P+L  ++ + ++  W K+ G+ +  G+ L E+ETDK ++E  +   G++ EIL
Sbjct: 1   MSLEVRVPALPESVADARVLTWSKRPGEAVREGENLVELETDKVVLEVPAPRTGVLSEIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +  +  +  I   +  + P+P  +           +  +            P 
Sbjct: 61  AAEGA-MVHTDDVLALISEGAVSVAPAPKPASTPSTAPTATPTPPAAATQPNAPPHVTPS 119

Query: 122 ASPLARR-LAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           A  L +        I                   E     +      +      +     
Sbjct: 120 ARQLVKELHLEPSQIPSRDGRIQKADVLAYLDAREHQAPERHPDLAAAPAAQTPVEPALA 179

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
               L+  A    + +P   +R  IA RL Q++Q         + N+  + +LR +   T
Sbjct: 180 PTPALSGEAGRPEQRVPMTRLRARIAERLLQAQQNAALLTTFNEVNLSAVNALRARYKET 239

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++ +    +KA   A+ + P  N S     ++ H + DI +AVS P G+V
Sbjct: 240 FEQR---HGVRLGLMSFFVKAAVEALQRFPVLNASIDGEDILYHGYYDIGIAVSSPRGLV 296

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            PI+R ADQ  + ++   +    Q+A+   L  EE  GGT SI+N G+ G      ++NP
Sbjct: 297 VPILRNADQLGMAEVEQGIADFGQKARDGSLSYEELTGGTFSITNGGVFGSLLSTPILNP 356

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL +   +++ + +N +I VA +M   L+ DHR +DG  A + L   KE +E+P  
Sbjct: 357 PQSAILGLHKIQERPIVENGQIVVAPMMYLALTYDHRLIDGRDAVQFLVAIKELLEDPAR 416

Query: 421 MLM 423
           +L+
Sbjct: 417 LLL 419


>gi|153835350|ref|ZP_01988017.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio harveyi HY01]
 gi|156973653|ref|YP_001444560.1| dihydrolipoamide acetyltransferase [Vibrio harveyi ATCC BAA-1116]
 gi|148868141|gb|EDL67300.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio harveyi HY01]
 gi|156525247|gb|ABU70333.1| hypothetical protein VIBHAR_01356 [Vibrio harveyi ATCC BAA-1116]
          Length = 402

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 96/422 (22%), Positives = 179/422 (42%), Gaps = 22/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W KQ GD +   ++L +IETDK ++E  + + G+++ I+
Sbjct: 1   MTIEILVPDLPESVADATVATWHKQPGDVVERDEVLVDIETDKVVLEVPAPEAGVLEAII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     I  +   +    P+   +++      + H  +      +  S     
Sbjct: 61  EEEGA-TVLSKQLIAKLKPGAVAGEPTTDSTEDKEASPDKRHKATLTEESNDALSPAVRR 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A +                                 +     +         
Sbjct: 120 LLAEHGLEASQ------------------VKGSGVGGRITREDIEAHLANAKAAPKAEAP 161

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A +    A  S + +P   +RKT+A RL ++K          + N+  ++ LR+Q     
Sbjct: 162 AAVEAPAAARSQKRVPMTRLRKTVANRLLEAKNNTAMLTTFNEVNMKPIMDLRKQYKDQF 221

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 222 EER---HGTRLGFMSFYVKAVTEALKRYPEVNASIDGDDIVYHNYFDISMAVSTPRGLVT 278

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D     DI   +K+LA + +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 279 PVLKDCDTLGFADIEKGIKELAIKGRDGKLTVDELMGGNFTITNGGVFGSLMSTPIINPP 338

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 339 QSAILGMHKIQERPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARL 398

Query: 422 LM 423
           L+
Sbjct: 399 LL 400


>gi|207856181|ref|YP_002242832.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|206707984|emb|CAR32273.1| dihydrolipoamide succinyltransferase component (E2) [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
          Length = 402

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 97/423 (22%), Positives = 180/423 (42%), Gaps = 23/423 (5%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S      +  S    
Sbjct: 61  LEEEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A            +        +  E+                      ++
Sbjct: 120 RLLAEHNLEASAIKGTGVGGRLTREDVEKHLAKGES-------------------KAPAV 160

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
           +            + +P   +RK +A RL  +K +        + N+  ++ LR+Q    
Sbjct: 161 EPAAQPALGARGEKRVPMTRLRKRVAERLLDAKNSTAMLTTFNEVNMKPIMDLRKQYGEV 220

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 221 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 277

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 278 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 337

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 338 PQSAILGMHAIKDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 397

Query: 421 MLM 423
           +L+
Sbjct: 398 LLL 400


>gi|189346888|ref|YP_001943417.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Chlorobium limicola DSM 245]
 gi|189341035|gb|ACD90438.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Chlorobium limicola DSM 245]
          Length = 415

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 115/423 (27%), Positives = 179/423 (42%), Gaps = 10/423 (2%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  +T+  LS +++E  L  W KQ GD ++  +IL E+ETDK + +  S   GI+ EI
Sbjct: 1   MAIIDVTISQLSESVSEATLLNWKKQPGDAVAEDEILFEVETDKVVFDVPSPSSGILFEI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           LV  G   +     +  I  + T         +E   E       S P            
Sbjct: 61  LVGDGGTIVP-GQVLARIDSEGTPAAAPSAPVEEPDSETGTTVHPSEPQSQATSPFAMPS 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
            A  +A        +  +   G    G ++ +                   S   +    
Sbjct: 120 AARLMAESGLDAREVHGTGKQGRIIKGDVLAAIAA------GAEPATPVSASTQKILPVE 173

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
               L +      + +P   +R  IA RL QS+ T        + N+  ++ LR +    
Sbjct: 174 AYRELPVATDRPEQRVPMTRLRARIAERLLQSQSTNAILTTFNEVNMQPVIDLRNRYREA 233

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        K+      +KA   A+ + P  N S     +I H + DI VAVS P G+V
Sbjct: 234 FEKE---HGVKLGFMSFFVKAVVHALRKYPVLNASVDGKDIIYHGYFDIGVAVSSPRGLV 290

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            P++R ADQ SI +I  ++   + +A+   L  EE  GGT S+SN G+ G      +INP
Sbjct: 291 VPVLRNADQMSIAEIERKITDFSTKARLGTLSLEELSGGTFSVSNGGVFGSMLSTPIINP 350

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL I A +++ V +N EI +  +    +S DHR +DG  A   L   K  +E+P  
Sbjct: 351 PQSAILGIHATKERPVVENGEIVIRPMNYLAMSYDHRIIDGKEAVLGLVAIKNALEDPAR 410

Query: 421 MLM 423
           +L+
Sbjct: 411 LLL 413


>gi|157825816|ref|YP_001493536.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           akari str. Hartford]
 gi|157799774|gb|ABV75028.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           akari str. Hartford]
          Length = 412

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 171/422 (40%), Positives = 258/422 (61%), Gaps = 10/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMT G LA+W+K+EGDK++PG+++ EIETDKA ME E+VDEGI+ +I+
Sbjct: 1   MPIKILMPALSPTMTAGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +P  ++N+ VNS I  +     E         +N          S          K+   
Sbjct: 61  IPQNSQNVPVNSLIAVLSEAREEKADIDAFIAKNNNV-------SPSPKPDTNLPKHHEN 113

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            + +  ++A          +           +I+      +        Q       S  
Sbjct: 114 IAKVEEQVAVIKHDTSKIFASPLAKRLAKMGNIKLESVKGSGPHGRIVKQDVLSYTPSTV 173

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            N +     + Y ++P++NIRK IA RL +SKQT+PHFY+SI+CN+D LL +RE +N++ 
Sbjct: 174 HNKIVSRNPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKSF 233

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
               E+ + +ISVND I+ A A A+  VP AN SW  +A+  + ++DISVAV+I  G+VT
Sbjct: 234 ---SEDKATRISVNDFIILAVAKALQAVPNANASWREDAIRYYNNVDISVAVAIENGLVT 290

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI++ A+QK+I++IS E+K+L ++AK  KL PEE+QGG  +ISN+GM G+ +F A+INPP
Sbjct: 291 PIVKNANQKNIIEISREMKKLIKKAKDNKLTPEEFQGGGFTISNLGMYGVKNFNAIINPP 350

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS I+ +GA  K+ + +N++I + TIM+ TLSADHR VDGA+ ++ LA FK++IE+P  M
Sbjct: 351 QSCIMGVGASAKRAIVKNDQITIETIMDVTLSADHRVVDGAVGAEFLAAFKKFIESPALM 410

Query: 422 LM 423
           L+
Sbjct: 411 LI 412


>gi|197261807|ref|ZP_03161881.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197240062|gb|EDY22682.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
          Length = 402

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 97/423 (22%), Positives = 181/423 (42%), Gaps = 23/423 (5%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S      +  S    
Sbjct: 61  LEEEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A            +        +  E+                      ++
Sbjct: 120 RLLTEHNLEASAIKGTGVGGRLTREDVEKHLAKGES-------------------KAPAV 160

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
           +            + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 161 EPAAQPALGARGEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEV 220

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 221 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 277

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 278 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 337

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 338 PQSAILGMHAIKDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 397

Query: 421 MLM 423
           +L+
Sbjct: 398 LLL 400


>gi|15604387|ref|NP_220903.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Rickettsia
           prowazekii str. Madrid E]
 gi|7674152|sp|Q9ZD20|ODP2_RICPR RecName: Full=Dihydrolipoyllysine-residue acetyltransferase
           component of pyruvate dehydrogenase complex; AltName:
           Full=Dihydrolipoamide acetyltransferase component of
           pyruvate dehydrogenase complex; AltName: Full=E2
 gi|3861079|emb|CAA14979.1| DIHYDROLIPOAMIDE ACETYLTRANSFERASE COMPONENT (pdhC) [Rickettsia
           prowazekii]
 gi|292572143|gb|ADE30058.1| Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rickettsia prowazekii Rp22]
          Length = 408

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 172/422 (40%), Positives = 258/422 (61%), Gaps = 14/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LA+W+K+EGDK++PG+++ EIETDKA ME ESVDEGI+ +I+
Sbjct: 1   MPIKILMPALSPTMREGNLARWLKKEGDKVNPGEVIAEIETDKATMEVESVDEGILAKII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +P  ++N+ VNS I  +  +  +         +N        + ++     +  +    I
Sbjct: 61  IPQNSQNVPVNSLIAVLSEEGEDKADIDSFIAQNNSVSLSLKTDATLKKSNDSITNVEGI 120

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                +  A      L+ +                              Q     D S  
Sbjct: 121 KHDSNKIFASPLAKRLAKIGDIRLENVQGSGP-----------HGRIVKQDILSYDSSTS 169

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           +N +     + Y  +P++NIRK IA RL +SKQT+PHFY+SI+CN+D LL +RE +N++ 
Sbjct: 170 SNKIVYRDTEEYRSVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDVREDINKSF 229

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
               E+   KISVND I+ A A A+ +VP AN SW+ +A+  + ++DISVAV+I  GIVT
Sbjct: 230 ---SEDKVTKISVNDFIILAVAKALQEVPNANASWSEDAIRYYNNVDISVAVAIENGIVT 286

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI++ A++K+I+++S E+K L ++AK  KL P E+QGG  +ISN+GM GI +F A+IN P
Sbjct: 287 PIVKDANKKNIIELSREMKTLIKKAKDNKLTPIEFQGGGFTISNLGMYGIKNFNAIINTP 346

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS I+ +GA  K+ + +N++I +ATIM+ TLSADHR +DGA++++ LA FK +IENPV M
Sbjct: 347 QSCIMGVGASTKRAIVKNDQIIIATIMDVTLSADHRVIDGAVSAEFLASFKRFIENPVLM 406

Query: 422 LM 423
           L+
Sbjct: 407 LI 408


>gi|312114095|ref|YP_004011691.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311219224|gb|ADP70592.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 470

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 180/445 (40%), Positives = 255/445 (57%), Gaps = 24/445 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM +GKLAKW+K+EGDK++ GD + EIETDKA ME E+VDEG I +I+
Sbjct: 25  MPTPILMPALSPTMEQGKLAKWLKKEGDKVASGDAIAEIETDKATMEVEAVDEGTIGKIM 84

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  GTE +AVN+PI  +L +  +         E       + + +S  V   K +     
Sbjct: 85  VAEGTEGVAVNTPIALLLGEGEDAAALKSYGAEPPQPAPAKAAQASEPVQVAKVNGAPAA 144

Query: 122 ASPLARRL------------------------AGEHGIDLSSLSGSGPHGRIVKSDIETL 157
           A                               A   G                 +     
Sbjct: 145 APQSNGHNGHDGGRVFASPLARRIAKDAGLDLAAVKGTGPHGRIVKHDVEEAKATGSAKP 204

Query: 158 ISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIP 217
            +     ++   +    L     D  I+ ++ K +YE+ P DN+RKTIA RL Q+ QTIP
Sbjct: 205 AAAAAPTQNGGALVPSRLAAAIPDDQIIAMYEKGTYELRPLDNMRKTIATRLTQATQTIP 264

Query: 218 HFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWT 277
           HF + ++C ID LL  R+++N       +  + K+SVND I+KA  LA+ +VP+AN ++T
Sbjct: 265 HFRLFVECEIDTLLEARQRINMRSPKDGQPGAFKVSVNDFIVKALGLALQRVPDANATFT 324

Query: 278 TNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQ 337
              ++ HK  D+ VAV++ GG+ TP+IR  ++KS+ DIS EVK LA+RA++R+L P EYQ
Sbjct: 325 ERGILLHKASDVGVAVAVEGGLFTPVIRGVERKSLADISNEVKDLAERARKRRLAPHEYQ 384

Query: 338 GGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHR 397
           GGTT++SN+GM G+++F AVINPP +TILA+G GEK+ V +  +I +AT M  TLS DHR
Sbjct: 385 GGTTAVSNLGMFGVDNFDAVINPPHATILAVGRGEKRPVVKGNQIVIATTMGCTLSCDHR 444

Query: 398 SVDGAIASKLLAKFKEYIENPVWML 422
            VDGA+ ++LL  FK YIE PV ML
Sbjct: 445 VVDGALGARLLQAFKGYIEEPVTML 469


>gi|83593214|ref|YP_426966.1| dihydrolipoamide acetyltransferase, long form [Rhodospirillum
           rubrum ATCC 11170]
 gi|83576128|gb|ABC22679.1| Dihydrolipoamide acetyltransferase, long form [Rhodospirillum
           rubrum ATCC 11170]
          Length = 440

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 193/442 (43%), Positives = 267/442 (60%), Gaps = 22/442 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+K+EGD I+ GD++ EIETDKA MEFE+ DEG++ +IL
Sbjct: 1   MPIEILMPALSPTMEEGTLAKWLKKEGDPIAAGDVIAEIETDKATMEFEATDEGVLGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP- 120
           V  GT  I VN PI  +L +  +       +     +   + +     V     S   P 
Sbjct: 61  VADGTAGIKVNQPIGILLEEGEDASALVQAAPAKAPDAPAKAAPEPAPVAAASQSDAAPA 120

Query: 121 --------------IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETL-----ISTK 161
                          ASPLARR+A   G+DL +L GSGPHGRIV+ D+E         T 
Sbjct: 121 PAAAAPKRAAGERLFASPLARRIAAAEGLDLGALQGSGPHGRIVRRDVEAALAAGTGKTA 180

Query: 162 TNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYV 221
                     +      +  A          +  + + ++RK IA RL +SKQT+PHFY+
Sbjct: 181 EKAVAAPVAPAAPPQAVAAAAPKPVALPDAPHTKVANTSMRKIIARRLTESKQTVPHFYL 240

Query: 222 SIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAM 281
           ++DC ID LL LR+ +N   +   +    K+SVND+I+KA ALA+ +VP AN SW+  A+
Sbjct: 241 TVDCKIDALLDLRKSLNARAEKRGD--GVKLSVNDLIIKAVALALRKVPAANASWSDEAI 298

Query: 282 IRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTT 341
           +    +DISVAV+ PGG++TPI+R+ADQK +  IS E+K LA RA+  KLKPEE+QGG  
Sbjct: 299 VLWSDVDISVAVATPGGLITPIVRKADQKGLATISAEMKDLATRARDGKLKPEEFQGGGF 358

Query: 342 SISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDG 401
           SISN+GM GI  F A+INPPQ  ILA+GAGE++ V +   + +AT+M+ TLS DHR VDG
Sbjct: 359 SISNLGMYGIREFAAIINPPQGCILAVGAGEQRPVVEAGALAIATVMSCTLSVDHRVVDG 418

Query: 402 AIASKLLAKFKEYIENPVWMLM 423
           A+ ++ L+ FK  IE+P+ M++
Sbjct: 419 AVGAEFLSAFKILIEDPMAMML 440


>gi|268590347|ref|ZP_06124568.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Providencia rettgeri
           DSM 1131]
 gi|291314257|gb|EFE54710.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Providencia rettgeri
           DSM 1131]
          Length = 403

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 99/423 (23%), Positives = 183/423 (43%), Gaps = 22/423 (5%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  + + G+++ I
Sbjct: 1   MSSVEILVPDLPESVADATVATWHKKPGDSVQRDEVLVEIETDKVVLEVPASEAGVLEAI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           +   G   +     +  I +  +   P+     +     + + +              R 
Sbjct: 61  VEDEGA-TVLSKQLLGRIRLGDSTGIPAEVKEAQESTPAQRQTASLETESNDALTPAIRR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           + +      A   G  +          + + ++                           
Sbjct: 120 LIAEHDLNPADIKGTGVGGRLTREDVEKHLAANK------------------SATPAAKA 161

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                   A  S + +P   +RK IA RL ++K T        + N+  +  LR+Q    
Sbjct: 162 PEAPQAPLAHRSEKRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVNMQPIKDLRKQYGEV 221

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+V
Sbjct: 222 FEKR---HGVRLGFMSFYVKAAVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPRGLV 278

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D  S+ DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 279 TPVLRDVDAMSMADIEKKIKELAVKGRDGKLTVEDLSGGNFTITNGGVFGSLMSTPIINP 338

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG+ +   L   K+ +E+P  
Sbjct: 339 PQSAILGMHAIKDRPMAVNGKVEILPMMYLALSYDHRLIDGSESVGFLVAIKDMLEDPTR 398

Query: 421 MLM 423
           +L+
Sbjct: 399 LLL 401


>gi|16759676|ref|NP_455293.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16764107|ref|NP_459722.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|29142551|ref|NP_805893.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56414146|ref|YP_151221.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62179311|ref|YP_215728.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161615037|ref|YP_001589002.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167993013|ref|ZP_02574108.1| dihydrolipoyllysine-residue succinyltransferase [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|168230615|ref|ZP_02655673.1| dihydrolipoyllysine-residue succinyltransferase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|168238880|ref|ZP_02663938.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168240588|ref|ZP_02665520.1| dihydrolipoyllysine-residue succinyltransferase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|168264340|ref|ZP_02686313.1| dihydrolipoyllysine-residue succinyltransferase [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|168467707|ref|ZP_02701544.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|168820135|ref|ZP_02832135.1| dihydrolipoyllysine-residue succinyltransferase [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|194444650|ref|YP_002039974.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194449786|ref|YP_002044767.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194472905|ref|ZP_03078889.1| dihydrolipoyllysine-residue succinyltransferase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194736917|ref|YP_002113843.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197250453|ref|YP_002145695.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197363068|ref|YP_002142705.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|198243386|ref|YP_002214705.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200391083|ref|ZP_03217694.1| dihydrolipoyllysine-residue succinyltransferase [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204929857|ref|ZP_03220878.1| dihydrolipoyllysine-residue succinyltransferase [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|213649150|ref|ZP_03379203.1| dihydrolipoamide acetyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213851939|ref|ZP_03381471.1| dihydrolipoamide acetyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|224582552|ref|YP_002636350.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|238911667|ref|ZP_04655504.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|289824376|ref|ZP_06543969.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25286449|pir||AE0591 dihydrolipoamide succinyltransferase component (E2) [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16419247|gb|AAL19681.1| 2-oxoglutarate dehydrogenase (dihydrolipoyltranssuccinase E2
           component) [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16501969|emb|CAD05199.1| dihydrolipoamide succinyltransferase component (E2) [Salmonella
           enterica subsp. enterica serovar Typhi]
 gi|29138182|gb|AAO69753.1| dihydrolipoamide succinyltransferase component [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|56128403|gb|AAV77909.1| dihydrolipoamide succinyltransferase component (E2) [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|62126944|gb|AAX64647.1| 2-oxoglutarate dehydrogenase (dihydrolipoyltranssuccinase E2
           component) [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161364401|gb|ABX68169.1| hypothetical protein SPAB_02797 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403313|gb|ACF63535.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194408090|gb|ACF68309.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194459269|gb|EDX48108.1| dihydrolipoyllysine-residue succinyltransferase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194712419|gb|ACF91640.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195629187|gb|EDX48555.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197094545|emb|CAR60065.1| dihydrolipoamide succinyltransferase component (E2) [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
 gi|197214156|gb|ACH51553.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197288334|gb|EDY27715.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197937902|gb|ACH75235.1| dihydrolipoyllysine-residue succinyltransferase [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|199603528|gb|EDZ02074.1| dihydrolipoyllysine-residue succinyltransferase [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204320851|gb|EDZ06052.1| dihydrolipoyllysine-residue succinyltransferase [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205328906|gb|EDZ15670.1| dihydrolipoyllysine-residue succinyltransferase [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205334796|gb|EDZ21560.1| dihydrolipoyllysine-residue succinyltransferase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|205339779|gb|EDZ26543.1| dihydrolipoyllysine-residue succinyltransferase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|205343027|gb|EDZ29791.1| dihydrolipoyllysine-residue succinyltransferase [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|205347170|gb|EDZ33801.1| dihydrolipoyllysine-residue succinyltransferase [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|224467079|gb|ACN44909.1| dihydrolipoamide acetyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|261246000|emb|CBG23802.1| dihydrolipoamide succinyltransferase component (E2) [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           D23580]
 gi|267992475|gb|ACY87360.1| dihydrolipoamide acetyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301157328|emb|CBW16817.1| dihydrolipoamide succinyltransferase component (E2) [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           SL1344]
 gi|312911763|dbj|BAJ35737.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320085006|emb|CBY94795.1| 2-oxoglutarate dehydrogenase (dihydrolipoyltranssuccinase E2
           component) [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|321226312|gb|EFX51363.1| Dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|322615830|gb|EFY12748.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322621226|gb|EFY18083.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322623646|gb|EFY20484.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322628918|gb|EFY25698.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322634898|gb|EFY31628.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322636574|gb|EFY33278.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322641758|gb|EFY38392.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647815|gb|EFY44295.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322651855|gb|EFY48224.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322652648|gb|EFY48997.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322658456|gb|EFY54719.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322668389|gb|EFY64545.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322670523|gb|EFY66656.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322675263|gb|EFY71339.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322679689|gb|EFY75730.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322684835|gb|EFY80834.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322713780|gb|EFZ05351.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323129047|gb|ADX16477.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323193153|gb|EFZ78372.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323200604|gb|EFZ85679.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323202276|gb|EFZ87324.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323205457|gb|EFZ90423.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323213504|gb|EFZ98297.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323215338|gb|EGA00083.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221787|gb|EGA06194.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323228083|gb|EGA12219.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323231011|gb|EGA15127.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323234156|gb|EGA18245.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323238149|gb|EGA22207.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323243584|gb|EGA27602.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323247392|gb|EGA31351.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323251380|gb|EGA35252.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323258481|gb|EGA42153.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323260635|gb|EGA44244.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323264707|gb|EGA48209.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323270971|gb|EGA54406.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326622461|gb|EGE28806.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|332987674|gb|AEF06657.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 402

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 97/423 (22%), Positives = 181/423 (42%), Gaps = 23/423 (5%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S      +  S    
Sbjct: 61  LEEEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A            +        +  E+                      ++
Sbjct: 120 RLLAEHNLEASAIKGTGVGGRLTREDVEKHLAKGES-------------------KAPAV 160

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
           +            + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 161 EPAAQPALGARGEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEV 220

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 221 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 277

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 278 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 337

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 338 PQSAILGMHAIKDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 397

Query: 421 MLM 423
           +L+
Sbjct: 398 LLL 400


>gi|205352001|ref|YP_002225802.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205271782|emb|CAR36616.1| dihydrolipoamide succinyltransferase component (E2) [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|326627041|gb|EGE33384.1| dihydrolipoamide succinyltransferase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 402

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 97/423 (22%), Positives = 181/423 (42%), Gaps = 23/423 (5%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASVDGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S      +  S    
Sbjct: 61  LEEEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A            +        +  E+                      ++
Sbjct: 120 RLLAEHNLEASAIKGTGVGGRLTREDVEKHLAKGES-------------------KAPAV 160

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
           +            + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 161 EPAAQPALGARGEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEV 220

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 221 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 277

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 278 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 337

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 338 PQSAILGMHAIKDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 397

Query: 421 MLM 423
           +L+
Sbjct: 398 LLL 400


>gi|86143916|ref|ZP_01062284.1| Dihydrolipoamide acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [Leeuwenhoekiella blandensis
           MED217]
 gi|85829623|gb|EAQ48086.1| Dihydrolipoamide acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [Leeuwenhoekiella blandensis
           MED217]
          Length = 559

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 143/430 (33%), Positives = 229/430 (53%), Gaps = 18/430 (4%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  +TMP LS TM EG +A W+K+EGD +  GDIL EIETDKA MEFES  +G +  I +
Sbjct: 137 VEVVTMPRLSDTMEEGTVASWLKKEGDSVDEGDILAEIETDKATMEFESFYKGTLLHIGI 196

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G E   V+S +  I  + T++       K    +         P     K  + +  A
Sbjct: 197 QEG-ETAKVDSLLAIIGEEGTDVSGVISNFKSGGAKKEAPKKEEKPKKEAPKKEEAKKEA 255

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
                    E     ++ S  G       +            K   + ++  +V + I+ 
Sbjct: 256 PKKEAPKKEESKPAKNTSSSDGRIFASPLAKKLAEEKGIDLAKVPGSGENGRVVRKDIEN 315

Query: 183 NILNLFA----------KDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232
                            ++SYE + +  +RK IA  L +SK T PH+Y++++ +++N+++
Sbjct: 316 YTPAASGAGVQQFVATGEESYEDVNNSQMRKAIAKSLGKSKFTAPHYYLNVEFDMENMIA 375

Query: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVA 292
            R Q         +    K+S ND+I+KA ++A+ Q P+ N  W  + M  + H+ I VA
Sbjct: 376 FRSQ-------FNQLPDTKVSYNDMIIKAVSIALKQHPQVNSQWFDDKMRLNNHVHIGVA 428

Query: 293 VSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGIN 352
           V++P G+V P++  A++KS+  I+ EVK+LA +A+ +KLKPEE QG T +ISN+GM GI 
Sbjct: 429 VAVPDGLVVPVVEFANEKSLQQINAEVKELAGKARNKKLKPEEMQGSTFTISNLGMFGIT 488

Query: 353 SFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFK 412
           +F ++IN P S IL++G+  +K V ++ +I V   M  +++ DHR++DGA  ++ L   K
Sbjct: 489 NFTSIINQPNSAILSVGSIIEKPVVKDGKIVVGNTMTLSMACDHRTIDGATGAQFLQTLK 548

Query: 413 EYIENPVWML 422
            YIENPV ML
Sbjct: 549 TYIENPVLML 558



 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/84 (47%), Positives = 52/84 (61%), Gaps = 1/84 (1%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   I MP LS TM EG +A W+K++GDK+  GDIL EIETDKA MEFES  EG +  I 
Sbjct: 1  MAEVIKMPRLSDTMEEGTVASWLKKKGDKVEEGDILAEIETDKATMEFESFYEGTLLHIG 60

Query: 62 VPAGTENIAVNSPILNILMDSTEI 85
          +  G E   V++ +  I  +  +I
Sbjct: 61 IEEG-ETANVDALLAIIGEEGEDI 83


>gi|254474944|ref|ZP_05088330.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Ruegeria sp. R11]
 gi|214029187|gb|EEB70022.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Ruegeria sp. R11]
          Length = 442

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 165/445 (37%), Positives = 239/445 (53%), Gaps = 28/445 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD ++ GD+L EIETDKA MEFE+VDEG+I +IL
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWLVKEGDTVASGDLLAEIETDKATMEFEAVDEGVIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +  G+E + VNSPI  +L D                      + S         +     
Sbjct: 61  IAEGSEGVKVNSPIAILLEDGESADDIGATPAAPAAAEDTAPAASKDASPAPAQAAAAAT 120

Query: 122 ASPLARRL-----------------------AGEHGIDLSSLSGSGPHGRIVKSDIETLI 158
            +P A                          A   G                 +      
Sbjct: 121 PAPAAPAGADGSRIFASPLARRIAADKGLDLADISGSGPRGRIVKADVENATAAPKAAAA 180

Query: 159 STKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPH 218
           +        +   +           +  ++    YE +  D +RKTIA RL ++KQTIPH
Sbjct: 181 APAAAAPAAAAPAAAAAASGPTADQVARMYEGRDYEEVALDGMRKTIAARLSEAKQTIPH 240

Query: 219 FYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTT 278
           FY+  D  +D LL  R ++N+ L+        K+SVND I+KA ALA+  VP+AN  W  
Sbjct: 241 FYLRRDIQLDALLKFRAELNKQLEGR----GVKLSVNDFIIKAVALALQAVPDANAVWAG 296

Query: 279 NAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQG 338
           + +++ K  D++VAV+I GG+ TP+++ +D KS+  +S E+K LA+RA+ RKL P EYQG
Sbjct: 297 DRVLKMKSSDVAVAVAIEGGLFTPVLQDSDMKSLSTLSAEMKDLAKRARDRKLAPHEYQG 356

Query: 339 GTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHR 397
           G+ +ISN+GM GI++F A++NPP + ILA+G+G KK V   + E+KVAT+M+ T+S DHR
Sbjct: 357 GSFAISNLGMFGIDNFDAIVNPPHAGILAVGSGVKKPVVGADGELKVATVMSVTMSVDHR 416

Query: 398 SVDGAIASKLLAKFKEYIENPVWML 422
            +DGA+ + LL    E +ENP+ ML
Sbjct: 417 VIDGALGADLLKAIVENLENPMTML 441


>gi|288556780|ref|YP_003428715.1| dihydrolipoamide succinyltransferase [Bacillus pseudofirmus OF4]
 gi|288547940|gb|ADC51823.1| dihydrolipoamide succinyltransferase [Bacillus pseudofirmus OF4]
          Length = 419

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 103/422 (24%), Positives = 180/422 (42%), Gaps = 6/422 (1%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I +P L+ ++TEG +A+W+KQ G++++ G+ + E+ETDK  +E  +   G+I E   
Sbjct: 1   MIEIKVPELAESITEGTIAQWLKQVGEQVNQGEYIAELETDKVNVEITAEHSGVIKEFKK 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G + + V   I  I         +   + +   +   +          E   +     
Sbjct: 61  EPG-DTVEVGEVIAVIDESGDASASTEAPAAKEEPKEEPKAEAPKAEAAEETQEETSSTD 119

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
            PLA   A +   +                  +  + +  +    +         +   A
Sbjct: 120 RPLASPAARKLAREKGIDLKEVATNDPTGRIRKQDVESHQSQPKAAPQAKSEAPAKKPQA 179

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
              +   K   E I     R+TIA RL +S+QT        + ++  ++ LR++      
Sbjct: 180 AAADQPGK-PVERIKMSRRRQTIAKRLVESQQTAAMLTTFNEVDMSAVMDLRKRRKDGF- 237

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
              E+   K+       KA   A+ + P  N     + ++  K+ DI VAVS   G+V P
Sbjct: 238 --LEKNGVKLGFMSFFTKAVIGALKEFPLLNAEIQGDEILMKKYYDIGVAVSTDEGLVVP 295

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R AD+     I  E+  L ++A+  KL   + QGGT +I+N G+ G      ++N PQ
Sbjct: 296 VVRDADRLGFAGIEREIGSLGKKARDNKLAISDLQGGTFTITNGGVFGSLWSTPILNAPQ 355

Query: 363 STILAIGAGEKKVVFQN-EEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
             IL +   + + V  + E  +   +M   LS DHR VDG  A   L K KE +E+P  +
Sbjct: 356 VGILGMHKVQWRPVAIDQENFENRPMMYIALSYDHRIVDGKEAVSFLVKVKELLEDPEQL 415

Query: 422 LM 423
           L+
Sbjct: 416 LL 417


>gi|27363639|ref|NP_759167.1| dihydrolipoamide succinyltransferase [Vibrio vulnificus CMCP6]
 gi|37679217|ref|NP_933826.1| dihydrolipoamide acetyltransferase [Vibrio vulnificus YJ016]
 gi|320157040|ref|YP_004189419.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio vulnificus
           MO6-24/O]
 gi|27359755|gb|AAO08694.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Vibrio vulnificus CMCP6]
 gi|37197960|dbj|BAC93797.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           [Vibrio vulnificus YJ016]
 gi|319932352|gb|ADV87216.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio vulnificus
           MO6-24/O]
          Length = 402

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 97/422 (22%), Positives = 183/422 (43%), Gaps = 22/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W K+ GD++   ++L +IETDK ++E  + + GI++ I+
Sbjct: 1   MTIEILVPDLPESVADATVATWHKKPGDRVERDEVLVDIETDKVVLEVPASEAGILEAIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     I  I + +    P+   ++E+     + H+ S      +  S     
Sbjct: 61  EEEGA-TVLSKQLIGRIKLAAVAGEPTADTTEESEPSPDKRHTASLSEESNDALSPAVRR 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A +                                 +     +      +  
Sbjct: 120 LLAEHSLEASQ------------------VKGTGVGGRITREDIEAHLAAAKQAPAVAEA 161

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
              +   A  S + +P   +RKT+A RL ++K +        + N+  ++ LR+Q     
Sbjct: 162 PAAVAPVAARSEKRVPMTRLRKTVANRLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDQF 221

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 222 EAR---HGIRLGFMSFYVKAVTEALKRYPEINASIDGDDIVYHNYFDISMAVSTPRGLVT 278

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D     D+   +K+LA + +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 279 PVLKDCDTLGFADVEKGIKELAIKGRDGKLTVDELIGGNFTITNGGVFGSLMSTPIINPP 338

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 339 QSAILGMHKIQDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTVKELLEDPARL 398

Query: 422 LM 423
           L+
Sbjct: 399 LL 400


>gi|295135749|ref|YP_003586425.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Zunongwangia profunda SM-A87]
 gi|294983764|gb|ADF54229.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Zunongwangia profunda SM-A87]
          Length = 539

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 150/424 (35%), Positives = 230/424 (54%), Gaps = 12/424 (2%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  + MP LS TM EG +A W+K+EGDK+S GDIL EIETDKA MEFES  EG + +I +
Sbjct: 123 VEIVKMPRLSDTMEEGTVASWLKKEGDKVSEGDILAEIETDKATMEFESFYEGTLLKIGI 182

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
           P G E   V+S +  I  + T++      S       ++E    +    +E+ +     +
Sbjct: 183 PEG-ETAPVDSLLAIIGPEGTDVSNVTGDSTGKKAAPKKEEKSEAKEEKKEETTTTSSDS 241

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID- 181
           S    R+         +        ++  S     I  K       +        +    
Sbjct: 242 SSEGGRIFASPLAKKMAEDKGIDLSKVEGSGENGRIVKKDIESYKPSEAPAPKETKKEAE 301

Query: 182 ---ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMN 238
              A       ++S+E I +  +RKTIA RL +SK + PH+Y++I+ +++N ++ R+Q+N
Sbjct: 302 TSVAAPYVPAGEESFEEIKNSQMRKTIAKRLGESKFSAPHYYLTIEVDMENAMASRKQIN 361

Query: 239 RTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGG 298
                       K+S ND+++KA A+A+ + P+ N  WT +AM   KHI + VAV++  G
Sbjct: 362 EM-------PDVKVSFNDMVIKASAMALRKHPQVNSQWTGDAMKIAKHIHMGVAVAVEDG 414

Query: 299 IVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVI 358
           +V P+++ ADQ S+  I   VK LA +A+ +KL+P+E +G T ++SN+GM GI  F ++I
Sbjct: 415 LVVPVLKFADQMSMTQIGGNVKDLAGKARNKKLQPKEMEGSTFTVSNLGMFGITEFTSII 474

Query: 359 NPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENP 418
           N P S IL++G   +K V +N EI V   M  TL+ DHR+VDGA  +  L   K YIENP
Sbjct: 475 NQPNSAILSVGTIVEKPVVKNGEIVVGHTMKLTLACDHRTVDGATGAAFLKDLKTYIENP 534

Query: 419 VWML 422
           V ML
Sbjct: 535 VTML 538



 Score =  127 bits (319), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 54/84 (64%), Gaps = 1/84 (1%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   I MP LS TM EG +AKW+KQ+GDK++ GDIL EIETDKA MEFES  EG +  I 
Sbjct: 1  MAEVINMPRLSDTMEEGVVAKWLKQKGDKVAEGDILAEIETDKATMEFESFYEGTLLHIG 60

Query: 62 VPAGTENIAVNSPILNILMDSTEI 85
          +  G E   V++ +  I  +  +I
Sbjct: 61 IEEG-ETAPVDTLLAIIGEEGEDI 83


>gi|114769292|ref|ZP_01446918.1| dihydrolipoamide acetyltransferase [alpha proteobacterium HTCC2255]
 gi|114550209|gb|EAU53090.1| dihydrolipoamide acetyltransferase [alpha proteobacterium HTCC2255]
          Length = 392

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 101/421 (23%), Positives = 174/421 (41%), Gaps = 31/421 (7%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  + +P+L  ++TE  LA W K+ GD +   +++CE+ETDK  +E  +   G + EI+ 
Sbjct: 1   MTEVRVPTLGESVTEATLATWFKKAGDLVVQDEMICELETDKVTVEVAAPVSGTLSEIVA 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G   + V++ +  I   +T    +     E  V+       S                
Sbjct: 61  GEG-VTVGVDALLAQISEGATSNAETKKTPVEQNVKAPSLEEKSGVKNAPSAEKLMEENN 119

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
                    +  I    +  +  +   +++                             A
Sbjct: 120 ITNVSGTGRDGRIMKGDVLNAIANPIPLQNIG---------------------------A 152

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
                      E +    +R+TIA RL++S+ T        + ++  ++ LR +      
Sbjct: 153 PAKPRKDDPREERVTMTRLRQTIARRLKESQNTAAMLTTYNEVDMSAVMDLRSEYKDMFL 212

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                   K+       KA   A+ ++PE N     N ++   ++++ +A   P G+V P
Sbjct: 213 KK---HGVKLGFMSFFTKACCHALNEIPEVNSEIDGNDVVYKNYVNMGIAAGTPTGLVVP 269

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           +I   DQ S  DI   + +   RA+  KL   E QGGT +ISN G+ G      ++NPPQ
Sbjct: 270 VINDVDQMSFADIEKSIAEKGARARSGKLSMAEMQGGTFTISNGGVYGSLMSSPILNPPQ 329

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL +   +K+ +  N+EI +  +M   LS DHR VDG  A   L + KE +E+P  +L
Sbjct: 330 SGILGMHTIQKRPIVINDEIVIRPMMYLALSYDHRVVDGKGAVTFLVRVKEALEDPRRLL 389

Query: 423 M 423
           M
Sbjct: 390 M 390


>gi|269940907|emb|CBI49291.1| dihydrolipoamide succinyltransferase E2component of 2-oxoglutarate
           dehydrogenase complex [Staphylococcus aureus subsp.
           aureus TW20]
          Length = 422

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 95/421 (22%), Positives = 173/421 (41%), Gaps = 5/421 (1%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            + +P L+ ++TEG +A+W+K  GD +  G+ + E+ETDK  +E  S + G++ E L   
Sbjct: 3   EVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLASE 62

Query: 65  GTENIAVNSPILNIL-MDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIAS 123
           G + + V   I  I          +   +     E        +     +K   N+    
Sbjct: 63  G-DTVEVGQAIAIIGKGSGNASKENSNDNTPQQNEETNNKKEETTNNSVDKAEVNQANDE 121

Query: 124 PLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDAN 183
              R  A       +  +G        K++           +             + +  
Sbjct: 122 NQQRINATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQASAKEEK 181

Query: 184 ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQF 243
             N +             +KT A +L +            + ++ N++ LR++       
Sbjct: 182 KYNQYPTKPVIREKMSRRKKTAAKKLLEISNNTAMLTTFNEVDMTNVMELRKRKKEQFMK 241

Query: 244 HREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPI 303
             +    K+       KA   A+ + PE N     + MI  ++ DI VAVS   G++ P 
Sbjct: 242 DHD--GTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPF 299

Query: 304 IRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQS 363
           +R  D+K+  +I  E+  LA +A+++KL  ++   G+ +I+N G+ G      +IN  Q+
Sbjct: 300 VRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQA 359

Query: 364 TILAIGAGEKKVVFQN-EEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
            IL + +   + +  + + I+   +M   LS DHR +DG  A   L   KE IENP  +L
Sbjct: 360 AILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLL 419

Query: 423 M 423
           +
Sbjct: 420 L 420


>gi|28198665|ref|NP_778979.1| dihydrolipoamide acetyltransferase [Xylella fastidiosa Temecula1]
 gi|182681355|ref|YP_001829515.1| dihydrolipoamide succinyltransferase [Xylella fastidiosa M23]
 gi|28056756|gb|AAO28628.1| dihydrolipoamide S-succinyltransferase [Xylella fastidiosa
           Temecula1]
 gi|182631465|gb|ACB92241.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Xylella fastidiosa M23]
 gi|307579802|gb|ADN63771.1| dihydrolipoamide succinyltransferase [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 391

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 113/421 (26%), Positives = 184/421 (43%), Gaps = 33/421 (7%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P L  ++++  +A W K+ G+ +   + + ++ETDK ++E  S  +G++ EI 
Sbjct: 1   MSTEVKVPVLPESVSDATIASWHKKAGEIVKRDENIVDLETDKVVLEVPSPVDGVLKEIK 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
             AG+  +  N  +  I   S        +         +        V       N   
Sbjct: 61  FDAGS-TVTSNQVLAIIEEGS--------IVTAPSPAPSQVIDQKPVAVSAPAAKSNVDS 111

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
             P AR  A   GID + + GSG  G + K DI                           
Sbjct: 112 LPPGARFTATTEGIDPAQIEGSGRRGAVTKEDIINFAKQNG------------------- 152

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                       E IP   IR+ IA RL QSK +        + N+  + ++R+++    
Sbjct: 153 --AARASGTRLEERIPMTRIRQRIAERLMQSKNSTAMLTTFNEINLAKVSNIRKELQEEF 210

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           Q        K+      +KA A A+ + P  N S     +I H + DIS+AVS   G+VT
Sbjct: 211 QKA---HGIKLGFMSFFVKAAANALQRFPLVNASIDGTDIIYHGYSDISIAVSTDKGLVT 267

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  ++ S  DI   +   A++A+  KL  EE QGGT +++N G  G      ++NPP
Sbjct: 268 PVLRNVERMSFADIEHRIADYAKKARDGKLSLEELQGGTFTVTNGGTFGSLLSTPIVNPP 327

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ + +N  I +A +M   LS DHR +DG  + + L   K  +E+P  M
Sbjct: 328 QSAILGMHTIKERPIAENGNIVIAPMMYVALSYDHRIIDGKDSVQFLVDIKNQLEDPGRM 387

Query: 422 L 422
           L
Sbjct: 388 L 388


>gi|269960710|ref|ZP_06175082.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio harveyi 1DA3]
 gi|269834787|gb|EEZ88874.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Vibrio harveyi 1DA3]
          Length = 402

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 95/422 (22%), Positives = 179/422 (42%), Gaps = 22/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W KQ GD +   ++L +IETDK ++E  + + G+++ I+
Sbjct: 1   MTIEILVPDLPESVADATVATWHKQPGDVVERDEVLVDIETDKVVLEVPAPEAGVLEAII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     I  +   +    P+   +++      + H  +      +  S     
Sbjct: 61  EEEGA-TVLSKQLIAKLKPGAVAGEPTTDSTEDKEASPDKRHKAALTEESNDALSPAVRR 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A +                                 +     +         
Sbjct: 120 LLAEHGLEASQ------------------VKGSGVGGRITREDIEAHLASAKAAPKAEAP 161

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A +    A  S + +P   +RKT+A RL ++K          + N+  ++ LR+Q     
Sbjct: 162 AAVEAPAAARSQKRVPMTRLRKTVANRLLEAKNNTAMLTTFNEVNMKPIMDLRKQYKDQF 221

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 222 EER---HGIRLGFMSFYVKAVTEALKRYPEVNASIDGDDIVYHNYFDISMAVSTPRGLVT 278

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D     D+   +K+LA + +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 279 PVLKDCDTLGFADVEKGIKELAIKGRDGKLTVDELMGGNFTITNGGVFGSLMSTPIINPP 338

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 339 QSAILGMHKIQERPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARL 398

Query: 422 LM 423
           L+
Sbjct: 399 LL 400


>gi|163744282|ref|ZP_02151642.1| dihydrolipoamide acetyltransferase [Oceanibulbus indolifex HEL-45]
 gi|161381100|gb|EDQ05509.1| dihydrolipoamide acetyltransferase [Oceanibulbus indolifex HEL-45]
          Length = 528

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 94/421 (22%), Positives = 175/421 (41%), Gaps = 20/421 (4%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
              + +P+L  ++TE  ++ W K+ GDK+   ++LCE+ETDK  +E  +   G++ EIL 
Sbjct: 126 TIEVKVPTLGESVTEATVSTWFKKVGDKVEADEMLCELETDKVSVEVPAPAAGVLAEILA 185

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G+  +  ++ +  +   +    P    +K       E  S     V     +K     
Sbjct: 186 DEGS-TVEASATLAVLTSGAGAAAPKGEDAKSGAGAAPETKSADGKDVEDAPSAKKAMAE 244

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
           + ++R      G D   +           +                          +   
Sbjct: 245 AGISRDQVTGSGRDGRVMKEDVAKAIAAGTSAAP----------------KADAKPAAPR 288

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
                      E +    +++T+A RL++++ T        + ++  ++ LR       +
Sbjct: 289 AASAPDDASREERVKMTRLKQTMARRLKEAQNTAAILTTFNEVDMTEVMELRNTYKADFE 348

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                   ++       KA   A+ ++PE N       +I   ++ + VA   P G+V P
Sbjct: 349 KK---HGVRMGFMSFFTKACCHALKEIPEVNAEIDGTDIIYKNYVHMGVAAGTPTGLVVP 405

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           +I+ AD  S  +I   V  + ++A+  KL   +  GGT +ISN G+ G      ++NPPQ
Sbjct: 406 VIKDADAMSFAEIEKAVNAMGKKARDGKLTMADMTGGTFTISNGGVYGSLMTAPILNPPQ 465

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL +   + + +  N E+ +  +M  +LS DHR +DG  A   L + KE +E+P  +L
Sbjct: 466 SGILGMAKIQDRPMAINGEVVIRPMMYISLSYDHRIIDGKGAVTFLVRVKEMLEDPRRLL 525

Query: 423 M 423
           M
Sbjct: 526 M 526



 Score =  130 bits (326), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   + +P+L  ++TE  +A W K+ GD ++  ++LCE+ETDK  +E  S   G + EI+
Sbjct: 1  MTSEVRVPTLGESVTEATVATWFKKPGDTVAVDEMLCELETDKVTVEVPSPVAGTLSEIV 60

Query: 62 VPAGTENIAVNSPILNILMDST 83
             G E + V++ + N+    +
Sbjct: 61 AQEG-ETVGVDALLANVSEGDS 81


>gi|237730690|ref|ZP_04561171.1| dihydrolipoamide acetyltransferase [Citrobacter sp. 30_2]
 gi|226906229|gb|EEH92147.1| dihydrolipoamide acetyltransferase [Citrobacter sp. 30_2]
          Length = 407

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 96/423 (22%), Positives = 175/423 (41%), Gaps = 18/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVRRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S      +  S    
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSTGKETSAKSEEKDSTPAQRQQASLAEQNNDALSPAIR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A                                     +          + 
Sbjct: 120 RLLGEHNLEASSIN--------------GTGVGGRITREDVEKHLAKAPAAKAEAKAPAA 165

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                        + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 166 APAPQAQLGARGEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDA 225

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 226 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 282

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI   +K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 283 TPVLRDVDLLGMADIEKNIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 342

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 343 PQSAILGMHAIKDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 402

Query: 421 MLM 423
           +L+
Sbjct: 403 LLL 405


>gi|254781052|ref|YP_003065465.1| dihydrolipoamide succinyltransferase [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040729|gb|ACT57525.1| dihydrolipoamide succinyltransferase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 436

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 98/422 (23%), Positives = 183/422 (43%), Gaps = 6/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +PSL  ++ E  +  W+K+ G+ +  G+IL E+ETDK  +E  S   G + E+ 
Sbjct: 19  MATKILVPSLGESVNEATVGTWLKEIGESVEIGEILVELETDKVTVEVPSPVSGKLHEMS 78

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  G + +     +  I+  + +   S   +  N               +    S ++ I
Sbjct: 79  VAKG-DTVTYGGFLGYIVEIARDEDESIKQNSPNSTANGLPEITDQGFQMPHSPSASKLI 137

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A         +       +  S     I +S+        T       + S  +   S  
Sbjct: 138 AESGLSPSDIKGTGKRGQILKSDVMAAISRSESSV--DQSTVDSHKKGVFSRIINSASNI 195

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
               ++  + S E +    +R+T+A RL+ ++ T        + N+  ++S+R +     
Sbjct: 196 FEKSSVSEELSEERVKMSRLRQTVAKRLKDAQNTAAILSTYNEVNMSRIISIRSRYKDIF 255

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+       KA +  + ++   N     + ++   +  I VAV    G+V 
Sbjct: 256 EKK---HGIKLGFMGFFTKAASHVLQEIKGVNAEIDGDHIVYKNYCHIGVAVGTDKGLVV 312

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR AD+ +I++I  E+ +L + A+   L   + Q GT +ISN G+ G      ++NPP
Sbjct: 313 PVIRHADKMNIVEIEREIARLGREARAGHLSMRDLQNGTFTISNGGVYGSLLSSPILNPP 372

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ + ++ +I +  +M   LS DHR VDG  A   L + KE +E+P   
Sbjct: 373 QSGILGMHKIQERPIVEDGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRLKELLEDPERF 432

Query: 422 LM 423
           ++
Sbjct: 433 IL 434


>gi|254419497|ref|ZP_05033221.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brevundimonas sp. BAL3]
 gi|196185674|gb|EDX80650.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brevundimonas sp. BAL3]
          Length = 431

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 184/434 (42%), Positives = 261/434 (60%), Gaps = 18/434 (4%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I MP+LSPTM EG LAKW  + GD +S GD++ EIETDKA ME E+VDEG I +ILV
Sbjct: 1   MTDILMPALSPTMEEGVLAKWHVKVGDVVSAGDVIAEIETDKATMEVEAVDEGEITDILV 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENI------------VEVREEHSHSSPVV 110
             GTE + VN+PI  +  +     P                        +     +    
Sbjct: 61  AEGTEGVKVNTPIARLKDEGGAAAPQKSEKPAAKAEETPKAAPAAVEAPKASAPVAPAPA 120

Query: 111 VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
             +  + +R  +SPLARR+A ++G+DL S+ G+GPHGRIVK D+E            +T 
Sbjct: 121 APKSDNGDRIFSSPLARRIAAQNGVDLKSVKGTGPHGRIVKRDVEAAGKGAAQPAAATTA 180

Query: 171 QSFGLVDESIDANILNLF--AKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNID 228
            +            L        SY++IP D ++K +A R+  S Q +PHF + IDC ID
Sbjct: 181 AAATSGIAPRQVQSLAQMGIPDGSYDLIPLDGMKKAVARRMVDSIQNVPHFPLFIDCEID 240

Query: 229 NLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHID 288
            L+++R ++N+ L+        K+SVND I+KA ALA+  VPEAN S+T   +  H + D
Sbjct: 241 QLMAVRAKVNKMLEPQ----GIKVSVNDFIIKAAALALKMVPEANASYTPEGIAMHHNAD 296

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           +S+AV+I GG++TPIIR+A+ K +  I+ E K LA+RA++RKLKPEE+QGGT S+SN+GM
Sbjct: 297 VSMAVAIDGGLITPIIRKAETKGLAQIATESKDLAKRARERKLKPEEFQGGTFSVSNLGM 356

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLL 408
            GI  F ++IN PQ  I+++GAGE++ V +N +I  AT+M  TL+ DHR VDGA  ++ L
Sbjct: 357 FGIKQFTSIINEPQGCIMSVGAGEQRAVVKNGQIVPATVMTVTLTCDHRVVDGATGARFL 416

Query: 409 AKFKEYIENPVWML 422
             FK  IE+PV ML
Sbjct: 417 QAFKPLIEDPVAML 430


>gi|167646719|ref|YP_001684382.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Caulobacter sp. K31]
 gi|167349149|gb|ABZ71884.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Caulobacter sp. K31]
          Length = 436

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 191/440 (43%), Positives = 268/440 (60%), Gaps = 22/440 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW  + GD +  GD++ EIETDKA ME E+VDEG+++ IL
Sbjct: 1   MSIDILMPALSPTMEEGTLAKWHVKVGDTVKAGDVIAEIETDKATMEVEAVDEGVVEAIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVRE-------------EHSHSSP 108
           V AGTEN+ VN+ I  +  +     P+P          +              E +  + 
Sbjct: 61  VEAGTENVKVNALIAKLAGEGESPAPAPAKPAPAAGAPKAAAPAPAAPVQAAGETAAPAK 120

Query: 109 VVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYS 168
             +    + +R  ASPLARRLA    +DL S++GSGPHGR+VK+D+E            +
Sbjct: 121 PALAPAPAGDRVFASPLARRLASAANLDLKSIAGSGPHGRVVKADVEAATKGGAPAAKAA 180

Query: 169 TIQSFGLVDESIDANIL-----NLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSI 223
           +  +      +                 SY+++P D +RKTIA RL  S + +PHF ++I
Sbjct: 181 SASATASAPAAAAPRAHLSLEQQGIPAGSYDLVPLDGMRKTIARRLTDSFRDVPHFPLTI 240

Query: 224 DCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIR 283
           D  ID LL+ R ++N  L+        K+SVNDII+KA A+A+ +VPEAN S+T   +  
Sbjct: 241 DLEIDALLAARAKINHLLEGQ----GVKVSVNDIIIKAVAVALKRVPEANASYTPEGIAL 296

Query: 284 HKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSI 343
           H H DI+VAV+I GG++TPI+R A+ K +  IS EVK LA RAK +KLKPEE+QGGT S+
Sbjct: 297 HHHADIAVAVAIDGGLITPIVRAAETKGLAQISAEVKDLAARAKSKKLKPEEFQGGTFSV 356

Query: 344 SNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAI 403
           SN+GM GI +F ++IN PQ  I+++GAGE++ V +N E+ VAT+M  TL+ DHR VDGAI
Sbjct: 357 SNLGMFGIKAFASIINEPQGAIMSVGAGEQRPVVKNGELAVATVMTITLTCDHRVVDGAI 416

Query: 404 ASKLLAKFKEYIENPVWMLM 423
            ++ LA FK  IE P+ +L+
Sbjct: 417 GARFLAAFKPLIEEPLTLLV 436


>gi|332557916|ref|ZP_08412238.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Rhodobacter sphaeroides WS8N]
 gi|332275628|gb|EGJ20943.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Rhodobacter sphaeroides WS8N]
          Length = 438

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 188/441 (42%), Positives = 265/441 (60%), Gaps = 24/441 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+K+EGD++  GDI+ EIETDKA MEFE+VDEGI+ +IL
Sbjct: 1   MATEILMPALSPTMEEGTLAKWLKKEGDEVRSGDIIAEIETDKATMEFEAVDEGILGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK---- 117
           +  GT  + VN+PI  ++ +   +            E  +E + +               
Sbjct: 61  IAEGTAGVKVNTPIAVLVEEGESVDAVSSAKAPEPQEPADEAAPAQGDPKEAPAPAAKAP 120

Query: 118 ---------NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS------TKT 162
                     R  ASPLARR+A E GIDL+++ GSGP GRIVK+D+E             
Sbjct: 121 AAQAARSEGERVFASPLARRIAKEKGIDLAAVQGSGPRGRIVKADVEGAQPSAAPAAKAD 180

Query: 163 NVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVS 222
                +   +      +  A++  LFA   YE +  D +RKTIA RL ++KQTIPHFY+ 
Sbjct: 181 VAAPKAEAPAAAAAPAASAASVAKLFADRDYEEVTLDGMRKTIAARLSEAKQTIPHFYLR 240

Query: 223 IDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMI 282
            +  +D L++ R  +N  L+        K+SVND I+KA A+A+ QVP AN  W  + ++
Sbjct: 241 REVALDALMAFRADLNAKLESR----GVKLSVNDFIIKACAVALQQVPNANAVWAGDRIL 296

Query: 283 RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTS 342
           R K  D++VAV+I GG+ TP++R A QKS+  +S E+K LA RA+ +KL P EYQGG+ +
Sbjct: 297 RLKPSDVAVAVAIEGGLFTPVLRDAHQKSLSALSAEMKDLAARARTKKLAPHEYQGGSFA 356

Query: 343 ISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHRSVDG 401
           ISN+GM G+ +F AVINPP  +ILA+GAG +K V  ++  I  AT+M+ TLS DHR +DG
Sbjct: 357 ISNLGMFGVENFDAVINPPHGSILAVGAGIRKPVVGKDGAITTATMMSMTLSVDHRVIDG 416

Query: 402 AIASKLLAKFKEYIENPVWML 422
           A+ ++ L    E +ENP+ ML
Sbjct: 417 ALGAEFLKAIVENLENPIAML 437


>gi|310815648|ref|YP_003963612.1| branched-chain alpha-keto acid dehydrogenase E2 subunit
           [Ketogulonicigenium vulgare Y25]
 gi|308754383|gb|ADO42312.1| branched-chain alpha-keto acid dehydrogenase E2 subunit
           [Ketogulonicigenium vulgare Y25]
          Length = 432

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 166/435 (38%), Positives = 238/435 (54%), Gaps = 18/435 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG +AKW+  EGD +  GDIL EIETDKA MEFE+VD+G+I +IL
Sbjct: 1   MSIEILMPALSPTMEEGTIAKWLVAEGDTVKSGDILAEIETDKATMEFEAVDDGVIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +PAG+E + VN+P+  +L D      +P  +   +     E   ++PV       +    
Sbjct: 61  LPAGSEGVKVNTPMAILLEDGETEAAAPKAAAPKVEAAPVEAPKAAPVAAAAAPVEKGDR 120

Query: 122 ASPLARRLAGEHGI---------DLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQS 172
                                                  +      +        +    
Sbjct: 121 VFASPLARRIAADKGLDLNAIAGSGPKGRIVRADVEGATAAKPAEAAKAPAAAAPTPAAP 180

Query: 173 FGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232
             +   S    IL ++    Y  +  D +RKTIA RL ++KQT+PHFY+    N+D L++
Sbjct: 181 APVPTSSSADQILKMYQGRDYTEVKLDGMRKTIAARLTEAKQTVPHFYLRRSVNLDALMA 240

Query: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVA 292
            R      L         KISVND ++KA A+A+ QVP+AN  W  + +++ K  D+S+A
Sbjct: 241 FRAD----LNAKLGPRGIKISVNDFVIKACAIALQQVPKANAIWAGDRVLQMKASDVSIA 296

Query: 293 VSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGIN 352
           V++ GG+ TP+IR AD KSI  +S E+K LA+RA+ +KL+P++YQGG+ SISN+GM G+ 
Sbjct: 297 VAVEGGLFTPVIRDADAKSISALSAEMKDLAKRARDKKLQPQDYQGGSFSISNLGMFGVE 356

Query: 353 SFCAVINPPQSTILAIGAGEKKVVF-QNEEIK----VATIMNATLSADHRSVDGAIASKL 407
           +F AVINPPQ  ILA+GAG KK +   + EI      AT+M+ TLS DHR +DGA+ + L
Sbjct: 357 NFDAVINPPQGAILAVGAGIKKPIVGDDGEITTETPPATLMSLTLSVDHRVIDGALGAHL 416

Query: 408 LAKFKEYIENPVWML 422
           L    E +ENP+ ML
Sbjct: 417 LTAIVENLENPLSML 431


>gi|323495095|ref|ZP_08100182.1| dihydrolipoamide succinyltransferase [Vibrio brasiliensis LMG
           20546]
 gi|323310646|gb|EGA63823.1| dihydrolipoamide succinyltransferase [Vibrio brasiliensis LMG
           20546]
          Length = 402

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 96/422 (22%), Positives = 180/422 (42%), Gaps = 22/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W KQ G+ +   ++L +IETDK ++E  + + G+++ I+
Sbjct: 1   MTIEILVPDLPESVADATVATWHKQPGEAVERDEVLVDIETDKVVLEVPAPEAGVLEAII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     I  +   +    P+   ++E+     + H  S      +  S     
Sbjct: 61  EEEGA-TVLSKQLIAKLKPGAVAGEPTTDTTEESEASPDKRHKASLTEESNDALSPAVRR 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                   A +                                 +     +         
Sbjct: 120 LLAEHGLEANQ------------------VKGTGVGGRITREDIEAHLANAKAAPKAEAP 161

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A +    A  S + +P   +RKT+A RL ++K          + N+  ++ LR+Q     
Sbjct: 162 AAVEAPAAARSQKRVPMTRLRKTVANRLLEAKNNTAMLTTFNEVNMKPIMDLRKQYKDQF 221

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 222 EER---HGIRLGFMSFYVKAVTEALKRYPEVNASIDGDDIVYHNYFDISMAVSTPRGLVT 278

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D     D+   +K+LA + +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 279 PVLKDCDTLGFADVEKGIKELAIKGRDGKLTVDELMGGNFTITNGGVFGSLMSTPIINPP 338

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 339 QSAILGMHKIQERPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARL 398

Query: 422 LM 423
           L+
Sbjct: 399 LL 400


>gi|221632586|ref|YP_002521807.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Thermomicrobium roseum DSM 5159]
 gi|221156975|gb|ACM06102.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Thermomicrobium roseum DSM 5159]
          Length = 439

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 103/441 (23%), Positives = 177/441 (40%), Gaps = 23/441 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +P +  ++ E  +  W K+EGD ++PGD+L E+ET+K  +E  +   G++  IL
Sbjct: 1   MAIEVRVPQMGESIVEAVIGAWRKREGDPVNPGDVLVELETEKVNVEVTADRAGVLQHIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E + V   I  I   +    P      E                   + ++    
Sbjct: 61  KREG-ETVTVGEVIALIEETAQVTAPVQETPAEAGRAREPAPLPEVTTAAASQPAQPAGG 119

Query: 122 ASPLARRLAGEHGIDL------------------SSLSGSGPHGRIVKSDIETLISTKTN 163
            +  A         +                     +              +        
Sbjct: 120 PAVRATPAVRRLAEEYGIDLAEVPASGEGGRVTREDVLRYVAQRGAAARPADGAAPQPVA 179

Query: 164 VKDYSTIQSFGLVDESIDANILNLFAKDSYE-VIPHDNIRKTIACRLQQSKQTIPHFYVS 222
                       V       +L   A    E  I     RKTIA RL +++ T       
Sbjct: 180 AAPPPAAPPAPGVTPPEAPVVLPFSAAGRREERIRMSQRRKTIARRLVEAQHTAAMLTTF 239

Query: 223 IDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMI 282
            + ++  +++LR +  +  +         +       KA   A+   P  N     + ++
Sbjct: 240 NEIDMSAVVALRNRWRQQFRER---YGVSLGFMSFFTKAVVGALKAFPLLNAEIQGDEIV 296

Query: 283 RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTS 342
              + DI +AV+   G+V P++R AD+KS  +I  E+++LA++A++R+L  EE  GGT +
Sbjct: 297 VKYYYDIGIAVATDEGLVVPVVRDADRKSFAEIEREIEELARKARERRLTLEELSGGTFT 356

Query: 343 ISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGA 402
           I+N G+ G      ++NPPQ  IL +   E++ V  N EI +  +M   L+ DHR VDG 
Sbjct: 357 ITNGGVFGSLLSTPILNPPQVGILGMHKIEERPVVVNGEIVIRPMMYVALTYDHRIVDGR 416

Query: 403 IASKLLAKFKEYIENPVWMLM 423
            A   L + KE IE+P  +L+
Sbjct: 417 EAVLFLVRVKELIEDPERLLL 437


>gi|322833842|ref|YP_004213869.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Rahnella sp. Y9602]
 gi|321169043|gb|ADW74742.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Rahnella sp. Y9602]
          Length = 409

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 110/423 (26%), Positives = 185/423 (43%), Gaps = 16/423 (3%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   D+L EIETDK ++E  + + GI+D I
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDSVERDDVLVEIETDKVVLEVPASEAGILDSI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           +   G   +     +  I   ++   PS   S +        H+ +              
Sbjct: 61  IEDEGA-TVISRQILARIRPGNSSGKPSTEKSSDKEATPAARHTAALEE----------- 108

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
             +  A   A    I   SL  S   G  V   +      +   K      +        
Sbjct: 109 -ENNDALSPAIRRLIAEHSLDASAIKGSGVGGRLTREDIEQHLAKAKDAKPAAAPAAAPA 167

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
             +        S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 168 ATSAAPALGSRSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEINMKPIMDLRKQYGDG 227

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      LKA   A+ + PE N S     ++ H + D+S+AVS P G+V
Sbjct: 228 FEKR---HGVRLGFMSFYLKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLV 284

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KLK EE  GG  +++N G+ G      +INP
Sbjct: 285 TPVLRDVDTLGMADIEKQIKELAIKGRDGKLKVEELTGGNFTVTNGGVFGSLMSTPIINP 344

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++ +  +M   LS DHR VDG  +   L   KE +E+P  
Sbjct: 345 PQSAILGMHAIKDRPMAVNGQVVILPMMYLALSYDHRLVDGRESVGFLVTIKEMLEDPAR 404

Query: 421 MLM 423
           +L+
Sbjct: 405 LLL 407


>gi|206968214|ref|ZP_03229170.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Bacillus cereus AH1134]
 gi|206737134|gb|EDZ54281.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Bacillus cereus AH1134]
          Length = 420

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 98/422 (23%), Positives = 185/422 (43%), Gaps = 5/422 (1%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I +P L+ ++TEG +++W+   GDK+  G  + E+ETDK  +E  + D GI+ ++L 
Sbjct: 1   MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G + + V + I  +  +   +  S P    +    +E            + +      
Sbjct: 61  EPG-DTVEVGATIAILDANGAPVAVSTPAPVADEQPKQETTEAPKAAAPNAEQTATLQGL 119

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
               R +A      ++   G   +       +  +          +  ++         A
Sbjct: 120 PNTNRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPKSPAHA 179

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
            +     +   E +     R+TIA RL + +QT        + ++  ++ LR++     +
Sbjct: 180 PVAKTEFEKPVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMSAIMELRKERKDAFE 239

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                   ++       KA   A+ Q P  N     + +I  K  DI +AV+ P G+V P
Sbjct: 240 KK---HDVRLGFMSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVP 296

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R A+Q +  +I  E+++L ++A+  KL  +E QGGT +I+N G+ G      ++N PQ
Sbjct: 297 VVRDANQLNFAEIESEIRELGKKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQ 356

Query: 363 STILAIGAGEKKVVFQNEE-IKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
             IL +   + + V  + E ++   +M   LS DHR VDG  A   L   K+ +E+P  +
Sbjct: 357 VGILGMHKIQVRPVAIDNERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKDMLEDPKSL 416

Query: 422 LM 423
           L+
Sbjct: 417 LL 418


>gi|332977245|gb|EGK14040.1| 2-oxoglutarate dehydrogenase E2, dihydrolipoamide acetyltransferase
           [Psychrobacter sp. 1501(2011)]
          Length = 414

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 98/422 (23%), Positives = 177/422 (41%), Gaps = 10/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I  P    ++ +G + +W   EGD+++  DIL EIETDK ++E  + D+G++ +I+
Sbjct: 1   MA-EIKAPVFPESVADGTIVEWHVSEGDQVNRDDILAEIETDKVVLEVVAPDDGVLTKII 59

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
                + +  +  I      +T        + E   E  E  S         K  +    
Sbjct: 60  KQV-DDTVLSDELIAEFEAGATGNAGGSDSADEAKEEETESTSKEEQAAQGGKPQQGEVN 118

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                 +          S           +    T            +            
Sbjct: 119 EKDHKDQSPAVRKAAKESGVDPKNVEGSGRGGRVTKQDMAKPTLKADSSIKSDSGR---- 174

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
             +     + + + +P   +RKT+A RL  + Q         + N+  L+ LR +     
Sbjct: 175 -PVAESVGERTEKRVPMTRLRKTVANRLLAASQETAMLTTFNEVNMKPLMDLRAKYKDQF 233

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++    + +KA   A+ + P  N S   + ++ H + DI VAVS   G+V 
Sbjct: 234 EKR---HGTRLGFMSMFVKAATEALKRFPAVNASIDGDDIVYHGYYDIGVAVSSDRGLVV 290

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R  D+ S+ DI   +++ A +A+  KL  +E  GGT +I+N G+ G      ++NPP
Sbjct: 291 PVLRDTDRMSMADIEGGIREFAGKARDGKLSLQEMTGGTFTITNGGVFGSLMSTPILNPP 350

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL + A   + +  N ++++  +M   LS DHR +DG  A + L   KE +E+P  +
Sbjct: 351 QTAILGMHAINDRPMAVNGQVEILPMMYLALSYDHRMIDGKDAVQFLVTIKELVEDPAML 410

Query: 422 LM 423
           L+
Sbjct: 411 LL 412


>gi|29654691|ref|NP_820383.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Coxiella burnetii RSA 493]
 gi|29541959|gb|AAO90897.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Coxiella burnetii
           RSA 493]
          Length = 405

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 110/422 (26%), Positives = 199/422 (47%), Gaps = 19/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++++  +AKW K+EGD IS  + L ++ETDK ++E  +  +G++++I+
Sbjct: 1   MAIEIKVPTLPESVSDATVAKWYKKEGDSISRDENLVDLETDKVMLEVPAPKDGVVEKIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +  +  +  +              ++   + +E+         +EK  +    
Sbjct: 61  AKEG-EVVKADQILALLKEGGAVAKEKEKKDEKETKKEKEKKEEKKDKEKKEKTEEKESD 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            SP  RR+  E  +D+  + GSG  GRI K D+E  +  +                E   
Sbjct: 120 LSPAVRRMVSEKDVDVEEIEGSGKGGRITKKDVEDYLEKQK---------------EKPS 164

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                   + + + +P   IR+ +A RL Q +Q         + N+  ++ LR++     
Sbjct: 165 EGKEGPADERTEKRVPLSRIRQRVAERLVQVQQEAALLTTFNEINMQLVMELRKKYREEF 224

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +   +    ++       KA   A+ + P  N S   + +I H + DI +A+    G++ 
Sbjct: 225 EKKFK---VRLGFMSFFTKAVVEALKRFPMVNASIDGSDIIYHNYYDIGIAIGTERGLIV 281

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI+R A++ ++ DI  ++++ A RA++ +L  EE  GGT +I+N G  G      +INPP
Sbjct: 282 PILRNAEKMNMADIEKQIREYASRAQEGRLNIEELTGGTFTITNGGTYGSLLSTPIINPP 341

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +     +   +N E+ V  IM   LS DHR +DG  A   L   KE +E+P  M
Sbjct: 342 QTAILGMHKIMDRPTVENGEVVVRPIMQVALSYDHRVIDGREAVLFLVTIKELLEDPARM 401

Query: 422 LM 423
           ++
Sbjct: 402 IL 403


>gi|254427676|ref|ZP_05041383.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Alcanivorax sp. DG881]
 gi|196193845|gb|EDX88804.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Alcanivorax sp. DG881]
          Length = 424

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 91/426 (21%), Positives = 185/426 (43%), Gaps = 8/426 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I  P    ++ +G +A W KQEG+ +   ++L +IETDK ++E  +  +G++ +I+
Sbjct: 1   MATDIKAPQFPESVADGTVATWHKQEGEAVKRDELLVDIETDKVVLEVVAPADGVVSKIM 60

Query: 62  VPAGTENIAVNSPILNILMDST----EIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK 117
              G E +     +      ++    +    P  ++ +     ++          +    
Sbjct: 61  AAEG-ETVESQQVLGTFDEGASGSAGKSDEKPAKAESDDDSADKKDDKQEEKADAKSEPA 119

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
           +   ++      A    +    ++     G      I      K   +      S     
Sbjct: 120 DDDDSAGDQAGPAARKLMSEHGIAADQVKGTGRGGRITKGDVEKVITEKAEKRASQPAPQ 179

Query: 178 ESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQM 237
           +    ++     +     +P   +RK IA RL  ++Q         + N+  ++ +R+  
Sbjct: 180 QPATLDVPGAPGEREERRVPMTRLRKRIAERLVSAQQDSAMLTTFNEVNMKPIMDMRKHY 239

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
               +      + ++       +A   A+ + P  N S     ++ H + D+ VAVS   
Sbjct: 240 QPEFEKA---HNVRLGFMGFFTRACVEALKRFPAVNASIDGEDIVYHGYYDVGVAVSTER 296

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G+V P++R ADQK + ++  ++ +  Q+A++ KL  EE  GGT +ISN G+ G      +
Sbjct: 297 GLVVPVLRDADQKGLAEVESQIIEYGQKAQKGKLSIEEMTGGTFTISNGGVFGSLISTPI 356

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           +NPPQ+ IL +   +++ +  + ++++  +M   LS DHR +DG  A + L   K +IE+
Sbjct: 357 LNPPQTAILGMHKIQERPMAVDGKVEILPMMYLALSYDHRLIDGKEAVQFLVAVKNFIED 416

Query: 418 PVWMLM 423
           P  +L+
Sbjct: 417 PARLLL 422


>gi|457726|emb|CAA54875.1| putative dihydrolipoamide succinyltransferase [Coxiella burnetii]
          Length = 405

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 110/422 (26%), Positives = 200/422 (47%), Gaps = 19/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++++  +AKW K+EGD IS  + L ++ETDK ++E  +  +G++++I+
Sbjct: 1   MAIEIKVPTLPESVSDATVAKWYKKEGDSISRDENLVDLETDKVMLEVPAPKDGVVEKIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +  +  +  +    +         ++   + +E+         +EK  +    
Sbjct: 61  AKEG-EVVKADQILALLKEGGSVAKEKEKKDEKETKKEKEKKEEKKDKEKKEKTEEKESD 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            SP  RR+  E  +D+  + GSG  GRI K D+E  +  +                E   
Sbjct: 120 LSPAVRRMVSEKDVDVEEIEGSGKGGRITKKDVEDYLEKQK---------------EKPS 164

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                   + + + +P   IR+ +A RL Q +Q         + N+  ++ LR++     
Sbjct: 165 EGKEGPADERTEKRVPLSRIRQRVAERLVQVQQEAALLTTFNEINMQLVMELRKKYREEF 224

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +   +    ++       KA   A+ + P  N S   + +I H + DI +A+    G++ 
Sbjct: 225 EKKFK---VRLGFMSFFTKAVVEALKRFPMVNASIDGSDIIYHNYYDIGIAIGTERGLIV 281

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI+R A++ ++ DI  ++++ A RA++ +L  EE  GGT +I+N G  G      +INPP
Sbjct: 282 PILRNAEKMNMADIEKQIREYASRAQEGRLNIEELTGGTFTITNGGTYGSLLSTPIINPP 341

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +     +   +N E+ V  IM   LS DHR +DG  A   L   KE +E+P  M
Sbjct: 342 QTAILGMHKIMDRPTVENGEVVVRPIMQVALSYDHRVIDGREAVLFLVTIKELLEDPARM 401

Query: 422 LM 423
           ++
Sbjct: 402 IL 403


>gi|167587329|ref|ZP_02379717.1| dihydrolipoamide acetyltransferase [Burkholderia ubonensis Bu]
          Length = 425

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 119/427 (27%), Positives = 198/427 (46%), Gaps = 8/427 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL E+ETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLS-KENIVEVREEHSHSSPVVVREKHSKNR 119
           L   G + +  +  I  I  ++            E         +  +        + + 
Sbjct: 61  LQNDG-DTVVADQVIATIDTEAKAGAAEAAAGATEVKPAAAPAAAAPAAQPAAAATASST 119

Query: 120 PIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDES 179
             ASP A +L  E G+    ++GSG  GRI K D+ +  + K          +       
Sbjct: 120 AAASPAASKLLAEKGLAAGDVAGSGRDGRITKGDVLSAGAPKAAPAAAPAKTAAAKASLP 179

Query: 180 I---DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQ 236
                A+          + +P   +R  IA RL +S+QT        + N+  ++ LR +
Sbjct: 180 DVKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNK 239

Query: 237 MNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIP 296
                +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P
Sbjct: 240 YKDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSP 296

Query: 297 GGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCA 356
            G+V PI+R ADQ S+ DI  ++ +  Q+AK  KL  EE  GGT SISN G+ G      
Sbjct: 297 RGLVVPILRNADQMSLADIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTP 356

Query: 357 VINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIE 416
           +INPPQS IL + A +++ V +N +I +  I    LS DHR +DG  A   L   K+ +E
Sbjct: 357 IINPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALE 416

Query: 417 NPVWMLM 423
           +P  +L+
Sbjct: 417 DPARLLL 423


>gi|319409449|emb|CBI83098.1| dihydrolipoamide succinyltransferase [Bartonella schoenbuchensis
           R1]
          Length = 401

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 105/422 (24%), Positives = 195/422 (46%), Gaps = 23/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++TE  + KW KQ G+ ++  + L E+ETDK  +E  +   G + EIL
Sbjct: 1   MASEIRVPTLGESVTEATIGKWFKQCGEAVAVDEPLVELETDKVTVEVPAPVAGKLSEIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + VN+ +  I         +   S  +   +      ++              
Sbjct: 61  AKEG-DTVEVNALLGLIEA------GAAGASSSSASSLSAPSPAAASGPASSSLGGGAMP 113

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +P A +L  E+ I+   +SGSG  G+I+K D+   ++ KT                +  
Sbjct: 114 PAPSAAKLMAENNIEKDKISGSGKRGQILKGDVLDALTQKTGAG-------------ASV 160

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
               +   +   E +    +R+TIA RL+ ++ T        + ++  ++ LR++     
Sbjct: 161 PVSSSSSNEMREERVRMTKLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMDLRKRYKDLF 220

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +      + K+       KA   A+ ++P  N       ++   +++  +AV    G+V 
Sbjct: 221 EKK---HNVKLGFMGFFTKAVCHALKELPAVNAEIDGTDIVYKNYVNAGIAVGTDKGLVV 277

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ SI +I  E+ +L + A++ KL   + QGGT +I+N G+ G      ++N P
Sbjct: 278 PVVRDADQMSISEIEKEIGRLGRLAREGKLAVSDMQGGTFTITNGGVYGSLMSTPILNAP 337

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ +    ++ +  +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 338 QSGILGMHAIKERAMVVGGQVVIRPMMYLALSYDHRIVDGQEAVTFLVRVKESLEDPERL 397

Query: 422 LM 423
           ++
Sbjct: 398 VL 399


>gi|56419559|ref|YP_146877.1| dihydrolipoamide succinyltransferase [Geobacillus kaustophilus
           HTA426]
 gi|261419221|ref|YP_003252903.1| dihydrolipoamide succinyltransferase [Geobacillus sp. Y412MC61]
 gi|319766037|ref|YP_004131538.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Geobacillus sp. Y412MC52]
 gi|56379401|dbj|BAD75309.1| 2-oxoglutarate dehydrogenase complex E2 component (dihydrolipoamide
           transsuccinylase) [Geobacillus kaustophilus HTA426]
 gi|261375678|gb|ACX78421.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Geobacillus sp. Y412MC61]
 gi|317110903|gb|ADU93395.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Geobacillus sp. Y412MC52]
          Length = 422

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 103/425 (24%), Positives = 187/425 (44%), Gaps = 8/425 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L+ ++TEG +A+W+K+ GD +  G+ +CE+ETDK  +E  + + G++ ++L
Sbjct: 1   MA-EIKVPELAESITEGTIAQWLKKPGDYVEKGESICELETDKVNVEIMAEESGVLQQLL 59

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVRE--EHSHSSPVVVREKHSKNR 119
              G + +AV   I  I   +     +   + +   E         +     +       
Sbjct: 60  ANEG-DTVAVGQAIAIIGEGAAAPTAALQAAPQPADETETVAPADSNEQPAPQPVAVAQA 118

Query: 120 PIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDES 179
           P   P+A   A +   +        P    +    +  +++       +   +      S
Sbjct: 119 PSQRPIASPAARKMAREKGIDLTQVPTVDPLGRVRKQDVASFAAQPAAAPQPAPQAAPTS 178

Query: 180 IDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
             A +    A            R+TIA RL +  QT        + ++  ++ LR++   
Sbjct: 179 TPAAVPAAEAGKPVIREKMSRRRQTIAKRLLEVTQTTAMLTTFNEIDMSAVIDLRKRKKD 238

Query: 240 TLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGI 299
                      ++      +KA   A+ + P  N     + ++  K+ DI VAVS   G+
Sbjct: 239 KFFEE---HDVRLGFMSFFVKAAVAALKKYPYVNAEIQGDEILLKKYYDIGVAVSTDEGL 295

Query: 300 VTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVIN 359
           V P++R  D+K+  +I  ++ +LA +A+  KL   + QGGT +I+N G+ G      ++N
Sbjct: 296 VVPVVRDCDRKNFAEIERDIAELAAKARSNKLSLADLQGGTFTITNGGVFGSLLSTPLLN 355

Query: 360 PPQSTILAIGAGEKKVVFQNEE-IKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENP 418
            PQ  IL + + + + V  +EE I+   +M   LS DHR +DG  A   L   K+ IENP
Sbjct: 356 GPQVGILGMHSIKLRPVAVDEERIENRPMMYVALSYDHRIIDGKEAVGFLKTVKDLIENP 415

Query: 419 VWMLM 423
             +L+
Sbjct: 416 EDLLL 420


>gi|167552845|ref|ZP_02346596.1| dihydrolipoyllysine-residue succinyltransferase [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205322567|gb|EDZ10406.1| dihydrolipoyllysine-residue succinyltransferase [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
          Length = 402

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 97/423 (22%), Positives = 181/423 (42%), Gaps = 23/423 (5%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S      +  S    
Sbjct: 61  LEEEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A            +        +  E+                      ++
Sbjct: 120 RLLAEHNLDASTIKGTGVGGRLTREDVEKHLAKGES-------------------KAPAV 160

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
           +            + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 161 EPVAQPALGARGEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEV 220

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 221 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 277

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 278 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 337

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 338 PQSAILGMHAIKDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 397

Query: 421 MLM 423
           +L+
Sbjct: 398 LLL 400


>gi|254452451|ref|ZP_05065888.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Octadecabacter antarcticus 238]
 gi|198266857|gb|EDY91127.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Octadecabacter antarcticus 238]
          Length = 446

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 182/449 (40%), Positives = 274/449 (61%), Gaps = 32/449 (7%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD++  GD++ EIETDKA MEFE+V+EGI+ ++L
Sbjct: 1   MAIEILMPALSPTMEEGTLAKWLVKEGDEVKSGDLIAEIETDKATMEFEAVEEGIVSKLL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVR------------------EEH 103
           V  GTE + VN+PI  I  +  ++  +P    +  V+ +                     
Sbjct: 61  VAEGTEGVKVNTPICIIGEEGEDMSSAPAPKSKESVKDQGDTLSADKAESAAPASEPAAA 120

Query: 104 SHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
             S+P         +R  A+PLARR+A + G+DL+++ GSGPHGRI+K+D+E   +    
Sbjct: 121 PASAPKAAPAAKDGSRLFATPLARRIAKDKGLDLATIKGSGPHGRIIKADVENASAQPAA 180

Query: 164 VKDYSTIQSFGLVDE---------SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQ 214
               +   +                    ++ ++   +++ +  D +RK IA RL ++KQ
Sbjct: 181 ALAAAAAPASAAPAAATGAIAATGPSTEQVIKMYEGRTFKEVKLDGMRKIIASRLTEAKQ 240

Query: 215 TIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANV 274
           T+PHFY+  D  +D LL  R Q+N+TL+        K+SVND I+KA ALA+ ++PEAN 
Sbjct: 241 TVPHFYLRRDIELDALLKFRSQLNKTLEPR----GVKLSVNDFIIKACALALQEIPEANA 296

Query: 275 SWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPE 334
            W  + +++    D++VAV+I GG+ TP+++ A+ KS+  +S ++K LA RA+ RKL P 
Sbjct: 297 VWAGDRVLQMTASDVAVAVAIEGGLFTPVLQDAETKSLSALSAQMKDLAARARDRKLAPH 356

Query: 335 EYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLS 393
           EYQGG+ +ISN+GM GI++F A+INPP S ILA+GAG KK +   + +IKVAT+M+ TLS
Sbjct: 357 EYQGGSFAISNLGMFGIDNFDAIINPPHSAILAVGAGAKKPIVGADGDIKVATVMSTTLS 416

Query: 394 ADHRSVDGAIASKLLAKFKEYIENPVWML 422
            DHR +DGA+ + LL   K  +ENP+ ML
Sbjct: 417 VDHRVIDGAMGANLLNAIKANLENPMGML 445


>gi|110678914|ref|YP_681921.1| dihydrolipoamide succinyltransferase [Roseobacter denitrificans OCh
           114]
 gi|109455030|gb|ABG31235.1| dihydrolipoamide succinyltransferase [Roseobacter denitrificans OCh
           114]
          Length = 498

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 96/420 (22%), Positives = 164/420 (39%), Gaps = 23/420 (5%)

Query: 4   HTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVP 63
             + +P+L  ++TE  ++ W K  GD ++  ++LCE+ETDK  +E  +   G + EIL P
Sbjct: 100 VDVMVPTLGESVTEATVSTWFKAVGDSVAQDEMLCELETDKVSVEVPAPAAGTLSEILAP 159

Query: 64  AGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIAS 123
            G E +A    +  +             +                             + 
Sbjct: 160 EG-ETVAAGGKLAVLSSGDGATSAPAAAAATPAPAAPAA-------------------SG 199

Query: 124 PLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDAN 183
                 A      ++    S         D   +    +     +               
Sbjct: 200 SKDVEDAPSAKKAMAQAGLSPDQVTGTGRDGRIMKEDVSQAIAAAASAPAPAATAPAPRA 259

Query: 184 ILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQF 243
            ++       E +    +R+TIA RL+ S+ T        + ++  +++LR +       
Sbjct: 260 PVSADDASREERVKMTRLRQTIAKRLKDSQNTAAMLTTYNEVDMTEVMALRNEYKDLFLK 319

Query: 244 HREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPI 303
                  K+       KA   A+ +VPE N       ++    + + +A   P G+V P+
Sbjct: 320 K---HGVKLGFMSFFTKACCHALREVPEVNAEIDGTDIVYKNFVHMGIAAGTPTGLVVPV 376

Query: 304 IRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQS 363
           IR AD  S   I   + +   RA+  KL   E QGGT +ISN G+ G      ++NPPQS
Sbjct: 377 IRDADAMSFHAIEQAIAEKGARARDGKLSMAEMQGGTFTISNGGVYGSLMSSPILNPPQS 436

Query: 364 TILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            IL +   + + +  N ++ +  +M   LS DHR VDG  A   L + KE +E+P  +LM
Sbjct: 437 GILGMHKIQDRPMAINGQVVIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRLLM 496



 Score =  128 bits (320), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   + +P+L  ++TE  +A W K+ G+ ++  ++LCE+ETDK  +E  S   G + EI+
Sbjct: 1  MTTEVRVPTLGESVTEATVATWFKKPGEAVAVDEMLCELETDKVTVEVPSPMAGTLGEIV 60

Query: 62 VPAGTENIAVNSPILNILMDSTE 84
             G E + VN+ +  I   +  
Sbjct: 61 AGEG-ETVGVNALLATISEGAAA 82


>gi|323938304|gb|EGB34561.1| 2-oxoacid dehydrogenase acyltransferase [Escherichia coli E1520]
          Length = 405

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 101/423 (23%), Positives = 186/423 (43%), Gaps = 20/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S              
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A    I       +     I  + +   ++ +   K  +   +      + 
Sbjct: 107 ---EEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAA 163

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                   A  S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 164 APAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMRPIMDLRKQYGEA 223

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 224 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 280

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 281 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 340

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 341 PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 400

Query: 421 MLM 423
           +L+
Sbjct: 401 LLL 403


>gi|254486376|ref|ZP_05099581.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Roseobacter sp. GAI101]
 gi|214043245|gb|EEB83883.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Roseobacter sp. GAI101]
          Length = 507

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 106/421 (25%), Positives = 186/421 (44%), Gaps = 20/421 (4%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
              + +P+L  ++TE  ++ W K+ GD ++  ++LCE+ETDK  +E  S   G + EIL 
Sbjct: 105 TVDVMVPTLGESVTEATISTWFKKVGDTVAADEMLCELETDKVSVEVPSPAAGTLTEILF 164

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G   +  N  +  I  ++     +    +        +             S      
Sbjct: 165 EEGA-TVEANGKLAVITEEAGGASATSGTPETTAKPGGRD--------ASPSTSSGDIED 215

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
           +P A++   E GI    ++G+G  GR++K D+   +S  T+    +   +        DA
Sbjct: 216 APSAKKAMAEAGITRDQVTGTGRDGRVMKEDVAKAVSAGTSAAKPAPAAAPRAPSAPQDA 275

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
                      E +    +R+TIA RL+ S+ T        + ++  +++LR +      
Sbjct: 276 A--------REERVKMTRLRQTIARRLKDSQNTAAMLTTYNEVDMTEIMALRNEYKDLFL 327

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
                   K+       KA   A+ +VPE N       ++   ++++ +A   P G+V P
Sbjct: 328 KK---HGVKLGFMSFFTKACIHALHEVPEVNAEIDGTDVVYKNYVNMGIAAGTPTGLVVP 384

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           +I+ A   S   I   +  +  +A+  KL   E QGGT +ISN G+ G      ++NPPQ
Sbjct: 385 VIKDAQDMSFATIEKSIADMGAKARDGKLSMAEMQGGTFTISNGGVYGSLMSSPILNPPQ 444

Query: 363 STILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S IL +   + + +  N ++ +  +M   LS DHR VDG  A   L + KE +E+P  +L
Sbjct: 445 SGILGMHKIQDRPMAINGQVVIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRLL 504

Query: 423 M 423
           M
Sbjct: 505 M 505



 Score =  133 bits (333), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   + +P+L  ++TE  +A W K+ GD +   ++LCE+ETDK  +E  S   G + EI+
Sbjct: 1  MTSEVRVPTLGESVTEATVATWFKKPGDSVEVDEMLCELETDKVTVEVPSPVAGTLAEIV 60

Query: 62 VPAGTENIAVNSPILNILMDS 82
             G E + V++ + NI    
Sbjct: 61 AAEG-ETVGVDALLANISEGG 80


>gi|288958360|ref|YP_003448701.1| pyruvate dehydrogenase E2 component [Azospirillum sp. B510]
 gi|288910668|dbj|BAI72157.1| pyruvate dehydrogenase E2 component [Azospirillum sp. B510]
          Length = 444

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 183/450 (40%), Positives = 270/450 (60%), Gaps = 34/450 (7%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTMTEG LAKW+K+EGD +  GD+L EIETDKA ME E+VDEG I +IL
Sbjct: 1   MTVQILMPALSPTMTEGNLAKWLKKEGDTVKSGDVLAEIETDKATMEVEAVDEGRIGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIP---------------PSPPLSKENIVEVREEHSHS 106
           +PAG++ +AVN+PI  +L +  +                    P                
Sbjct: 61  IPAGSQGVAVNTPIAILLEEGEDESALASAGSAPAPVPAAAPAPAQTAAPAAAPVPAPAP 120

Query: 107 SPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI-------- 158
           +           R  ASPLARR+A + G+DL ++ G+GPHGRIVK+D+E           
Sbjct: 121 AAPAAAPAAGGARVFASPLARRIAEQAGVDLKTVKGTGPHGRIVKADVEAAKAAGPAKVA 180

Query: 159 -----STKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSK 213
                +            +     E +DA  L      +Y  +P+  +RKTIA RL + K
Sbjct: 181 DTPAAAAPAAAPAPVAAPAPAPKAEGVDAKALADKLGMAYTAVPNSGMRKTIAKRLGEVK 240

Query: 214 QTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEAN 273
           +T+P +Y+++D  ID L+ +R ++N     +      K+SVND I++A ALA+ +VP  N
Sbjct: 241 RTVPDYYLTVDVEIDALMKVRAELNGRSDAY------KLSVNDFIIRAVALALKKVPALN 294

Query: 274 VSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKP 333
            +WT  AM++ +H D+SVAV+ P G++TPI+++A+ K + DIS E+K LA++A+   LKP
Sbjct: 295 AAWTDEAMLQFQHADVSVAVATPTGLITPIVKKAETKGLADISNEMKVLAKKARDNALKP 354

Query: 334 EEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLS 393
           EEYQGGT SISN+GM+GI  F A+INPPQ+ ILA+GA E++ V ++  + +AT+M+ T +
Sbjct: 355 EEYQGGTISISNLGMMGIKQFAAIINPPQACILAVGASEQRPVVKDGALAIATVMSLTGT 414

Query: 394 ADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            DHR  DGA+ ++ LA  K+ +E+P+ ML+
Sbjct: 415 FDHRVADGAVGAEFLAAVKKLLEDPLSMLL 444


>gi|283784482|ref|YP_003364347.1| dihydrolipoamide succinyltransferase component (E2) [Citrobacter
           rodentium ICC168]
 gi|282947936|emb|CBG87500.1| dihydrolipoamide succinyltransferase component (E2) [Citrobacter
           rodentium ICC168]
          Length = 406

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 98/423 (23%), Positives = 179/423 (42%), Gaps = 19/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S      +  S    
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A            +        +       TK                   
Sbjct: 120 RLLAEHNLEASVIKGTGVGGRITREDVEKHLAKAPAKEETKA---------------PEA 164

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                      S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 165 APTAQPALGARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEA 224

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 225 FEKR---HGIRLGFMSFYVKAVVEALKRFPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 281

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  ++  GG  +I+N G+ G      +INP
Sbjct: 282 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINP 341

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 342 PQSAILGMHAIKDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTR 401

Query: 421 MLM 423
           +L+
Sbjct: 402 LLL 404


>gi|73541734|ref|YP_296254.1| dihydrolipoamide acetyltransferase [Ralstonia eutropha JMP134]
 gi|72119147|gb|AAZ61410.1| 2-oxoglutarate dehydrogenase E2 component [Ralstonia eutropha
           JMP134]
          Length = 419

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 106/423 (25%), Positives = 179/423 (42%), Gaps = 6/423 (1%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS ++ E  +  W K+ G+ ++  +IL EIETDK ++E  +   G++ +I
Sbjct: 1   MAIVDVKVPQLSESVAEATMLNWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLSQI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           +   G + +  +  I  I  ++T    +P  +           + ++            P
Sbjct: 61  IKNDG-DTVVADELIAKIDTEATAGAAAPAAAAPAPAAAAPAAAAAAAPAAAGAV--AMP 117

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
            A+ L        G    +          V                 +   +   + +  
Sbjct: 118 SAAKLMAEAGLSAGQVAGTGKDGRITKGDVLGASAAPAPAPAAKAAPAPAAAKPALPQVA 177

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                        E +P   +R  IA RL QS+ T        + N+  ++ LR +    
Sbjct: 178 ANVDFAALGDRPEERVPMSRLRARIAERLVQSQSTNAILTTFNEVNMKPVMDLRNKYKDR 237

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  P G+V
Sbjct: 238 FEKE---HGVKLGFMSFFVKAAVHALKKYPVINASVDGNDIVYHGYFDIGIAVGSPRGLV 294

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            PI+R ADQ S+ DI  ++ +   +A+  KL  EE  GGT SISN G  G      +INP
Sbjct: 295 VPILRNADQMSLADIEKKIAEFGAKARDGKLSLEELTGGTFSISNGGTFGSMLSTPIINP 354

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + V ++ +I +  +    +S DHR +DG  A   L   KE +E+P  
Sbjct: 355 PQSAILGVHATKDRAVVEDGQIVIRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPAR 414

Query: 421 MLM 423
           +L+
Sbjct: 415 LLL 417


>gi|197335246|ref|YP_002155586.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Vibrio fischeri MJ11]
 gi|197316736|gb|ACH66183.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Vibrio fischeri MJ11]
          Length = 403

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 98/422 (23%), Positives = 184/422 (43%), Gaps = 21/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W KQ GD +   +IL +IETDK ++E  + + G+++ IL
Sbjct: 1   MTIEILVPDLPESVADATVATWHKQPGDAVERDEILVDIETDKVVLEVPAPEAGVLEAIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  I   +                V  E +            K    
Sbjct: 61  EDEGA-TVLSKQLLARIKPGA----------------VVGEPTTDVTTATESSPDKRHTA 103

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           +       A    +             +  + +   I+ +      + +++    +++ D
Sbjct: 104 SLSEESNDALSPAVRRLLGEHDIAPSDVKGTGVGGRITREDVDAHIAALKAAPKAEKAAD 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                L    S + +P   +RKT+A RL ++K +        + N+  ++ LR+Q     
Sbjct: 164 KPAEALAH-RSEKRVPMTRLRKTVANRLLEAKNSTAMLTTFNEVNMKPIMDLRKQYKDQF 222

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 223 EER---HGTRLGFMSFYVKAVTEALKRYPEVNASIDGDDIVYHNYFDISMAVSTPRGLVT 279

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D     DI   +K+LA + +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 280 PVLKDCDTLGFADIEKGIKELAIKGRDGKLAVEDLMGGNFTITNGGVFGSLMSTPIINPP 339

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 340 QAAILGMHKIQDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARL 399

Query: 422 LM 423
           L+
Sbjct: 400 LL 401


>gi|332187183|ref|ZP_08388923.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Sphingomonas sp. S17]
 gi|332012883|gb|EGI54948.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Sphingomonas sp. S17]
          Length = 447

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 183/450 (40%), Positives = 258/450 (57%), Gaps = 33/450 (7%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +  GDI+ EIETDKA MEFE+VDEG+I +IL
Sbjct: 1   MSIEIKMPALSPTMEEGTLAKWLVKEGDTVKSGDIMAEIETDKATMEFEAVDEGVIAKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  GT+N+ V + I  +  +  +       +K       +          +         
Sbjct: 61  VSEGTDNVKVGTVIAILAEEGEDASSVQAPTKSETPAPAKPMPTDPTDPNKTGSEAKPAE 120

Query: 122 ASPLA-----------------------------RRLAGEHGIDLSSLSGSGPHGRIVKS 152
            +                                RR+A + G+DLS+L+GSGP+GRIVK+
Sbjct: 121 RTLTQAEDHGKPVDSGKQGGSSAGNGRAIASPLARRVASQKGLDLSALTGSGPNGRIVKA 180

Query: 153 DIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQS 212
           D+E     +      +T  S       + A          +E     N+RKTIA RL +S
Sbjct: 181 DVENAQPGQAKAVPAATASSSETASAPVAAPKPAQVPDIPHEASKLSNMRKTIARRLTES 240

Query: 213 KQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEA 272
           KQ +PH Y+++D  +D LL LR ++N  L+        K+SVND+++KA  +A++ VP+ 
Sbjct: 241 KQQVPHIYLTVDVRLDALLKLRGELNAGLESR----GVKLSVNDMLIKALGVALMAVPKC 296

Query: 273 NVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLK 332
           NV +T + +I  K  DISVAVS P G++TPI+ +AD +S+  IS  +K LA RA+  KL+
Sbjct: 297 NVMFTPDQLISFKRADISVAVSTPAGLITPIVSEADTRSLSSISTTMKDLATRARDNKLQ 356

Query: 333 PEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATL 392
           P E+QGGT SISNMGM GI  F AVINPPQ  ILAIGAGEK+    ++++ VAT+M+AT 
Sbjct: 357 PHEFQGGTASISNMGMFGIKQFEAVINPPQGMILAIGAGEKRPYIVDDQLGVATVMSATG 416

Query: 393 SADHRSVDGAIASKLLAKFKEYIENPVWML 422
           S DHR++DGA  ++L+  FKE +E P+ ML
Sbjct: 417 SFDHRAIDGADGAELMKVFKELVERPLAML 446


>gi|187730708|ref|YP_001879382.1| dihydrolipoamide succinyltransferase [Shigella boydii CDC 3083-94]
 gi|187427700|gb|ACD06974.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Shigella boydii CDC 3083-94]
          Length = 405

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 101/423 (23%), Positives = 186/423 (43%), Gaps = 20/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S              
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A    I       +     I  + +   ++ +   K  +   +      + 
Sbjct: 107 ---EEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKSPAKESAPAAA 163

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                   A  S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 164 APAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEA 223

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 224 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 280

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 281 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 340

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 341 PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 400

Query: 421 MLM 423
           +L+
Sbjct: 401 LLL 403


>gi|193065532|ref|ZP_03046600.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli E22]
 gi|194429070|ref|ZP_03061601.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli B171]
 gi|260842933|ref|YP_003220711.1| dihydrolipoyltranssuccinase [Escherichia coli O103:H2 str. 12009]
 gi|192926821|gb|EDV81447.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli E22]
 gi|194412901|gb|EDX29192.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli B171]
 gi|257758080|dbj|BAI29577.1| dihydrolipoyltranssuccinase [Escherichia coli O103:H2 str. 12009]
 gi|323158776|gb|EFZ44789.1| dihydrolipoyllysine-residue succinyltransferase [Escherichia coli
           E128010]
          Length = 405

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 103/423 (24%), Positives = 187/423 (44%), Gaps = 20/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     I  +   ++    +   S+E      +    S              
Sbjct: 61  LEDEGT-TVTSRQIIGRLREGNSAGKETSAKSEEKASTPAQRQQASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A    I       +     I  + +   ++ +   K  +   +      + 
Sbjct: 107 ---EEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAA 163

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
           D       A  S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 164 DPAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEA 223

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 224 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 280

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 281 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 340

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 341 PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 400

Query: 421 MLM 423
           +L+
Sbjct: 401 LLL 403


>gi|148657500|ref|YP_001277705.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Roseiflexus sp. RS-1]
 gi|148569610|gb|ABQ91755.1| 2-oxoglutarate dehydrogenase E2 component [Roseiflexus sp. RS-1]
          Length = 400

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 113/425 (26%), Positives = 192/425 (45%), Gaps = 30/425 (7%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++ E  +  W K EGD ++ G++L E+ETDK  +E  +   GI+  IL
Sbjct: 1   MAVEIKVPTLGESIVEATVGAWHKHEGDPVTAGEVLVELETDKVTVEVTASGSGILSRIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
            P G   + +   +  I     E                                  R  
Sbjct: 61  KPDGA-TVTIGELLGVIAEKVEEPAMPLHDGAG-----------------------ARVT 96

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A+P+ARRLA  HG+D++++ GSGP GR+ K D+    +          + +      ++ 
Sbjct: 97  ATPVARRLAETHGVDIAAIPGSGPGGRVTKDDVIRHGAGSPAPLPTEAVPAVTPHTPALT 156

Query: 182 A---NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMN 238
                          E I     R+TIA RL ++++T        + ++  ++ LR++  
Sbjct: 157 PATQPAPVPDDGRREERIRMTRRRQTIAARLVEAQRTAAMLTTFNEIDMSAVIDLRKR-- 214

Query: 239 RTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGG 298
              +  RE     +       KA   A+   P  N     + +I   + DI +AVS   G
Sbjct: 215 -HRESFRERHGVGLGFMSFFTKAVIGALKAFPLLNAEIRGDEIIVKHYYDIGIAVSTDEG 273

Query: 299 IVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVI 358
           +V P++R AD+ S  +I   +++LA RA++ KL   + QGGT +I+N G+ G      ++
Sbjct: 274 LVVPVLRNADRLSFAEIERSIEELAHRARESKLTIADLQGGTFTITNGGIFGSLMSTPIL 333

Query: 359 NPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENP 418
           N PQ  IL +   +++ V  N ++ +  +M   LS DHR +DG  A   L + KE +E+P
Sbjct: 334 NAPQVGILGMHKIQERPVALNGQVVIRPMMYVALSYDHRIIDGREAVSFLVRVKELVEDP 393

Query: 419 VWMLM 423
             +L+
Sbjct: 394 ERLLL 398


>gi|218288894|ref|ZP_03493145.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218240983|gb|EED08160.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 415

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 103/422 (24%), Positives = 179/422 (42%), Gaps = 9/422 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   + +PSL  ++ E  + +W+K+EGD +  G+ + E+ETDK  +E  + + G++ +IL
Sbjct: 1   MA-EVKVPSLGESIVEATIGQWLKREGDAVESGEAIAELETDKVNVEVIAEESGVLAQIL 59

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + +A+   I  I        P+P  +        +  + S+P       ++    
Sbjct: 60  KQVG-DTVAIGDVIAVIAEGQAPSAPAPESAPAAQAPEVKPSAPSAPQAPSAPAAQQAST 118

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                              + +     + +     L          +         +   
Sbjct: 119 QQVSVPGELLVRPTPSLRRAAAAQGIDLRQVQAGALGLGAQPAAPAAPKAPSAPAAQPAA 178

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            + L    +   E I     R TIA RL +++ T        + ++  ++ +R++     
Sbjct: 179 QSAL----RPDEERIRMSRRRATIAKRLVEAQHTAAMLTTFNEVDMSRVIEIRKRRK--- 231

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
              RE+    +       KA   A+ Q P  N       MI   H DI +AV+  GG+V 
Sbjct: 232 DAFREKYGVGLGYMSFFTKAVVGALKQFPLLNAEIQGEDMIVKHHYDIGIAVATEGGLVV 291

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD+ +  +I  ++  LA RA+  KL  EE QGGT +I+N G  G      ++N P
Sbjct: 292 PVVRNADRLTFAEIEQQIADLAARARANKLSLEELQGGTFTITNGGTFGSLFSTPILNAP 351

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q  IL +    ++ V  N ++++  +M   LS DHR VDGA A   L   K  IE+P  +
Sbjct: 352 QVGILGMHNIVERPVAVNGQVEIRPMMYIALSYDHRIVDGAEAVSFLVTVKRLIEDPESL 411

Query: 422 LM 423
           L+
Sbjct: 412 LL 413


>gi|295689367|ref|YP_003593060.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Caulobacter segnis ATCC 21756]
 gi|295431270|gb|ADG10442.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Caulobacter segnis ATCC 21756]
          Length = 429

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 176/433 (40%), Positives = 249/433 (57%), Gaps = 15/433 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW  + GD +  GD++ EIETDKA ME E+VDEG+++ IL
Sbjct: 1   MSIDILMPALSPTMEEGTLAKWHVKVGDTVKAGDVIAEIETDKATMEVEAVDEGVVEAIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V AGTEN+ VN+ I  +  +     P+P              + +         +   P+
Sbjct: 61  VDAGTENVKVNALIAKLAGEGESPAPAPKAEAPKAAAAAPAPTAAPAAPAPAAPAPAAPV 120

Query: 122 ASPLARRLAGEHGIDLSS-----------LSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
           A+  +R  A      L+S               G   +      ++           ++ 
Sbjct: 121 AADGSRVFASPLARRLASAAGLDLKSIKGTGPHGRVIKSDVEAAKSGAPAAKAAPASTSA 180

Query: 171 QSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNL 230
                      +         SY+++P D +RKTIA RL  S + +PHF + ID  ID L
Sbjct: 181 APAAAEPRKALSLEQMGIPAGSYDLVPLDGMRKTIARRLTDSFRDVPHFPLQIDLEIDAL 240

Query: 231 LSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDIS 290
           L+ R ++N  L+        K+SVNDI++KA A+A+ QVPEAN S+T   +  H + DI+
Sbjct: 241 LAARAKINSLLEKQ----GVKVSVNDIVIKAAAVALKQVPEANASYTPEGIAMHHNADIA 296

Query: 291 VAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLG 350
           VAV+I GG++TPIIR+A+ K +  IS E+K LAQRAK +KLKPEE+QGGT SISN+GM G
Sbjct: 297 VAVAIDGGLITPIIRKAETKGLAQISAEMKDLAQRAKDKKLKPEEFQGGTFSISNLGMFG 356

Query: 351 INSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAK 410
           I SF ++IN PQ  I+++GAGE++ V +N E+KVAT+M  TL+ DHR VDGAI +K LA 
Sbjct: 357 IKSFASIINEPQGAIMSVGAGEQRPVVKNGELKVATVMTVTLTCDHRVVDGAIGAKFLAA 416

Query: 411 FKEYIENPVWMLM 423
           FK  IE P+ +++
Sbjct: 417 FKPLIEEPLTLIV 429


>gi|212639718|ref|YP_002316238.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Anoxybacillus flavithermus WK1]
 gi|212561198|gb|ACJ34253.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide
           acyltransferase (E2) component [Anoxybacillus
           flavithermus WK1]
          Length = 434

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 102/434 (23%), Positives = 189/434 (43%), Gaps = 17/434 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M     +P +   + EG++ KW  + GD+++  D+LCE++ DKA++E  S  +G + EIL
Sbjct: 4   MAFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEIL 63

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  GT    V   ++       E         +      ++         +E+ ++ +P 
Sbjct: 64  VSEGT-VATVGQTLIKFDAPGYENLKFKGDHGDEPKVEEKKEEVKQEQPAQEQPAQAQPK 122

Query: 122 ASPLARRLAGEHGIDLS----------SLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQ 171
              +A     ++  +                                 T+       T+ 
Sbjct: 123 KRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKQDIDAYLAGGAAPQTEAKAPQAETVA 182

Query: 172 SFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLL 231
                  +  A  + L  +          IR+ IA  +  SK T PH  +  + ++  L+
Sbjct: 183 PAQEQKAAPTAQPVVLEGEFPETREKMSGIRRAIAKAMVNSKHTAPHVTLMDEVDVTKLV 242

Query: 232 SLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTT--NAMIRHKHIDI 289
           + R++     +    +   K++    ++KA   A+ + P  N S       ++   + +I
Sbjct: 243 AHRKK----FKDVAAQKGIKLTFLPYVVKALTSALREYPALNTSIDDATEEIVHKHYYNI 298

Query: 290 SVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGML 349
            +A     G++ P+++ AD+KSI  I+ E+ +LA +A++ KL P E +G T +I+N+G  
Sbjct: 299 GIAADTDKGLLVPVVKHADRKSIFAIAKEINELATKAREGKLMPNEMKGATCTITNIGSA 358

Query: 350 GINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLA 409
           G   F  VIN P+  IL IG   +K + ++ EI +A ++  +LS DHR +DGA A   L 
Sbjct: 359 GGQWFTPVINHPEVAILGIGRISEKPIVRDGEIVIAPVLALSLSFDHRMIDGATAQNALN 418

Query: 410 KFKEYIENPVWMLM 423
             K  + +P  +LM
Sbjct: 419 HIKRLLNDPELLLM 432


>gi|300715879|ref|YP_003740682.1| dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Erwinia billingiae
           Eb661]
 gi|299061715|emb|CAX58831.1| Dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Erwinia billingiae
           Eb661]
          Length = 407

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 99/423 (23%), Positives = 177/423 (41%), Gaps = 18/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK I+E  +  +G+++ I
Sbjct: 1   MSSVEIIVPDLPESVADATVATWHKKPGDSVQRDEVLVEIETDKVILEVPATADGVLEAI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G   +     +  +   ++    S    +E      +  S S      +  S    
Sbjct: 61  LEDEGA-TVISRQALGRLKEGNSGGKASSAKVEEQDSTPAQRQSASLEEESNDALSPAIR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A                 +                       +      + 
Sbjct: 120 RLIAEHNLDA--------------AAIKGTGVGGRLTREDVEKHLAKKPEAAAKAPAAAA 165

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
            +         S + +P   +RK IA RL ++K +        + N+  +++LR+Q    
Sbjct: 166 PSAPAAALPGRSEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVNMQPIMNLRKQYGEA 225

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      LKA   A+ + PE N S     ++ H + D+S+AVS P G+V
Sbjct: 226 FEKR---HGVRLGFMSFYLKAVVEALKRFPEVNASIDGEDVVYHNYFDVSIAVSTPRGLV 282

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP+++  D   + DI  ++K+LA + +  KL  +E  GG  +I+N G+ G      +INP
Sbjct: 283 TPVLKDIDALGMADIEKKIKELAVKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINP 342

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++ +  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 343 PQSAILGMHAIKDRPMAVNGQVVILPMMYLALSYDHRLIDGKESVSYLVAIKELLEDPSR 402

Query: 421 MLM 423
           +L+
Sbjct: 403 LLL 405


>gi|229544291|ref|ZP_04433350.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Bacillus coagulans 36D1]
 gi|229325430|gb|EEN91106.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Bacillus coagulans 36D1]
          Length = 422

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 102/425 (24%), Positives = 180/425 (42%), Gaps = 8/425 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L+ ++TEG +A+W+K  GD +  G+ + E+ETDK  +E  S +EG++  +L
Sbjct: 1   MA-EIKVPELAESITEGTIAQWLKHPGDHVDKGEYIVELETDKVNVEVISEEEGVVQSLL 59

Query: 62  VPAGTENIAVNSPILNILMDSTE--IPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNR 119
              G + + V   I  +   + E    PS P  +    +  +  + +       +  K  
Sbjct: 60  FEEG-DTVQVGDVIAIVGEGTGENSATPSAPQKEAEAPQPAQAEAPAQTQAPAPEQQKPA 118

Query: 120 PIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDES 179
              S      +                   V                 +  ++    ++ 
Sbjct: 119 QEESESRPIASPAARKLAREKGIDLSQVPAVDPLGRVRKQDVETFNPQAAAKAPAAPEKP 178

Query: 180 IDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
               ++   A    E I     R+TIA RL +  QT        + ++  ++ LR++   
Sbjct: 179 AAGKVVPEEAGKPIERIRMSRRRQTIAKRLVEVTQTTAMLTTFNEIDMTAVMDLRKRKKE 238

Query: 240 TLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGI 299
                 ++   ++       KA    + + P  N     N ++  K+ DI +AVS   G+
Sbjct: 239 QF---VKDHDIRLGFMSFFTKAVVAGLKKYPYVNAEIQGNELLLKKYYDIGIAVSTEEGL 295

Query: 300 VTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVIN 359
           V P++R  D+KS  +I  ++   AQ+A+  KL   + QGGT +I+N G+ G      +IN
Sbjct: 296 VVPVVRDCDRKSFAEIEADIAAFAQKARDNKLALSDLQGGTFTITNGGVFGSLFSTPIIN 355

Query: 360 PPQSTILAIGAGEKKVVFQNEE-IKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENP 418
             Q  IL +   +K+ V  + + I++  +M   LS DHR +DG  A   L   K  IENP
Sbjct: 356 GTQVGILGMHTIQKRPVAVDGDRIEIRPMMYVALSYDHRVIDGKDAVGFLKTVKTLIENP 415

Query: 419 VWMLM 423
             +L+
Sbjct: 416 EDLLL 420


>gi|324114836|gb|EGC08804.1| 2-oxoacid dehydrogenase acyltransferase [Escherichia fergusonii
           B253]
 gi|325498099|gb|EGC95958.1| dihydrolipoamide succinyltransferase (E2 component) [Escherichia
           fergusonii ECD227]
          Length = 405

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 101/423 (23%), Positives = 186/423 (43%), Gaps = 20/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S              
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A    I       +     I  + +   ++ +   K  +   +      + 
Sbjct: 107 ---EEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAA 163

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                   A  S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 164 ATAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEA 223

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 224 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 280

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 281 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 340

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 341 PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 400

Query: 421 MLM 423
           +L+
Sbjct: 401 LLL 403


>gi|320177270|gb|EFW52276.1| Dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Shigella
           dysenteriae CDC 74-1112]
          Length = 405

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 101/423 (23%), Positives = 185/423 (43%), Gaps = 20/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S              
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A    I       +     I  + +   ++ +   K      +      + 
Sbjct: 107 ---EEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLEKSPAKESAPAAA 163

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                   A  S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 164 APAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEA 223

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 224 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 280

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 281 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 340

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 341 PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 400

Query: 421 MLM 423
           +L+
Sbjct: 401 LLL 403


>gi|331651724|ref|ZP_08352743.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli M718]
 gi|331050002|gb|EGI22060.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli M718]
          Length = 405

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 101/423 (23%), Positives = 187/423 (44%), Gaps = 20/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S              
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A    I       +     I  + +   ++ +   K  +   +      + 
Sbjct: 107 ---EEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAA 163

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
            +      A  S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 164 ASAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEA 223

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 224 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 280

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 281 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 340

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 341 PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 400

Query: 421 MLM 423
           +L+
Sbjct: 401 LLL 403


>gi|284920505|emb|CBG33567.1| dihydrolipoamide succinyltransferase component (E2) [Escherichia
           coli 042]
          Length = 405

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 100/423 (23%), Positives = 185/423 (43%), Gaps = 20/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S              
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A    I       +     I  + +   ++ +   K  +   +      + 
Sbjct: 107 ---EEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAA 163

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                      S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 164 APAAQPALVARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEA 223

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 224 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 280

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 281 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 340

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 341 PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 400

Query: 421 MLM 423
           +L+
Sbjct: 401 LLL 403


>gi|91209760|ref|YP_539746.1| dihydrolipoamide succinyltransferase [Escherichia coli UTI89]
 gi|117622920|ref|YP_851833.1| dihydrolipoamide acetyltransferase [Escherichia coli APEC O1]
 gi|218557642|ref|YP_002390555.1| dihydrolipoamide succinyltransferase [Escherichia coli S88]
 gi|218688520|ref|YP_002396732.1| dihydrolipoamide succinyltransferase [Escherichia coli ED1a]
 gi|237707311|ref|ZP_04537792.1| dihydrolipoyltranssuccinase [Escherichia sp. 3_2_53FAA]
 gi|306812865|ref|ZP_07447058.1| dihydrolipoamide succinyltransferase [Escherichia coli NC101]
 gi|331656744|ref|ZP_08357706.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli TA206]
 gi|91071334|gb|ABE06215.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Escherichia coli UTI89]
 gi|115512044|gb|ABJ00119.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Escherichia coli APEC O1]
 gi|218364411|emb|CAR02091.1| dihydrolipoyltranssuccinase [Escherichia coli S88]
 gi|218426084|emb|CAR06902.1| dihydrolipoyltranssuccinase [Escherichia coli ED1a]
 gi|222032463|emb|CAP75202.1| Dihydrolipoyllysine-residue succinyltransferase component
           [Escherichia coli LF82]
 gi|226898521|gb|EEH84780.1| dihydrolipoyltranssuccinase [Escherichia sp. 3_2_53FAA]
 gi|294490338|gb|ADE89094.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli IHE3034]
 gi|305853628|gb|EFM54067.1| dihydrolipoamide succinyltransferase [Escherichia coli NC101]
 gi|307627859|gb|ADN72163.1| dihydrolipoamide succinyltransferase [Escherichia coli UM146]
 gi|312945251|gb|ADR26078.1| dihydrolipoamide succinyltransferase [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|315287159|gb|EFU46571.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           110-3]
 gi|315299271|gb|EFU58523.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           16-3]
 gi|323952715|gb|EGB48583.1| 2-oxoacid dehydrogenase acyltransferase [Escherichia coli H252]
 gi|323958471|gb|EGB54177.1| 2-oxoacid dehydrogenase acyltransferase [Escherichia coli H263]
 gi|331054992|gb|EGI27001.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli TA206]
          Length = 405

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 101/423 (23%), Positives = 186/423 (43%), Gaps = 20/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S              
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A    I       +     I  + +   ++ +   K  +   +      + 
Sbjct: 107 ---EEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAP 163

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                   A  S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 164 APAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEA 223

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 224 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 280

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 281 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 340

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 341 PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 400

Query: 421 MLM 423
           +L+
Sbjct: 401 LLL 403


>gi|26246694|ref|NP_752734.1| dihydrolipoamide succinyltransferase [Escherichia coli CFT073]
 gi|110640935|ref|YP_668663.1| dihydrolipoamide succinyltransferase [Escherichia coli 536]
 gi|191174062|ref|ZP_03035578.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli F11]
 gi|227884307|ref|ZP_04002112.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli 83972]
 gi|300972375|ref|ZP_07171912.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           200-1]
 gi|300993152|ref|ZP_07180235.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           45-1]
 gi|301051354|ref|ZP_07198177.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           185-1]
 gi|26107093|gb|AAN79277.1|AE016757_181 Dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Escherichia coli CFT073]
 gi|110342527|gb|ABG68764.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Escherichia coli 536]
 gi|190905670|gb|EDV65293.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli F11]
 gi|227838728|gb|EEJ49194.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli 83972]
 gi|300297016|gb|EFJ53401.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           185-1]
 gi|300309174|gb|EFJ63694.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           200-1]
 gi|300406682|gb|EFJ90220.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           45-1]
 gi|307552578|gb|ADN45353.1| dihydrolipoyllysine-residue succinyltransferase component of
           2-oxoglutarate dehydrogenase complex [Escherichia coli
           ABU 83972]
 gi|315292640|gb|EFU51992.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           153-1]
 gi|320194116|gb|EFW68748.1| Dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Escherichia coli
           WV_060327]
 gi|324010448|gb|EGB79667.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           60-1]
          Length = 405

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 101/423 (23%), Positives = 186/423 (43%), Gaps = 20/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S              
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A    I       +     I  + +   ++ +   K  +   +      + 
Sbjct: 107 ---EEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAA 163

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                   A  S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 164 APAAQPTLAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEA 223

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 224 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 280

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 281 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 340

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 341 PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 400

Query: 421 MLM 423
           +L+
Sbjct: 401 LLL 403


>gi|15800431|ref|NP_286443.1| dihydrolipoamide succinyltransferase [Escherichia coli O157:H7
           EDL933]
 gi|15830006|ref|NP_308779.1| dihydrolipoamide succinyltransferase [Escherichia coli O157:H7 str.
           Sakai]
 gi|16128702|ref|NP_415255.1| dihydrolipoyltranssuccinase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|74311251|ref|YP_309670.1| dihydrolipoamide succinyltransferase [Shigella sonnei Ss046]
 gi|89107584|ref|AP_001364.1| dihydrolipoyltranssuccinase [Escherichia coli str. K-12 substr.
           W3110]
 gi|157157585|ref|YP_001461886.1| dihydrolipoamide succinyltransferase [Escherichia coli E24377A]
 gi|168750658|ref|ZP_02775680.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4113]
 gi|168757180|ref|ZP_02782187.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4401]
 gi|168764008|ref|ZP_02789015.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4501]
 gi|168767167|ref|ZP_02792174.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4486]
 gi|168777543|ref|ZP_02802550.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4196]
 gi|168779210|ref|ZP_02804217.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4076]
 gi|168786880|ref|ZP_02811887.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC869]
 gi|168801364|ref|ZP_02826371.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC508]
 gi|170020929|ref|YP_001725883.1| dihydrolipoamide succinyltransferase [Escherichia coli ATCC 8739]
 gi|170080393|ref|YP_001729713.1| dihydrolipoyltranssuccinase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170681017|ref|YP_001742827.1| dihydrolipoamide succinyltransferase [Escherichia coli SMS-3-5]
 gi|188492199|ref|ZP_02999469.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Escherichia coli 53638]
 gi|191167199|ref|ZP_03029018.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli B7A]
 gi|193070661|ref|ZP_03051598.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli E110019]
 gi|194433983|ref|ZP_03066254.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Shigella dysenteriae 1012]
 gi|194439254|ref|ZP_03071334.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli 101-1]
 gi|195939068|ref|ZP_03084450.1| dihydrolipoamide acetyltransferase [Escherichia coli O157:H7 str.
           EC4024]
 gi|208805894|ref|ZP_03248231.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4206]
 gi|208815793|ref|ZP_03256972.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4045]
 gi|208822873|ref|ZP_03263191.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4042]
 gi|209397255|ref|YP_002269350.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4115]
 gi|209917977|ref|YP_002292061.1| dihydrolipoamide succinyltransferase [Escherichia coli SE11]
 gi|215485745|ref|YP_002328176.1| dihydrolipoamide succinyltransferase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217326096|ref|ZP_03442180.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. TW14588]
 gi|218553253|ref|YP_002386166.1| dihydrolipoamide succinyltransferase [Escherichia coli IAI1]
 gi|218699081|ref|YP_002406710.1| dihydrolipoamide succinyltransferase [Escherichia coli IAI39]
 gi|238899991|ref|YP_002925787.1| dihydrolipoyltranssuccinase [Escherichia coli BW2952]
 gi|253774303|ref|YP_003037134.1| dihydrolipoamide succinyltransferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160796|ref|YP_003043904.1| dihydrolipoamide succinyltransferase [Escherichia coli B str.
           REL606]
 gi|254791873|ref|YP_003076710.1| dihydrolipoamide succinyltransferase [Escherichia coli O157:H7 str.
           TW14359]
 gi|256023672|ref|ZP_05437537.1| dihydrolipoamide succinyltransferase [Escherichia sp. 4_1_40B]
 gi|260853961|ref|YP_003227852.1| dihydrolipoyltranssuccinase [Escherichia coli O26:H11 str. 11368]
 gi|260866857|ref|YP_003233259.1| dihydrolipoyltranssuccinase [Escherichia coli O111:H- str. 11128]
 gi|261224427|ref|ZP_05938708.1| dihydrolipoamide succinyltransferase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261254582|ref|ZP_05947115.1| dihydrolipoamide succinyltransferase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291281659|ref|YP_003498477.1| Dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (Succinyl-transferring)
           complex [Escherichia coli O55:H7 str. CB9615]
 gi|293409100|ref|ZP_06652676.1| dihydrolipoyllysine-residue succinyltransferase [Escherichia coli
           B354]
 gi|293414004|ref|ZP_06656653.1| dihydrolipoyllysine-residue succinyltransferase [Escherichia coli
           B185]
 gi|293432995|ref|ZP_06661423.1| dihydrolipoyllysine-residue succinyltransferase [Escherichia coli
           B088]
 gi|300906984|ref|ZP_07124653.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           84-1]
 gi|300918386|ref|ZP_07134986.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           115-1]
 gi|300926129|ref|ZP_07141942.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           182-1]
 gi|300929469|ref|ZP_07144937.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           187-1]
 gi|300937817|ref|ZP_07152613.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           21-1]
 gi|300947194|ref|ZP_07161404.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           116-1]
 gi|300957673|ref|ZP_07169863.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           175-1]
 gi|301020813|ref|ZP_07184877.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           69-1]
 gi|301027093|ref|ZP_07190465.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           196-1]
 gi|301305213|ref|ZP_07211311.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           124-1]
 gi|301327918|ref|ZP_07221089.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           78-1]
 gi|301648030|ref|ZP_07247797.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           146-1]
 gi|307137338|ref|ZP_07496694.1| dihydrolipoamide succinyltransferase [Escherichia coli H736]
 gi|309797439|ref|ZP_07691831.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           145-7]
 gi|312965157|ref|ZP_07779394.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli 2362-75]
 gi|331641227|ref|ZP_08342362.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli H736]
 gi|331645875|ref|ZP_08346978.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli M605]
 gi|331662079|ref|ZP_08363002.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli TA143]
 gi|331672241|ref|ZP_08373032.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli TA280]
 gi|331682157|ref|ZP_08382779.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli H299]
 gi|84027823|sp|P0AFG7|ODO2_ECO57 RecName: Full=Dihydrolipoyllysine-residue succinyltransferase
           component of 2-oxoglutarate dehydrogenase complex;
           AltName: Full=2-oxoglutarate dehydrogenase complex
           component E2; Short=OGDC-E2; AltName:
           Full=Dihydrolipoamide succinyltransferase component of
           2-oxoglutarate dehydrogenase complex
 gi|84027824|sp|P0AFG6|ODO2_ECOLI RecName: Full=Dihydrolipoyllysine-residue succinyltransferase
           component of 2-oxoglutarate dehydrogenase complex;
           AltName: Full=2-oxoglutarate dehydrogenase complex
           component E2; Short=OGDC-E2; AltName:
           Full=Dihydrolipoamide succinyltransferase component of
           2-oxoglutarate dehydrogenase complex
 gi|12513642|gb|AAG55051.1|AE005250_10 2-oxoglutarate dehydrogenase (dihydrolipoyltranssuccinase E2
           component) [Escherichia coli O157:H7 str. EDL933]
 gi|43022|emb|CAA25284.1| unnamed protein product [Escherichia coli K-12]
 gi|146202|gb|AAA23898.1| dihydrolipoamide succinyltransferase [Escherichia coli K-12]
 gi|1651322|dbj|BAA35393.1| dihydrolipoyltranssuccinase [Escherichia coli str. K12 substr.
           W3110]
 gi|1786946|gb|AAC73821.1| dihydrolipoyltranssuccinase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|13360210|dbj|BAB34175.1| 2-oxoglutarate dehydrogenase dihydrolipoyltranssuccinase E2
           component [Escherichia coli O157:H7 str. Sakai]
 gi|73854728|gb|AAZ87435.1| 2-oxoglutarate dehydrogenase dihydrolipoyltranssuccinase E2
           component [Shigella sonnei Ss046]
 gi|157079615|gb|ABV19323.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli E24377A]
 gi|169755857|gb|ACA78556.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Escherichia coli ATCC 8739]
 gi|169888228|gb|ACB01935.1| dihydrolipoyltranssuccinase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170518735|gb|ACB16913.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli SMS-3-5]
 gi|187767227|gb|EDU31071.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4196]
 gi|188015221|gb|EDU53343.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4113]
 gi|188487398|gb|EDU62501.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Escherichia coli 53638]
 gi|189002966|gb|EDU71952.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4076]
 gi|189355777|gb|EDU74196.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4401]
 gi|189363360|gb|EDU81779.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4486]
 gi|189365937|gb|EDU84353.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4501]
 gi|189372983|gb|EDU91399.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC869]
 gi|189376474|gb|EDU94890.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC508]
 gi|190902747|gb|EDV62477.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli B7A]
 gi|192956049|gb|EDV86515.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli E110019]
 gi|194417748|gb|EDX33846.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Shigella dysenteriae 1012]
 gi|194421839|gb|EDX37846.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli 101-1]
 gi|208725695|gb|EDZ75296.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4206]
 gi|208732441|gb|EDZ81129.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4045]
 gi|208737066|gb|EDZ84750.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4042]
 gi|209158655|gb|ACI36088.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. EC4115]
 gi|209776478|gb|ACI86551.1| 2-oxoglutarate dehydrogenase dihydrolipoyltranssuccinase E2
           component [Escherichia coli]
 gi|209776480|gb|ACI86552.1| 2-oxoglutarate dehydrogenase dihydrolipoyltranssuccinase E2
           component [Escherichia coli]
 gi|209776482|gb|ACI86553.1| 2-oxoglutarate dehydrogenase dihydrolipoyltranssuccinase E2
           component [Escherichia coli]
 gi|209776484|gb|ACI86554.1| 2-oxoglutarate dehydrogenase dihydrolipoyltranssuccinase E2
           component [Escherichia coli]
 gi|209776486|gb|ACI86555.1| 2-oxoglutarate dehydrogenase dihydrolipoyltranssuccinase E2
           component [Escherichia coli]
 gi|209911236|dbj|BAG76310.1| 2-oxoglutarate dehydrogenase E2 component [Escherichia coli SE11]
 gi|215263817|emb|CAS08154.1| dihydrolipoyltranssuccinase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217322317|gb|EEC30741.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli O157:H7 str. TW14588]
 gi|218360021|emb|CAQ97568.1| dihydrolipoyltranssuccinase [Escherichia coli IAI1]
 gi|218369067|emb|CAR16821.1| dihydrolipoyltranssuccinase [Escherichia coli IAI39]
 gi|238860764|gb|ACR62762.1| dihydrolipoyltranssuccinase [Escherichia coli BW2952]
 gi|242376488|emb|CAQ31192.1| sucB, subunit of dihydrolipoyltranssuccinylase and 2-oxoglutarate
           dehydrogenase complex [Escherichia coli BL21(DE3)]
 gi|253325347|gb|ACT29949.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972697|gb|ACT38368.1| dihydrolipoamide acetyltransferase [Escherichia coli B str. REL606]
 gi|253976891|gb|ACT42561.1| dihydrolipoamide acetyltransferase [Escherichia coli BL21(DE3)]
 gi|254591273|gb|ACT70634.1| dihydrolipoyltranssuccinase [Escherichia coli O157:H7 str. TW14359]
 gi|257752610|dbj|BAI24112.1| dihydrolipoyltranssuccinase [Escherichia coli O26:H11 str. 11368]
 gi|257763213|dbj|BAI34708.1| dihydrolipoyltranssuccinase [Escherichia coli O111:H- str. 11128]
 gi|260450120|gb|ACX40542.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Escherichia coli DH1]
 gi|290761532|gb|ADD55493.1| Dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (Succinyl-transferring)
           complex [Escherichia coli O55:H7 str. CB9615]
 gi|291323814|gb|EFE63236.1| dihydrolipoyllysine-residue succinyltransferase [Escherichia coli
           B088]
 gi|291434062|gb|EFF07035.1| dihydrolipoyllysine-residue succinyltransferase [Escherichia coli
           B185]
 gi|291469568|gb|EFF12052.1| dihydrolipoyllysine-residue succinyltransferase [Escherichia coli
           B354]
 gi|299879427|gb|EFI87638.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           196-1]
 gi|300315618|gb|EFJ65402.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           175-1]
 gi|300398459|gb|EFJ81997.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           69-1]
 gi|300401205|gb|EFJ84743.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           84-1]
 gi|300414449|gb|EFJ97759.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           115-1]
 gi|300417828|gb|EFK01139.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           182-1]
 gi|300453180|gb|EFK16800.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           116-1]
 gi|300457182|gb|EFK20675.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           21-1]
 gi|300462578|gb|EFK26071.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           187-1]
 gi|300839525|gb|EFK67285.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           124-1]
 gi|300845561|gb|EFK73321.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           78-1]
 gi|301073856|gb|EFK88662.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           146-1]
 gi|308118963|gb|EFO56225.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           145-7]
 gi|309700948|emb|CBJ00245.1| dihydrolipoamide succinyltransferase component (E2) [Escherichia
           coli ETEC H10407]
 gi|312290248|gb|EFR18131.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli 2362-75]
 gi|315135382|dbj|BAJ42541.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase(succinyl-transferring)
           complex [Escherichia coli DH1]
 gi|315257644|gb|EFU37612.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           85-1]
 gi|315614601|gb|EFU95243.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli 3431]
 gi|320179433|gb|EFW54390.1| Dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Shigella boydii
           ATCC 9905]
 gi|320193121|gb|EFW67761.1| Dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Escherichia coli
           O157:H7 str. EC1212]
 gi|320637974|gb|EFX07743.1| dihydrolipoamide succinyltransferase [Escherichia coli O157:H7 str.
           G5101]
 gi|320643369|gb|EFX12549.1| dihydrolipoamide succinyltransferase [Escherichia coli O157:H- str.
           493-89]
 gi|320648718|gb|EFX17351.1| dihydrolipoamide succinyltransferase [Escherichia coli O157:H- str.
           H 2687]
 gi|320654302|gb|EFX22355.1| dihydrolipoamide succinyltransferase [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320659935|gb|EFX27477.1| dihydrolipoamide succinyltransferase [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320664759|gb|EFX31897.1| dihydrolipoamide succinyltransferase [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323153760|gb|EFZ40007.1| dihydrolipoyllysine-residue succinyltransferase [Escherichia coli
           EPECa14]
 gi|323163885|gb|EFZ49695.1| dihydrolipoyllysine-residue succinyltransferase [Shigella sonnei
           53G]
 gi|323170846|gb|EFZ56496.1| dihydrolipoyllysine-residue succinyltransferase [Escherichia coli
           LT-68]
 gi|323180035|gb|EFZ65591.1| dihydrolipoyllysine-residue succinyltransferase [Escherichia coli
           1180]
 gi|323191071|gb|EFZ76336.1| dihydrolipoyllysine-residue succinyltransferase [Escherichia coli
           RN587/1]
 gi|323942948|gb|EGB39112.1| 2-oxoacid dehydrogenase acyltransferase [Escherichia coli E482]
 gi|323963107|gb|EGB58677.1| 2-oxoacid dehydrogenase acyltransferase [Escherichia coli H489]
 gi|323972011|gb|EGB67231.1| 2-oxoacid dehydrogenase acyltransferase [Escherichia coli TA007]
 gi|324009580|gb|EGB78799.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           57-2]
 gi|324020367|gb|EGB89586.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           117-3]
 gi|326341535|gb|EGD65325.1| Dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Escherichia coli
           O157:H7 str. 1044]
 gi|326345753|gb|EGD69492.1| Dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Escherichia coli
           O157:H7 str. 1125]
 gi|330910475|gb|EGH38985.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Escherichia coli
           AA86]
 gi|331038025|gb|EGI10245.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli H736]
 gi|331044627|gb|EGI16754.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli M605]
 gi|331060501|gb|EGI32465.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli TA143]
 gi|331070436|gb|EGI41800.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli TA280]
 gi|331080581|gb|EGI51757.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli H299]
 gi|332096517|gb|EGJ01513.1| dihydrolipoyllysine-residue succinyltransferase [Shigella
           dysenteriae 155-74]
 gi|332342062|gb|AEE55396.1| oxoglutarate dehydrogenase, E2 component SucB [Escherichia coli
           UMNK88]
          Length = 405

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 101/423 (23%), Positives = 186/423 (43%), Gaps = 20/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S              
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A    I       +     I  + +   ++ +   K  +   +      + 
Sbjct: 107 ---EEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAA 163

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                   A  S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 164 APAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEA 223

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 224 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 280

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 281 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 340

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 341 PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 400

Query: 421 MLM 423
           +L+
Sbjct: 401 LLL 403


>gi|218549709|ref|YP_002383500.1| dihydrolipoamide succinyltransferase [Escherichia fergusonii ATCC
           35469]
 gi|218357250|emb|CAQ89885.1| dihydrolipoyltranssuccinase [Escherichia fergusonii ATCC 35469]
 gi|323967433|gb|EGB62853.1| 2-oxoacid dehydrogenase acyltransferase [Escherichia coli M863]
 gi|327254405|gb|EGE66027.1| dihydrolipoyllysine-residue succinyltransferase [Escherichia coli
           STEC_7v]
          Length = 405

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 101/423 (23%), Positives = 186/423 (43%), Gaps = 20/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S              
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A    I       +     I  + +   ++ +   K  +   +      + 
Sbjct: 107 ---EEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAA 163

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                   A  S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 164 TTAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEA 223

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 224 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 280

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 281 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 340

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 341 PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 400

Query: 421 MLM 423
           +L+
Sbjct: 401 LLL 403


>gi|218694150|ref|YP_002401817.1| dihydrolipoamide succinyltransferase [Escherichia coli 55989]
 gi|256021200|ref|ZP_05435065.1| dihydrolipoamide succinyltransferase [Shigella sp. D9]
 gi|300816374|ref|ZP_07096596.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           107-1]
 gi|300822986|ref|ZP_07103121.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           119-7]
 gi|307314809|ref|ZP_07594403.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Escherichia coli W]
 gi|331667092|ref|ZP_08367957.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli TA271]
 gi|331676408|ref|ZP_08377105.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli H591]
 gi|332282426|ref|ZP_08394839.1| dihydrolipoamide acetyltransferase [Shigella sp. D9]
 gi|218350882|emb|CAU96580.1| dihydrolipoyltranssuccinase [Escherichia coli 55989]
 gi|300524527|gb|EFK45596.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           119-7]
 gi|300531064|gb|EFK52126.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase complex [Escherichia coli MS
           107-1]
 gi|306905707|gb|EFN36235.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Escherichia coli W]
 gi|315059969|gb|ADT74296.1| dihydrolipoyltranssuccinase [Escherichia coli W]
 gi|320198155|gb|EFW72759.1| Dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Escherichia coli
           EC4100B]
 gi|323185115|gb|EFZ70481.1| dihydrolipoyllysine-residue succinyltransferase [Escherichia coli
           1357]
 gi|323379471|gb|ADX51739.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Escherichia coli KO11]
 gi|323947009|gb|EGB43023.1| 2-oxoacid dehydrogenase acyltransferase [Escherichia coli H120]
 gi|324116267|gb|EGC10188.1| 2-oxoacid dehydrogenase acyltransferase [Escherichia coli E1167]
 gi|331065448|gb|EGI37341.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli TA271]
 gi|331075901|gb|EGI47198.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli H591]
 gi|332104778|gb|EGJ08124.1| dihydrolipoamide acetyltransferase [Shigella sp. D9]
          Length = 405

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 102/423 (24%), Positives = 187/423 (44%), Gaps = 20/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S              
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A    I       +     I  + +   ++ +   K  +   +      + 
Sbjct: 107 ---EEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAA 163

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
           D       A  S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 164 DPAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEA 223

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 224 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 280

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 281 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 340

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 341 PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 400

Query: 421 MLM 423
           +L+
Sbjct: 401 LLL 403


>gi|322514061|ref|ZP_08067132.1| dihydrolipoyllysine-residue succinyltransferase [Actinobacillus
           ureae ATCC 25976]
 gi|322120078|gb|EFX92049.1| dihydrolipoyllysine-residue succinyltransferase [Actinobacillus
           ureae ATCC 25976]
          Length = 409

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 103/422 (24%), Positives = 188/422 (44%), Gaps = 15/422 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I  P L  ++ +  +A W K  GD I   +++ EIETDK ++E  +  +GI+ EI 
Sbjct: 1   MTIEILTPDLPESVADATVATWHKNVGDAIKRDEVIVEIETDKVVLEVPAPHDGILAEIS 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   I+    +  I            +   +  +   + ++ +    R+  +     
Sbjct: 61  QVQGATVISK-QLLGKIST----------VQAGDFTQETIKPTNEATPADRKSAAIEHDH 109

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           +   ++  A    +   ++      G  V   I          +  +         E   
Sbjct: 110 SDADSQGPAIRRLLAEHNIEAHLIKGTGVGGRITREDIEHHLAQRQTQASKQATATEQST 169

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            + ++     S + +P   +RK IA RL ++K T        + ++  +++LR+      
Sbjct: 170 VSTVSYS-ARSEKRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMTLRKTYGEKF 228

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 229 EKQ---HGVRLGFMSFYIKAVVEALKRYPEINASIDGDDVVYHNYFDISIAVSTPRGLVT 285

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR  D+ S+ DI   +K+LA++ +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 286 PVIRNCDKLSMADIEKTIKELAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPP 345

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A + + V  N ++ +  +M   LS DHR +DG  +   L   K+ +E+P  +
Sbjct: 346 QSAILGMHAIKDRPVAVNCQVVIRPMMYLALSYDHRLIDGRESVGFLVAVKDLLEDPTRL 405

Query: 422 LM 423
           L+
Sbjct: 406 LL 407


>gi|320182931|gb|EFW57800.1| Dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Shigella flexneri
           CDC 796-83]
          Length = 405

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 101/423 (23%), Positives = 186/423 (43%), Gaps = 20/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S              
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A    I       +     I  + +   ++ +   K  +   +      + 
Sbjct: 107 ---EEQNNDALSPAIRRLLAVHNLDASAIKGTGVGGRLTREDVEKHLAKSPAKESAPAAA 163

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                   A  S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 164 APAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEA 223

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 224 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 280

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 281 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 340

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 341 PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 400

Query: 421 MLM 423
           +L+
Sbjct: 401 LLL 403


>gi|254796906|ref|YP_003081743.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Neorickettsia risticii str. Illinois]
 gi|254590142|gb|ACT69504.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Neorickettsia risticii str. Illinois]
          Length = 427

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 103/429 (24%), Positives = 185/429 (43%), Gaps = 12/429 (2%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  + +P +  ++ E  + K  K  GD +   ++L E+ETDKA +E  +   G++ +I V
Sbjct: 1   MKEVLVPRMGESIAEASVVKITKNIGDSVREDELLFELETDKAAVEVSAPVSGVLSKINV 60

Query: 63  PAGTENIAVNSPILNILM------DSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHS 116
             G + + V+  +  I          + I P           V      +  V   +  S
Sbjct: 61  EVG-QAVKVDDVLGLIDENVVASDGGSPISPGVDGGNIVPPSVAIAGGTALGVSTGKDVS 119

Query: 117 KNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLV 176
             +      A++ A    I L   S S         D         +   Y         
Sbjct: 120 SLQSSELVYAKQDAPSARILLEEKSLSPRDIVGTGKDNRIRKVDVLSRLFYGDPAQKQDS 179

Query: 177 DESIDANILN--LFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLR 234
           +    A   +  L  K    ++P   +R+ IA RL++S+ T        + +++N++ +R
Sbjct: 180 ESEQRAVAGSGSLAPKFPERLVPLSKLRQRIASRLKESQNTAAILTTFNEVDMENVIQIR 239

Query: 235 EQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVS 294
           ++   + +        K+      ++A    +   PE N       ++   + +I VAV 
Sbjct: 240 KRYKDSFEK---VHGLKLGFMSFFVQAVICGLEAFPEINAEIRGKDIVYKDYYNIGVAVG 296

Query: 295 IPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSF 354
              G+V P+I+ A   S  +I  ++ +  ++A+  K++P++ QGGT +ISN G+ G    
Sbjct: 297 TKNGLVVPVIKNAQNLSFAEIERQILEYGKKARDGKIEPDDMQGGTFTISNGGIYGSLMS 356

Query: 355 CAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEY 414
             +INPPQS IL + A +++ V  +  I V  +M   LS DHR VDG  A   L + KE 
Sbjct: 357 TPIINPPQSGILGMHAIKERPVVIDGAIVVRPMMYLALSYDHRIVDGREAVSFLVRVKEC 416

Query: 415 IENPVWMLM 423
           +ENP  +L+
Sbjct: 417 LENPERLLL 425


>gi|302383096|ref|YP_003818919.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302193724|gb|ADL01296.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 440

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 181/443 (40%), Positives = 267/443 (60%), Gaps = 27/443 (6%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I MP+LSPTM EG LAKW  + GD +  GD++ EIETDKA ME E+VDEG I +ILV
Sbjct: 1   MTDILMPALSPTMEEGVLAKWHVKVGDTVKAGDVIAEIETDKATMEVEAVDEGTITDILV 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKN---- 118
             G+E + VN+PI  +  +     P+P  ++    E  +     +     +  +      
Sbjct: 61  AEGSEGVKVNTPIARLAEEGGSAAPAPKAAEPAKAEAPKAAPAPAGHESGDAVATPDGIK 120

Query: 119 ------------------RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST 160
                             R  +SPLARRLA + G+DLS+L G+GPHGRIVK+D+E     
Sbjct: 121 SAEAVLPKTSGTAASTGARVFSSPLARRLAKDAGLDLSTLKGTGPHGRIVKADVEAAAKG 180

Query: 161 KTNVKDYSTIQSFGLVDESIDANILNL-FAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
                      +   ++     ++ ++     SY++IP D +RK IA R+  S Q +PHF
Sbjct: 181 GARPAAAPATTAASGIEARKVQSLADMGIPDGSYDLIPLDGMRKAIARRMVGSIQNVPHF 240

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN 279
            + ID  ID LL+ R ++N  L+        K+SVND ++KA A+A+  VPEAN S++  
Sbjct: 241 PLFIDVEIDALLAARAKVNAMLEKS----GVKVSVNDFVIKAAAMALKLVPEANASYSPE 296

Query: 280 AMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
            +  H + D+++AV+I GG++TPII +A+ KS+  I++E K LA+RA+ +KLKPEE+QGG
Sbjct: 297 GIAMHHNADVAMAVAIDGGLITPIIFKAETKSLSQIAVESKDLAKRARDKKLKPEEFQGG 356

Query: 340 TTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSV 399
           T S+SN+GM GI +F ++IN PQ  I+++GAGE++ V +N ++ VAT+M  TL+ DHR V
Sbjct: 357 TFSVSNLGMFGIKAFSSIINEPQGAIMSVGAGEQRPVVKNGQLAVATVMTVTLTCDHRVV 416

Query: 400 DGAIASKLLAKFKEYIENPVWML 422
           DGA  ++ L  FK  IE+PV ML
Sbjct: 417 DGATGARFLQAFKPLIEDPVTML 439


>gi|295096567|emb|CBK85657.1| 2-oxoglutarate dehydrogenase E2 component [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 408

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 98/423 (23%), Positives = 180/423 (42%), Gaps = 17/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD ++  ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVTRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    S   S+E      +    S      +  S    
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKESSAKSEEKASTPAQRQQASLSDQTNDALSPAIR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                                              T      ++    +         + 
Sbjct: 120 RLLAEH-------------SLDPAAIKGTGVGGRLTREDIDKHLAKAPSEAKAEAKAPAA 166

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                      S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 167 APAAQPALGARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDA 226

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 227 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 283

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 284 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 343

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 344 PQSAILGMHAIKDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTR 403

Query: 421 MLM 423
           +L+
Sbjct: 404 LLL 406


>gi|107022582|ref|YP_620909.1| dihydrolipoamide succinyltransferase [Burkholderia cenocepacia AU
           1054]
 gi|116689531|ref|YP_835154.1| dihydrolipoamide acetyltransferase [Burkholderia cenocepacia
           HI2424]
 gi|170732835|ref|YP_001764782.1| dihydrolipoamide succinyltransferase [Burkholderia cenocepacia
           MC0-3]
 gi|105892771|gb|ABF75936.1| 2-oxoglutarate dehydrogenase E2 component [Burkholderia cenocepacia
           AU 1054]
 gi|116647620|gb|ABK08261.1| 2-oxoglutarate dehydrogenase E2 component [Burkholderia cenocepacia
           HI2424]
 gi|169816077|gb|ACA90660.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Burkholderia cenocepacia MC0-3]
          Length = 426

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 106/428 (24%), Positives = 186/428 (43%), Gaps = 9/428 (2%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS +++E  + +W K+ G+ ++  +IL E+ETDK ++E  +   G++ ++
Sbjct: 1   MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G + +  +  I  I  ++             +       + ++P       + +  
Sbjct: 61  LQNDG-DTVVADQIIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAAAPAAQPAAATASSS 119

Query: 121 IASPLARRLAGEHG-----IDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGL 175
            A+  A                 S            +      +        +      L
Sbjct: 120 AAASPAAAKLLAEKGLSTGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKTAAAKPAL 179

Query: 176 VDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLRE 235
            +  + A+          + +P   +R  IA RL +S+QT        + N+  ++ LR 
Sbjct: 180 PEVKVPASAATWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRN 239

Query: 236 QMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSI 295
           +     +        K+      +KA   A+ + P  N S   N ++ H + DI +AV  
Sbjct: 240 KYKDKFEKE---HGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGS 296

Query: 296 PGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFC 355
           P G+V PI+R ADQ S+ +I  ++ +  Q+AK  KL  EE  GGT SISN G+ G     
Sbjct: 297 PRGLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLST 356

Query: 356 AVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYI 415
            +INPPQS IL + A +++ V +N +I +  I    LS DHR +DG  A   L   K+ +
Sbjct: 357 PIINPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDAL 416

Query: 416 ENPVWMLM 423
           E+P  +L+
Sbjct: 417 EDPARLLL 424


>gi|113461101|ref|YP_719169.1| 2-oxoglutarate dehydrogenase E2 component [Haemophilus somnus
           129PT]
 gi|112823144|gb|ABI25233.1| 2-oxoglutarate dehydrogenase E2 component [Haemophilus somnus
           129PT]
          Length = 407

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 106/423 (25%), Positives = 192/423 (45%), Gaps = 18/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I  P L  ++ +  +  W K  GD +   ++L EIETDK ++E  ++ +G+++ I
Sbjct: 1   MSNFDIITPDLPESVADATVVTWHKNVGDAVKCDEVLVEIETDKIVLEIPALSDGVLETI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L P G+  ++    +L  +  S  I      + +N+ +   +   ++          +  
Sbjct: 61  LQPEGSTVVS--KQLLGKVSASAGIGEVTKSTVQNVEKTPADRHSANLNTDASSDVLSPA 118

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           +   LA        I  + + G      I     +    T+T     S      +     
Sbjct: 119 VRRLLAEHELNADEIKGTGVGGRITREDIALVVKQKAQQTETAQASQSIATGLKIDH--- 175

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                      + + +P   +RK IA RL ++K T        + ++  +++LR++    
Sbjct: 176 ----------RNEKRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMNLRKRYAEK 225

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+V
Sbjct: 226 FEKQ---HGARLGFMSFYIKAVVEALKRYPEINASIDGDDIVYHNYFDISIAVSTPRGLV 282

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D+ S+ DI  E+K LA++ +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 283 TPVVRNCDKLSMADIEKEIKLLAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 342

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + V  N E+ +  +M   LS DHR +DG  +   L   K+ +E+P  
Sbjct: 343 PQSAILGMHAIKDRPVAVNGEVVIRPMMYLALSYDHRLIDGRESVGFLVTVKDLLEDPTR 402

Query: 421 MLM 423
           +L+
Sbjct: 403 LLL 405


>gi|82775995|ref|YP_402342.1| dihydrolipoamide succinyltransferase [Shigella dysenteriae Sd197]
 gi|309786390|ref|ZP_07681016.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Shigella dysenteriae 1617]
 gi|81240143|gb|ABB60853.1| 2-oxoglutarate dehydrogenase, dihydrolipoyltranssuccinase E2
           component [Shigella dysenteriae Sd197]
 gi|308925784|gb|EFP71265.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Shigella dysenteriae 1617]
          Length = 405

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 101/423 (23%), Positives = 187/423 (44%), Gaps = 20/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S              
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A    I       +     I  + +   ++ +   K  +   +      + 
Sbjct: 107 ---EEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESALAAA 163

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
            +      A  S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 164 ASAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEA 223

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 224 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 280

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 281 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 340

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 341 PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 400

Query: 421 MLM 423
           +L+
Sbjct: 401 LLL 403


>gi|332975526|gb|EGK12416.1| 2-oxoglutarate dehydrogenase E2, dihydrolipoamide acetyltransferase
           [Desmospora sp. 8437]
          Length = 419

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 98/422 (23%), Positives = 179/422 (42%), Gaps = 6/422 (1%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +H + +P L+ ++TEG ++ W+  EGD+++ GD+L E+ETDK  +E  +   G +  I  
Sbjct: 1   MHEVKVPELAESITEGTISDWLVSEGDQVNEGDVLLELETDKVNVEIHAEHSGTLQNIRK 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
            AG + + V   I  I  +     P+ P +     E +E           E   +     
Sbjct: 61  KAG-DTVEVGEVIAQIG-EGAATAPAAPQAPAPQPEQKEAAPVKEEAPAAESVEEAADGD 118

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
             +    A         +             +          +  +          +   
Sbjct: 119 GDITASPAARKLAREKGIDLRRVRPSDPMGRVTVDDVKAHTEQPPAKPAPAEKKQAAAPT 178

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
             +        E +P    R+TIA RL +++QT        + ++  ++ +R++     +
Sbjct: 179 PAVETDPAKPVERVPMTRRRQTIAKRLVEAQQTAAMLTTFNEVDMSAVMEIRKRRK---E 235

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
             +E+    +       KA   A+   P  N       ++  K  DI +AV+   G+V P
Sbjct: 236 AFKEQHDVSLGFMSFFTKAVVGALKAYPALNAEIDGTDVLYKKFYDIGIAVATDNGLVVP 295

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R AD++S  DI  E+  LA++A+  KL   + QGGT +I+N G+ G      ++N PQ
Sbjct: 296 VVRDADRRSFADIEREIANLAKKARNNKLALSDLQGGTFTITNGGVFGSLLSTPILNAPQ 355

Query: 363 STILAIGAGEKKVV-FQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
             IL +   +K+ V    + ++   +M   LS DHR VDG  A   L   K+ +E+P  +
Sbjct: 356 VGILGMHTIQKRPVTVDGDRLEHRPMMYIALSYDHRLVDGKEAVGFLVTIKKLLEDPELL 415

Query: 422 LM 423
           ++
Sbjct: 416 ML 417


>gi|146277139|ref|YP_001167298.1| branched-chain alpha-keto acid dehydrogenase subunit E2
           [Rhodobacter sphaeroides ATCC 17025]
 gi|145555380|gb|ABP69993.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 438

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 169/441 (38%), Positives = 244/441 (55%), Gaps = 24/441 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+K+EGD++  GDIL EIETDKA MEFE+VDEGI+ +IL
Sbjct: 1   MATEILMPALSPTMEEGTLAKWLKKEGDEVRSGDILAEIETDKATMEFEAVDEGILGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +  GT  + VN+PI  ++ +                E ++E + +         +   P 
Sbjct: 61  IAEGTAGVKVNTPIAVLVEEGESADAVSSGKTPAPEEPKDEAAPAQEAPKASPAASPAPA 120

Query: 122 ASPLARRLAGEHGIDLSSLSG-------------------SGPHGRIVKSDIETLISTKT 162
           A P   R+         +                           +   +      +   
Sbjct: 121 AKPEGDRIFASPLARRIATEKGLDLATVKGSGPRGRIVKADVEGAQKPAAPAAKAEAAAP 180

Query: 163 NVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVS 222
                +   +      +  A++  LFA   +E I  D +RKTIA RL ++KQTIPHFY+ 
Sbjct: 181 QADAPAAAAAPVTSPAASAASVAKLFADREFEEITLDGMRKTIAARLSEAKQTIPHFYLR 240

Query: 223 IDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMI 282
            +  +D L++ R  +N  L+        K+SVND I+KA A+A+ QVP AN  W  + ++
Sbjct: 241 REVALDALMAFRADLNAKLESR----GVKLSVNDFIIKACAVALQQVPNANAVWAGDRIL 296

Query: 283 RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTS 342
           R K  D++VAV+I GG+ TP++R A QKS+  +S E+K LA RA+ +KL P EYQGG+ +
Sbjct: 297 RLKPSDVAVAVAIEGGLFTPVLRDAHQKSLSALSAEMKDLAARARTKKLAPHEYQGGSFA 356

Query: 343 ISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHRSVDG 401
           ISN+GM GI +F AVINPP  +ILA+GAG +K V  ++  I  AT+M+ TLS DHR +DG
Sbjct: 357 ISNLGMFGIENFDAVINPPHGSILAVGAGIRKPVVAKDGAITTATMMSMTLSVDHRVIDG 416

Query: 402 AIASKLLAKFKEYIENPVWML 422
           A+ ++ L    E +ENP+ ML
Sbjct: 417 ALGAEFLKAIVENLENPIAML 437


>gi|49483602|ref|YP_040826.1| dihydrolipoamide succinyltransferase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|257425476|ref|ZP_05601901.1| dihydrolipoamide acetyltransferase [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257428136|ref|ZP_05604534.1| dihydrolipoamide acetyltransferase [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|257433527|ref|ZP_05609885.1| dihydrolipoamide acetyltransferase [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257436368|ref|ZP_05612415.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus subsp. aureus M876]
 gi|282903993|ref|ZP_06311881.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Staphylococcus aureus subsp. aureus C160]
 gi|282905757|ref|ZP_06313612.1| dihydrolipoamide acetyltransferase [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282908728|ref|ZP_06316546.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282914201|ref|ZP_06321988.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Staphylococcus aureus subsp. aureus
           M899]
 gi|282919123|ref|ZP_06326858.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus subsp. aureus C427]
 gi|282924306|ref|ZP_06331980.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus subsp. aureus C101]
 gi|283958175|ref|ZP_06375626.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus A017934/97]
 gi|293501227|ref|ZP_06667078.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus subsp. aureus 58-424]
 gi|293510189|ref|ZP_06668897.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus subsp. aureus M809]
 gi|293526781|ref|ZP_06671466.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Staphylococcus aureus subsp. aureus
           M1015]
 gi|295427925|ref|ZP_06820557.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus EMRSA16]
 gi|297591114|ref|ZP_06949752.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus MN8]
 gi|81651148|sp|Q6GGZ6|ODO2_STAAR RecName: Full=Dihydrolipoyllysine-residue succinyltransferase
           component of 2-oxoglutarate dehydrogenase complex;
           AltName: Full=2-oxoglutarate dehydrogenase complex
           component E2; Short=OGDC-E2; AltName:
           Full=Dihydrolipoamide succinyltransferase component of
           2-oxoglutarate dehydrogenase complex
 gi|49241731|emb|CAG40421.1| dihydrolipoamide succinyltransferase E2 component of 2-oxoglutarate
           dehydrogenase complex [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|257271933|gb|EEV04071.1| dihydrolipoamide acetyltransferase [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257274977|gb|EEV06464.1| dihydrolipoamide acetyltransferase [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|257281620|gb|EEV11757.1| dihydrolipoamide acetyltransferase [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257284650|gb|EEV14770.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus subsp. aureus M876]
 gi|282313693|gb|EFB44086.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus subsp. aureus C101]
 gi|282316933|gb|EFB47307.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus subsp. aureus C427]
 gi|282322269|gb|EFB52593.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Staphylococcus aureus subsp. aureus
           M899]
 gi|282326992|gb|EFB57287.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331049|gb|EFB60563.1| dihydrolipoamide acetyltransferase [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282595611|gb|EFC00575.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Staphylococcus aureus subsp. aureus C160]
 gi|283790324|gb|EFC29141.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus A017934/97]
 gi|290920853|gb|EFD97916.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide
           succinyltransferase [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291096232|gb|EFE26493.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus subsp. aureus 58-424]
 gi|291467133|gb|EFF09651.1| dihydrolipoyllysine-residue succinyltransferase, E2 component
           [Staphylococcus aureus subsp. aureus M809]
 gi|295128283|gb|EFG57917.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus EMRSA16]
 gi|297576000|gb|EFH94716.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus MN8]
 gi|312438188|gb|ADQ77259.1| dihydrolipoyllysine-residue succinyltransferase [Staphylococcus
           aureus subsp. aureus TCH60]
 gi|315195305|gb|EFU25692.1| dihydrolipoamide acetyltransferase [Staphylococcus aureus subsp.
           aureus CGS00]
          Length = 423

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 94/422 (22%), Positives = 173/422 (40%), Gaps = 6/422 (1%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            + +P L+ ++TEG +A+W+K  GD +  G+ + E+ETDK  +E  S + G++ E L   
Sbjct: 3   EVKVPELAESITEGTIAEWLKNLGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLASE 62

Query: 65  GTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASP 124
           G + + V   I  I   S                    ++       +          + 
Sbjct: 63  G-DTVEVGQAIAVIGEGSGNASKENSNDNTPQQNDETTNNKKEETTNKSADKAEVNQTND 121

Query: 125 LARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANI 184
             ++              +G +   V      ++  +   K      S     ++     
Sbjct: 122 DNQQRVNATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQAPAKEE 181

Query: 185 LNLFAKDSYEVI--PHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
                  +  VI       +KT A +L +            + ++ N++ LR++      
Sbjct: 182 KKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFM 241

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
              +    K+       KA   A+ + PE N     + MI  ++ DI VAVS   G++ P
Sbjct: 242 KDHD--GTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVP 299

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
            +R  D+K+  +I  E+  LA +A+++KL  ++   G+ +I+N G+ G      +IN  Q
Sbjct: 300 FVRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQ 359

Query: 363 STILAIGAGEKKVVFQN-EEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           + IL + +   + +  + + I+   +M   LS DHR +DG  A   L   KE IENP  +
Sbjct: 360 AAILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDL 419

Query: 422 LM 423
           L+
Sbjct: 420 LL 421


>gi|294499652|ref|YP_003563352.1| 2-oxoglutarate dehydrogenase, E2 component (dihydrolipoamide
           succinyltransferase) [Bacillus megaterium QM B1551]
 gi|294349589|gb|ADE69918.1| 2-oxoglutarate dehydrogenase, E2 component (dihydrolipoamide
           succinyltransferase) [Bacillus megaterium QM B1551]
          Length = 431

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 119/432 (27%), Positives = 204/432 (47%), Gaps = 18/432 (4%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            I +P L+ +++EG +A+W+KQ GD +  GD + E+ETDK  +E  + D G++ E+L   
Sbjct: 3   EIKVPELAESISEGTVAQWLKQVGDFVEKGDYIVELETDKVNVEITAEDSGVLTELLAGE 62

Query: 65  GTENIAVNSPILNIL------------MDSTEIPPSPPLSKENIVEVREEHSHSSPVVVR 112
           G + + V   I  +              +      +P        +   E    +    +
Sbjct: 63  G-DTVQVGETIARLEAKEGASAPAAPKAEEKPAEEAPKQEAAPAQQKTVEEVAPAAEAPQ 121

Query: 113 EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQS 172
           + + K   IASP AR+ A E GI L  +  + P GR+ K DI++  + + + +     Q+
Sbjct: 122 QGNQKQWLIASPAARKAARERGIKLDQVPTTDPLGRVRKHDIDSY-ADQKSNEQKQQAQA 180

Query: 173 FGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232
                    +   +  +    E       R+TIA RL + +QT        + ++  +++
Sbjct: 181 SKPATPVSPSPAASENSDKPVERERMSRRRQTIAKRLVEVQQTAAMLTTFNEVDMTAVMA 240

Query: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVA 292
           LR++         E+   ++       KA   A+ + P  N     N ++  K  DI +A
Sbjct: 241 LRKRRKDKF---FEQHDVRLGFMSFFTKAVVAALKKYPLLNAEIQGNELLIKKFYDIGIA 297

Query: 293 VSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGIN 352
           VS P G+V P++R AD+K+   I   +  LA++A+  KL  ++ QGGT +I+N G+ G  
Sbjct: 298 VSAPDGLVVPVVRDADRKTFAGIEGSIVDLAKKARDNKLSLKDLQGGTFTITNGGVFGSL 357

Query: 353 SFCAVINPPQSTILAIGAGEKKVVFQNEE-IKVATIMNATLSADHRSVDGAIASKLLAKF 411
               ++N PQ  IL +   + + V  +EE I+   +M   LS DHR VDG  A   LA  
Sbjct: 358 MSTPILNGPQVGILGMHKVQLRPVAIDEERIENRPMMYIALSYDHRIVDGKEAVSFLATV 417

Query: 412 KEYIENPVWMLM 423
           KE +E+P  +L+
Sbjct: 418 KELLEDPESLLL 429


>gi|259418599|ref|ZP_05742516.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Silicibacter sp. TrichCH4B]
 gi|259344821|gb|EEW56675.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Silicibacter sp. TrichCH4B]
          Length = 441

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 162/444 (36%), Positives = 242/444 (54%), Gaps = 27/444 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +S GD++ EIETDKA MEFE+VDEG++ +IL
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWLVKEGDTVSSGDLIAEIETDKATMEFEAVDEGVVGKIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           +  G+E + VN+PI  +L D          +         + +  +        +     
Sbjct: 61  IAEGSEGVKVNTPIAVLLEDGESADDIDTSAATPEAAPAADAAQEAASEGGSDAAAAPAA 120

Query: 122 ASPLARRLAGEHGIDLSSLS----------------------GSGPHGRIVKSDIETLIS 159
           AS      A          +                        G   ++   +      
Sbjct: 121 ASATPAPAAPAAADGSRIFASPLARRIAADKGLDLSAIKGSGPRGRIIKVDVENATAAPK 180

Query: 160 TKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHF 219
            +T     +   +           +  ++    YE +  D +RKTIA RL ++KQTIPHF
Sbjct: 181 AETKAAPAAAPAAAVAPAGPSADAVAKMYEGRDYEEVKLDGMRKTIAARLTEAKQTIPHF 240

Query: 220 YVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN 279
           Y+  D  +D LL  R Q+N+ L+        K+SVND I+KA ALA+  VP+AN  W  +
Sbjct: 241 YLRRDIQLDALLKFRSQLNKQLEPR----GVKLSVNDFIIKAVALALQSVPDANAVWAGD 296

Query: 280 AMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGG 339
            +++ K  D++VAV+I GG+ TP+++ +D KS+  +S E+K LA RA+ RKL P EYQGG
Sbjct: 297 RVLKMKASDVAVAVAIEGGLFTPVLQDSDMKSLSALSAEMKDLASRARDRKLAPHEYQGG 356

Query: 340 TTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHRS 398
           + +ISN+GM GI++F A++NPP + ILA+G+G KK V   + E+ VAT+M+ T+S DHR 
Sbjct: 357 SFAISNLGMFGIDNFDAIVNPPHAGILAVGSGVKKPVVGADGELTVATVMSVTMSVDHRV 416

Query: 399 VDGAIASKLLAKFKEYIENPVWML 422
           +DGA+ + LL    + +ENP+ ML
Sbjct: 417 IDGALGADLLKAIVDNLENPMVML 440


>gi|51473379|ref|YP_067136.1| dihydrolipoamide acetyltransferase [Rickettsia typhi str.
           Wilmington]
 gi|81692316|sp|Q68XI8|ODO2_RICTY RecName: Full=Dihydrolipoyllysine-residue succinyltransferase
           component of 2-oxoglutarate dehydrogenase complex;
           AltName: Full=2-oxoglutarate dehydrogenase complex
           component E2; Short=OGDC-E2; AltName:
           Full=Dihydrolipoamide succinyltransferase component of
           2-oxoglutarate dehydrogenase complex
 gi|51459691|gb|AAU03654.1| dihydrolipoamide S-succinyltransferase [Rickettsia typhi str.
           Wilmington]
          Length = 398

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 122/422 (28%), Positives = 200/422 (47%), Gaps = 26/422 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +PSL  ++TE  +AKW K+ GD +   ++L EIETDK  +E  +   G I +I 
Sbjct: 1   MSIKIIIPSLGESVTEATIAKWYKKLGDAVKTDELLLEIETDKVTLEVNAPCNGTIGKIS 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G  N+ V   +  I                 I   ++E S  +   + +K +    I
Sbjct: 61  KTDGA-NVTVGEEVGEINE-------IADTDTAWINNKKQEVSQHTSEQLVDKPAMASNI 112

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            +P  ++L  E+ +D +++ G+G  GRI K D+   I+T                  +I+
Sbjct: 113 LAPSVQKLVTENKLDPNNIKGTGRGGRITKYDVLETINTTPI---------------TIE 157

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
            + +N   ++  + +    +RKTIA RL+ S+ T        + ++  +++LR Q     
Sbjct: 158 THAINKTNEERTQRVRMSRLRKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEF 217

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+      +KA   A+  +P  N     + ++   + DI VAV    G+V 
Sbjct: 218 EKKHT---VKLGFMSFFVKATIEALKLIPSINAEIDGDDLLYKNYYDIGVAVGTEQGLVV 274

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+IR AD+ S  DI   +  LA++A++ KL   +  GGT SISN G+ G      +INPP
Sbjct: 275 PVIRDADKMSFADIEQAIGNLAKKAREGKLSISDLSGGTFSISNGGVYGSLLSTPIINPP 334

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   E++ V  + +I++  +M   LS DHR +DG      L K K  IENP  +
Sbjct: 335 QSGILGLHKTEERAVVIDGKIEIRPMMYIALSYDHRIIDGKEGVSFLVKIKNLIENPEKL 394

Query: 422 LM 423
           L+
Sbjct: 395 LL 396


>gi|332093787|gb|EGI98841.1| dihydrolipoyllysine-residue succinyltransferase [Shigella boydii
           5216-82]
          Length = 405

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 101/423 (23%), Positives = 186/423 (43%), Gaps = 20/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S              
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A    I       +     I  + +   ++ +   K  +   +      + 
Sbjct: 107 ---EEQNNDALSPVIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAA 163

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                   A  S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 164 APAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEA 223

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 224 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 280

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 281 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 340

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 341 PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 400

Query: 421 MLM 423
           +L+
Sbjct: 401 LLL 403


>gi|4322028|gb|AAD15925.1| dihydrolipoamide succinyltransferase [Coxiella burnetii]
          Length = 405

 Score =  290 bits (741), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 110/422 (26%), Positives = 200/422 (47%), Gaps = 19/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P+L  ++++  +AKW K+EGD IS  + L ++ETDK ++E  +  +G++++I+
Sbjct: 1   MAIEIKVPTLPESVSDATVAKWYKKEGDSISRDENLVDLETDKVMLEVPAPKDGVVEKIV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G E +  +  +  +    +         ++   + +E+         +EK  +    
Sbjct: 61  AKEG-EVVKADQILALLKEGGSVAKEKAKKDEKETKKEKEKKEEKKDKEKKEKTEEKESD 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            SP  RR+  E  +D+  + GSG  GRI K D+E  +  +                E   
Sbjct: 120 LSPAVRRMVSEKDVDVEEIEGSGKGGRITKKDVEDYLEKQK---------------EKPS 164

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                   + + + +P   IR+ +A RL Q +Q         + N+  ++ LR++     
Sbjct: 165 EGKEGPADERTEKRVPLSRIRQRVAERLVQVQQEAALLTTFNEINMQLVMELRKKYREEF 224

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +   +    ++       KA   A+ + P  N S   + +I H + DI +A+    G++ 
Sbjct: 225 EKKFK---VRLGFMSFFTKAVVEALKRFPMVNASIDGSDIIYHNYYDIGIAIGTERGLIV 281

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI+R A++ ++ DI  ++++ A RA++ +L  EE  GGT +I+N G  G      +INPP
Sbjct: 282 PILRNAEKMNMADIEKQIREYASRAQEGRLNIEELTGGTFTITNGGTYGTLLSTPIINPP 341

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +     +   +N E+ V  IM   LS DHR +DG  A   L   KE +E+P  M
Sbjct: 342 QTAILGMHKIMDRPTVENGEVVVRPIMQVALSYDHRVIDGREAVLFLVTIKELLEDPARM 401

Query: 422 LM 423
           ++
Sbjct: 402 IL 403


>gi|294787744|ref|ZP_06752988.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Simonsiella muelleri ATCC 29453]
 gi|294484037|gb|EFG31720.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Simonsiella muelleri ATCC 29453]
          Length = 397

 Score =  290 bits (741), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 107/422 (25%), Positives = 180/422 (42%), Gaps = 31/422 (7%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           MI  + +P  + ++TEG L  W K+ GD ++  ++L +IETDK ++E  +   G++ EI+
Sbjct: 5   MIVEVNVPVFAESITEGTLLSWHKKVGDSVARDEVLVDIETDKVVLEVPAPQAGVLVEII 64

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  G E +     +  I   +T    +P    +      +  + ++  +           
Sbjct: 65  VKDG-EVVTTQQLLAKIDTAATASAAAPQAVAQAAATQPQSTASNNVAMPAAAKLAAEKG 123

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                 + +G  G  L     +       +S          N                  
Sbjct: 124 VDLNNVQGSGRDGRVLKEDVQAASVAAPTQSAPTVAKIATGN------------------ 165

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                       E +P   +R  +A RL  S+Q         + N+  ++ LR +     
Sbjct: 166 ---------RVEERVPMSRLRARVAERLLASQQENAILTTFNELNMKPIMDLRAKYKEKF 216

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+      +KA   A+ + P  N S   N ++ H + DI +A+  P G+V 
Sbjct: 217 EKE---HGIKLGFMSFFVKAAVAALKKFPVVNASVDGNDIVYHGYFDIGIAIGSPRGLVV 273

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PI+R ADQ S+ DI   +   A++AK  K+  E+  GGT SI+N G  G      +INPP
Sbjct: 274 PILRDADQMSLADIEKAIADYAKKAKDGKIAIEDLTGGTFSITNGGTFGSMMSTPIINPP 333

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL + A +++ V +N EI +  +M   LS DHR +DG  A   L   K+ +E+P  +
Sbjct: 334 QSAILGMHATKERAVVENGEIVIRPMMYLALSYDHRIIDGREAVLTLVTIKDLLEDPARL 393

Query: 422 LM 423
           L+
Sbjct: 394 LL 395


>gi|329903481|ref|ZP_08273500.1| Dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327548356|gb|EGF33041.1| Dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 431

 Score =  290 bits (741), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 117/433 (27%), Positives = 197/433 (45%), Gaps = 14/433 (3%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS ++ E  L +W K+ G+ +S  + + +IETDK ++E  +  +GII ++
Sbjct: 1   MAILEVKVPQLSESVAEATLLQWHKKVGEPVSRDENMIDIETDKVVLELPAPADGIITQL 60

Query: 61  LVPAGTENIAVNSPILNILMDSTE--------IPPSPPLSKENIVEVREEHSHSSPVVVR 112
           + P G   +     I  I  D +           P P    +++          +  +  
Sbjct: 61  MQPDGA-TVVAGQVIALIDTDGSAKVSPLEISALPVPQPHPDSVAAASTTSDPVAAAINT 119

Query: 113 EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQS 172
                   +A P A ++  E+ +  S + G+G  GR+ K D+   +  K       +  +
Sbjct: 120 LGSKAAANVAMPAAAKMLAENSMTASQVDGTGKDGRVTKGDVINQLEKKPAPVVAPSAPA 179

Query: 173 FGLVD--ESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNL 230
                  + + A       +   + +P   +R  IA RL QS+QT        + N+  +
Sbjct: 180 VAAKPALQQVAAGPGPNLGERPEQRVPMSRLRARIAERLVQSQQTNAILTTFNEVNMAPV 239

Query: 231 LSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDIS 290
           + LR +     +        K+      +KA   A+ + P  N S   N ++ H + DI 
Sbjct: 240 MELRNKYKDKFEKE---HGVKLGFMSFFVKAAVAALKKYPVINGSVDGNDIVYHGYFDIG 296

Query: 291 VAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLG 350
           +AV  P G+V P++R ADQ SI DI  ++ +   +AK  KL  ++  GGT SISN G  G
Sbjct: 297 IAVGSPRGLVVPVLRNADQMSIADIEKKIGEFGAKAKDGKLTMDDLTGGTFSISNGGTFG 356

Query: 351 INSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAK 410
                 +INPPQS IL + A + + V +N +I +  +    LS DHR +DG  A   L  
Sbjct: 357 SMLSTPIINPPQSAILGVHATKDRAVVENGQIVIRPMNYLALSYDHRIIDGREAVLGLVA 416

Query: 411 FKEYIENPVWMLM 423
            KE +E+P  +L+
Sbjct: 417 MKEALEDPARLLL 429


>gi|157828104|ref|YP_001494346.1| dihydrolipoamide succinyltransferase [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165932806|ref|YP_001649595.1| dihydrolipoamide succinyltransferase [Rickettsia rickettsii str.
           Iowa]
 gi|157800585|gb|ABV75838.1| dihydrolipoamide acetyltransferase [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165907893|gb|ABY72189.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Rickettsia
           rickettsii str. Iowa]
          Length = 395

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 107/422 (25%), Positives = 178/422 (42%), Gaps = 29/422 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +PSL  ++TE  +AKW K+EGD +   ++L EIET+K  +E  +   G I +I 
Sbjct: 1   MRVNIIVPSLGESITEATIAKWYKKEGDSVKTDELLLEIETEKVTLEVHAPCNGTIGKIS 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G  N+AV   I  I   ++               V +  S    V            
Sbjct: 61  KTDGA-NVAVGEEIGEINEGASVNTAGTNNESAKAQPVTQPTSEKPAVANNTL------- 112

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                                        K D   +  T  + +         +   +  
Sbjct: 113 ------------------APSVQKLVTENKLDPNNIKGTGRDGRITKGDVLATINTTTTS 154

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A  ++   ++  + +    +RKTIA RL+ S+ T        + ++  +++LR Q     
Sbjct: 155 APAISKSNEERVQRVRMSRLRKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEF 214

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+      +KA   A+  +P  N     + ++   + DI VAV    G+V 
Sbjct: 215 EKKHT---VKLGFMSFFVKATIEALKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVV 271

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD+    ++   +  LA++A++ KL   +  GGT SISN G+ G      +INPP
Sbjct: 272 PVVRDADKMGFAEVEKTIGILAKQAREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPP 331

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   E++ V  + +I++  +M   LS DHR +DG      L K K+ IENP  +
Sbjct: 332 QSGILGLHKTEERAVVIDGKIEIRPMMYIALSYDHRIIDGKEGVSFLVKIKQLIENPEKL 391

Query: 422 LM 423
           L+
Sbjct: 392 LL 393


>gi|296135820|ref|YP_003643062.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Thiomonas intermedia K12]
 gi|295795942|gb|ADG30732.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Thiomonas intermedia K12]
          Length = 432

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 105/434 (24%), Positives = 176/434 (40%), Gaps = 15/434 (3%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M +  I +P LS ++ E  L  W K+ G+ ++  +IL EIETDK ++E  + + G++ +I
Sbjct: 1   MALIDIKVPQLSESVAEATLLTWKKKPGEPVAQDEILIEIETDKVVLEVPAPEAGVMAQI 60

Query: 61  LVPAGTENIAVNSPILNILMDST-----------EIPPSPPLSKENIVEVREEHSHSSPV 109
           L   G E++  +  I  I  ++            +       +   +         +  +
Sbjct: 61  LKNDG-ESVTSDEVIAKIDTEAKPQTSPLPVAPVKAAEPTASAPAAVATAAPSAGAAVAM 119

Query: 110 VVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYST 169
               K    + +             I       +    +       T             
Sbjct: 120 PAAAKIMAEQGVNPSDVAGTGRGGRITKGDALQAAAAPKPPTVPAPTPAPKPATAAAAMP 179

Query: 170 IQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
             +   +        L  +     + +P   +R  IA RL QS+ T        + N+  
Sbjct: 180 SLTIPALQPVEADLDLAAYTDRPEQRVPMSRLRARIAERLLQSQATNAILTTFNEVNMKP 239

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDI 289
           ++ +R       +        K+      ++A   A+ + P  N S   N ++ H + DI
Sbjct: 240 VIDMRNLYKDKFEKQ---HGVKLGFMSFFVRAAVHALRKFPLLNASIDGNDIVYHGYFDI 296

Query: 290 SVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGML 349
            +AV  P G+V PI+R ADQ S  DI   +     +A+  KL  EE  GGT SISN G+ 
Sbjct: 297 GIAVGSPRGLVVPILRNADQMSFADIEKAIADFGAKARDGKLTIEELTGGTFSISNGGVF 356

Query: 350 GINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLA 409
           G      +INPPQS IL I A + + V ++ +I +  +    LS DHR +DG  A   L 
Sbjct: 357 GSMLSTPIINPPQSAILGIHATKDRPVVEDGQIVIRPMNYLALSYDHRLIDGREAVLSLV 416

Query: 410 KFKEYIENPVWMLM 423
             KE +E+P  +L+
Sbjct: 417 AMKEALEDPARLLL 430


>gi|157160206|ref|YP_001457524.1| dihydrolipoamide succinyltransferase [Escherichia coli HS]
 gi|157065886|gb|ABV05141.1| dihydrolipoyllysine-residue succinyltransferase, E2 component of
           oxoglutarate dehydrogenase (succinyl-transferring)
           complex [Escherichia coli HS]
          Length = 405

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 101/423 (23%), Positives = 186/423 (43%), Gaps = 20/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   S+E      +    S              
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSTGKETSAKSEEKASTPAQRQQASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A    I       +     I  + +   ++ +   K  +   +      + 
Sbjct: 107 ---EEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAA 163

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                   A  S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 164 APAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEA 223

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 224 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 280

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 281 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 340

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 341 PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 400

Query: 421 MLM 423
           +L+
Sbjct: 401 LLL 403


>gi|170717678|ref|YP_001784753.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Haemophilus somnus 2336]
 gi|168825807|gb|ACA31178.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Haemophilus somnus 2336]
          Length = 407

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 106/423 (25%), Positives = 193/423 (45%), Gaps = 18/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I  P L  ++ +  +  W K  GD +   ++L EIETDK ++E  ++ +G+++ I
Sbjct: 1   MSNFDIITPDLPESVADATVVTWHKNVGDAVKCDEVLVEIETDKIVLEIPALSDGVLETI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L P G+  ++    +L  +  S  I      + +N+ +   +   ++          +  
Sbjct: 61  LQPEGSTVVS--KQLLGKVSASAGIGEVTKSTVQNVEKTPADRHSANLNTDASSDVLSPA 118

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           +   LA        I  + + G      I     +    T+T     S +    +     
Sbjct: 119 VRRLLAEHELNADEIKGTGVGGRITREDIALVVKQKAQQTETAQASQSIVTGLKIDH--- 175

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                      + + +P   +RK IA RL ++K T        + ++  +++LR++    
Sbjct: 176 ----------RNEKRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMNLRKRYAEK 225

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+V
Sbjct: 226 FEKQ---HGARLGFMSFYIKAVVEALKRYPEINASIDGDDIVYHNYFDISIAVSTPRGLV 282

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D+ S+ DI  E+K LA++ +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 283 TPVVRNCDKLSMADIEKEIKLLAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 342

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + V  N E+ +  +M   LS DHR +DG  +   L   K+ +E+P  
Sbjct: 343 PQSAILGMHAIKDRPVAVNGEVVIRPMMYLALSYDHRLIDGRESVGFLVTVKDLLEDPTR 402

Query: 421 MLM 423
           +L+
Sbjct: 403 LLL 405


>gi|295705041|ref|YP_003598116.1| 2-oxoglutarate dehydrogenase E2 component [Bacillus megaterium DSM
           319]
 gi|294802700|gb|ADF39766.1| 2-oxoglutarate dehydrogenase, E2 component (dihydrolipoamide
           succinyltransferase) [Bacillus megaterium DSM 319]
          Length = 431

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 119/432 (27%), Positives = 206/432 (47%), Gaps = 18/432 (4%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            I +P L+ +++EG +A+W+KQ GD +  GD + E+ETDK  +E  + D G++ E+L   
Sbjct: 3   EIKVPELAESISEGTVAQWLKQVGDFVEKGDYIVELETDKVNVEITAEDSGVLTELLAGE 62

Query: 65  GTENIAVNSPILNIL------------MDSTEIPPSPPLSKENIVEVREEHSHSSPVVVR 112
           G + + V   I  +              +  +   +P        +   E    +    +
Sbjct: 63  G-DTVQVGETIARLEAKEGASAPAAPKAEEKQAEEAPKQEAAPAQQKTVEEVAPAAEAPQ 121

Query: 113 EKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQS 172
           + + K   IASP AR+ A E GI L  +  + P GR+ K DI++  + + + +     Q+
Sbjct: 122 QGNQKQWLIASPAARKAARERGIKLDQVPTTDPLGRVRKHDIDSY-ADQKSNEQKQQAQA 180

Query: 173 FGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232
               +    +   +  +    E       R+TIA RL + +QT        + ++  +++
Sbjct: 181 SKPANPVSPSPAASENSDKPVERERMSRRRQTIAKRLVEVQQTAAMLTTFNEVDMTAVMA 240

Query: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVA 292
           LR++         E+   ++       KA   A+ + P  N     N ++  K  DI +A
Sbjct: 241 LRKRRKDKF---FEQHDVRLGFMSFFTKAVVAALKKYPLLNAEIQGNELLIKKFYDIGIA 297

Query: 293 VSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGIN 352
           VS P G+V P++R AD+K+   I   +  LA++A+  KL  ++ QGGT +I+N G+ G  
Sbjct: 298 VSAPDGLVVPVVRDADRKTFAGIEGSIVDLAKKARDNKLALKDLQGGTFTITNGGVFGSL 357

Query: 353 SFCAVINPPQSTILAIGAGEKKVVFQNEE-IKVATIMNATLSADHRSVDGAIASKLLAKF 411
               ++N PQ  IL +   + + V  +EE I+   +M   LS DHR VDG  A   LA  
Sbjct: 358 MSTPILNGPQVGILGMHKVQLRPVAIDEERIENRPMMYIALSYDHRIVDGKEAVSFLATV 417

Query: 412 KEYIENPVWMLM 423
           KE +E+P  +L+
Sbjct: 418 KELLEDPESLLL 429


>gi|157825365|ref|YP_001493085.1| dihydrolipoamide succinyltransferase [Rickettsia akari str.
           Hartford]
 gi|157799323|gb|ABV74577.1| dihydrolipoamide acetyltransferase [Rickettsia akari str. Hartford]
          Length = 400

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 109/422 (25%), Positives = 180/422 (42%), Gaps = 24/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++TE  +AKW K+EGD +   ++L EIET+K  +E  +   G I +I 
Sbjct: 1   MSVKIIVPLLGESVTEATIAKWYKKEGDSVKTDELLLEIETEKVTLEVNAPCNGTIGKIS 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G  N+AV   I +I   +               EV +  S          ++   P 
Sbjct: 61  KTDGA-NVAVGEEIGDINEGAAVNTAGTHTESAKAQEVTQPTSEKPVDRPAMVNNILAPS 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
              L      +      +   +      V   I T                      +  
Sbjct: 120 VQKLVTENKLDPNNIKGTGKDARITKSDVLETINT--------------------KSAAT 159

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           +  +N   ++  + +    +RKTIA RL+ S+ T        + ++  +++LR Q     
Sbjct: 160 STTVNKTNEERVQRVRMSRLRKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEF 219

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        K+      +KA   A+  +P  N     + ++   + DI VAV    G+V 
Sbjct: 220 EKK---HDVKLGFMSFFVKATIEALKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVV 276

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R ADQ    ++   +  LA++A++ KL   +  GGT SISN G+ G      +INPP
Sbjct: 277 PVVRDADQMGFAEVEKAIGTLAKKAREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPP 336

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   E++ V  + +I++  +M   LS DHR +DG      L K K+ IENP  +
Sbjct: 337 QSGILGLHKTEERAVVIDGKIEIHPMMYIALSYDHRIIDGKEGVSFLVKIKQLIENPEKL 396

Query: 422 LM 423
           L+
Sbjct: 397 LL 398


>gi|290474110|ref|YP_003466987.1| dihydrolipoyltranssuccinate transferase, component of the
           2-oxoglutarate dehydrogenase complex [Xenorhabdus
           bovienii SS-2004]
 gi|289173420|emb|CBJ80197.1| dihydrolipoyltranssuccinate transferase, component of the
           2-oxoglutarate dehydrogenase complex [Xenorhabdus
           bovienii SS-2004]
          Length = 404

 Score =  289 bits (740), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 102/423 (24%), Positives = 178/423 (42%), Gaps = 21/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   D+L EIETDK ++E  + + G+++ I
Sbjct: 1   MSSVEILVPDLPESVADATVATWHKKAGDTVQRDDVLVEIETDKVVLEVPASEAGVLEAI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G   +     +  I +  +   P+    K      + + +              R 
Sbjct: 61  LEEEGA-TVLSKQLLGRIRLSDSTGIPAEVKEKTESTPAQRQTASLEEESNDVLSPAVRR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
           + +      A   G  +          +                   +  +         
Sbjct: 120 LIAEHDLDPAAIKGSGVGGRIVREDVEK-----------------YIAAHKKESGKVAEA 162

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                +     S + +P   +RK +A RL ++K          + N+  +  LR+Q    
Sbjct: 163 APAQASQLPHRSEKRVPMTRLRKRVAERLLEAKNNTAMLTTFNEVNMKPIQELRKQYGDA 222

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S     ++ H + DIS+AVS P G+V
Sbjct: 223 FEKR---HGMRLGFMSFYVKAVVEALKRYPEVNASIDGTDVVYHNYFDISIAVSTPRGLV 279

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R AD   + DI   +K+LA + +  KL  EE  GG  +I+N G+ G      +INP
Sbjct: 280 TPVLRDADALGMADIEKSIKELAIKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINP 339

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR VDG  +   L   KE +E+P  
Sbjct: 340 PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLVDGRESVGFLVTIKEMLEDPTR 399

Query: 421 MLM 423
           +L+
Sbjct: 400 LLL 402


>gi|15614768|ref|NP_243071.1| dihydrolipoamide succinyltransferase [Bacillus halodurans C-125]
 gi|10174824|dbj|BAB05924.1| dihydrolipoamide succinyltransferase [Bacillus halodurans C-125]
          Length = 411

 Score =  289 bits (740), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 115/422 (27%), Positives = 195/422 (46%), Gaps = 14/422 (3%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I +P L+ ++TEG +A+W+K+ GD +S G+ + E+ETDK  +E  +   G+I E+  
Sbjct: 1   MIEIKVPELAESITEGTIAQWLKKVGDHVSQGEYIAELETDKVNVEITAEHSGVIQELKR 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G + + V   I  +    +    +         +     +             NRP+A
Sbjct: 61  EEG-DTVEVGEVIAVLAEGDSPTASTEQAEAPKEEKKVSTVASEEAAPAP----GNRPVA 115

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
           SP AR+LA E GIDL ++  + P GR+ K D+ +              +       +   
Sbjct: 116 SPAARKLAREKGIDLEAVPTADPLGRLRKQDVASYEEKPAASAPAKAPEKKAAPAAANVE 175

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
           +          E I     R+TIA RL +++QT        + ++  ++ LR++      
Sbjct: 176 SPGKPV-----ERIKMSRRRQTIAKRLVEAQQTAAMLTTFNEVDMSAVMELRKRRKDQF- 229

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
              E+   K+       KA   A+ + P  N     + ++  K+ DI +AVS   G+V P
Sbjct: 230 --FEKHDVKLGFMSFFTKAVIGALKEFPLLNAEIQGDEILLKKYYDIGIAVSTDEGLVVP 287

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R AD+     I  E+  L ++A++ KL   E QGGT +I+N G+ G      ++N PQ
Sbjct: 288 VVRDADRLGFAGIEREIMHLGKKARENKLSLSELQGGTFTITNGGVFGSLWSTPILNAPQ 347

Query: 363 STILAIGAGEKKVVFQNEE-IKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
             IL +   + + V  +EE  +   +M   LS DHR VDG  A   L + KE +E+P  +
Sbjct: 348 VGILGMHKIQWRPVAIDEENFENRPMMYIALSYDHRIVDGKEAVSFLVRVKEMLEDPESL 407

Query: 422 LM 423
           L+
Sbjct: 408 LL 409


>gi|261252265|ref|ZP_05944838.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio orientalis
           CIP 102891]
 gi|260935656|gb|EEX91645.1| dihydrolipoamide succinyltransferase component (E2) of
           2-oxoglutarate dehydrogenase complex [Vibrio orientalis
           CIP 102891]
          Length = 401

 Score =  289 bits (740), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 94/422 (22%), Positives = 180/422 (42%), Gaps = 23/422 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W KQ GD +   ++L +IETDK ++E  + + G+++ I+
Sbjct: 1   MTIEILVPDLPESVADATVATWHKQPGDVVERDEVLVDIETDKVVLEVPAPEAGVLEAII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              GT  +     I  +   +    P+   ++       + H  +      +        
Sbjct: 61  EAEGT-TVLSKQLIAKLKPGAVAGEPTTDTTESTEASPDKRHKAALTEESNDA------- 112

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                                +       +     +    T     + + +     ++  
Sbjct: 113 ------------LSPAVRRLLAEHGLEPSQVKGTGVGGRITREDVDAHLANAKAAPKADA 160

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                  A  S + +P   +RKT+A RL ++K          + N+  ++ LR+Q     
Sbjct: 161 PVAEAPAAARSQKRVPMTRLRKTVANRLLEAKNNTAMLTTFNEVNMKPIMDLRKQYKDQF 220

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S     ++ H + DIS+AVS P G+VT
Sbjct: 221 EER---HGIRLGFMSFYVKAVTEALKRYPEVNASIDGEDIVYHNYFDISMAVSTPRGLVT 277

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D     D+   +K+LA + +  KL  +E  GG  +I+N G+ G      +INPP
Sbjct: 278 PVLKDCDTLGFADVEKGIKELAIKGRDGKLTVDELMGGNFTITNGGVFGSLMSTPIINPP 337

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   +++ +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 338 QSAILGMHKIQERPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARL 397

Query: 422 LM 423
           L+
Sbjct: 398 LL 399


>gi|238650463|ref|YP_002916315.1| dihydrolipoamide acetyltransferase [Rickettsia peacockii str.
           Rustic]
 gi|238624561|gb|ACR47267.1| dihydrolipoamide acetyltransferase [Rickettsia peacockii str.
           Rustic]
          Length = 395

 Score =  289 bits (740), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 108/422 (25%), Positives = 179/422 (42%), Gaps = 29/422 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +PSL  ++TE  +AKW K+EGD +   ++L EIET+K  +E  +   G I +I 
Sbjct: 1   MRVKIIVPSLGESITEATIAKWYKKEGDSVKTDELLLEIETEKVTLEVNAPCNGTIGKIS 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G  NIAV   I  I   ++               V +  S    V            
Sbjct: 61  KTDGA-NIAVGEEIGEINEGASVNTAGTNNESARAQAVTQPTSEKPAVANNTL------- 112

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
                                        K D   +  T  + +         +   +  
Sbjct: 113 ------------------APSVQKLVTENKLDPNNIKGTGRDGRITKGDVLATINTTTTS 154

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A  ++   ++  + +    +RKTIA RL+ S+ T        + ++  +++LR Q     
Sbjct: 155 APAISKSNEERVQRVRMSRLRKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEF 214

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +      + K+      +KA   A+  +P  N     + ++   + DI VAV    G+V 
Sbjct: 215 EKK---HAVKLGFMSFFVKATIEALKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVV 271

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P++R AD+    ++   +  LA++A++ KL   +  GGT SISN G+ G      +INPP
Sbjct: 272 PVVRDADKMGFAEVEKTIGILAKQAREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPP 331

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +   E++ V  + +I++  +M   LS DHR +DG      L K K+ IENP  +
Sbjct: 332 QSGILGLHKTEERAVVIDGKIEIHPMMYIALSYDHRIIDGKEGVSFLVKIKQLIENPEKL 391

Query: 422 LM 423
           L+
Sbjct: 392 LL 393


>gi|323976303|gb|EGB71393.1| 2-oxoacid dehydrogenase acyltransferase [Escherichia coli TW10509]
          Length = 405

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 100/423 (23%), Positives = 186/423 (43%), Gaps = 20/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +   ++    +   ++E      +    S              
Sbjct: 61  LEDEGT-TVTSRQILGRLREGNSAGKETSAKAEEKASTPAQRQQASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A    I       +     I  + +   ++ +   K  +   +      + 
Sbjct: 107 ---EEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAA 163

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                   A  S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 164 ATAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEA 223

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 224 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 280

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 281 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 340

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 341 PQSAILGMHAIKDRPMAVNGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTR 400

Query: 421 MLM 423
           +L+
Sbjct: 401 LLL 403


>gi|300771340|ref|ZP_07081216.1| dihydrolipoyllysine-residue succinyltransferase [Sphingobacterium
           spiritivorum ATCC 33861]
 gi|300762010|gb|EFK58830.1| dihydrolipoyllysine-residue succinyltransferase [Sphingobacterium
           spiritivorum ATCC 33861]
          Length = 416

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 102/422 (24%), Positives = 182/422 (43%), Gaps = 8/422 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P++  ++TE  LA+W+KQ+GD +   + + E+E+DKA  E  +   GI+ +I+
Sbjct: 1   MSLEIKVPAVGESITEVTLAQWLKQDGDYVEMDENIAELESDKATFELPAEKAGIL-KII 59

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G + + + + +  I   S           E      +  + +S     +   +N   
Sbjct: 60  AQEG-DTLEIGAVVCTIEEGSAPAGGDAAPKAEETKAAAQPAASTSAPAASDDEDQNSYA 118

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           A   +   A          +     G+  +   E     +   K  +   +      +  
Sbjct: 119 AGTASPAAAKILREKGIDPAAVKGTGKDGRITKEDAEKAQAGAKPAAAQSTTSAPAATPA 178

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
             +     +         ++RKTIA RL   K          + N+  ++ LR +   T 
Sbjct: 179 PAVAGARNER---REKMTSLRKTIAKRLVAVKNETAMLTTFNEVNMQPIMDLRAKYKDTF 235

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +         +       KA   A+ + P  N     N ++     DIS+AVS P G+V 
Sbjct: 236 KEK---HGVGLGFMSFFTKAVTTALKEWPAVNARIEENELVYSDFADISIAVSAPKGLVV 292

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           PIIR A+  S+ +I  ++ +LA +A+  KL  EE  GGT +I+N G+ G      +IN P
Sbjct: 293 PIIRNAESLSLHEIEKKIGELAGKARDNKLTIEEMTGGTFTITNGGVFGSMMSTPIINAP 352

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           QS IL +    ++ V +N ++ +  +M   LS DHR +DG  +   L + K+ +E+P  +
Sbjct: 353 QSAILGMHNIIQRPVAENGQVVIRPMMYIALSYDHRIIDGRESVSFLVRVKQLLEDPARL 412

Query: 422 LM 423
           L+
Sbjct: 413 LL 414


>gi|205373224|ref|ZP_03226028.1| dihydrolipoamide acetyltransferase [Bacillus coahuilensis m4-4]
          Length = 411

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 119/422 (28%), Positives = 196/422 (46%), Gaps = 14/422 (3%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           +  I +P L+ ++TEG +A W+K+ GD +  G+ + E+ETDK  +E  S + G + E+  
Sbjct: 1   MVEIKVPELAESITEGTIASWLKKPGDHVEKGEYILELETDKVNVEVISEESGTLKELKA 60

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIA 122
             G + + V   I  +   +     S P S E     + +               NRPIA
Sbjct: 61  EEG-DTVEVGQVIAIVEAGNPSTSQSTPSSNETTEAQQVKEEVKEVQNEVPSSKLNRPIA 119

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
           SP AR+LA E G+DLS +  + P GR+ K D+E       +    S           +  
Sbjct: 120 SPAARKLAREKGLDLSMVPTTDPLGRVRKQDVEHFNEAPKSQAAPS---------APVQQ 170

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
             L++      E       R+TIA RL + +Q         + ++  +++LR++      
Sbjct: 171 KALSVEDAKPVERQKMSRRRQTIAKRLVEVQQNAAMLTTFNEIDMTAVMALRKRKKDKF- 229

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTP 302
              E    ++       KA   A+ + P  N     + +I  K  DI VAVS   G+V P
Sbjct: 230 --FESHDVRLGFMSFFTKAVVAALKKYPSVNGEIDGDEVILKKFYDIGVAVSTEEGLVVP 287

Query: 303 IIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQ 362
           ++R  D+K+  +I   + +LA++A+  KL   + QGGT +I+N G+ G      ++N  Q
Sbjct: 288 VVRDCDRKNFAEIEGNILELAKKARDNKLSLSDLQGGTFTITNGGVFGSLLSTPILNGNQ 347

Query: 363 STILAIGAGEKKVVFQNEE-IKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
             IL +   + + V  + E ++   +M   LS DHR +DG  A   L K KE +ENP  +
Sbjct: 348 VGILGMHTIQTRPVAIDAERMENRPMMYVALSYDHRIIDGKEAVGFLVKVKELLENPEDL 407

Query: 422 LM 423
           L+
Sbjct: 408 LL 409


>gi|333010157|gb|EGK29592.1| dihydrolipoyllysine-residue succinyltransferase [Shigella flexneri
           K-272]
 gi|333021112|gb|EGK40369.1| dihydrolipoyllysine-residue succinyltransferase [Shigella flexneri
           K-227]
          Length = 405

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 102/423 (24%), Positives = 186/423 (43%), Gaps = 20/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   GT  +     +  +  D++    +   S+E      +    S              
Sbjct: 61  LEDEGT-TVTSRQILGRLREDNSAGKETSAKSEEKASTPAQRQQASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A    I       +     I  + +   ++ +   K  +   +      + 
Sbjct: 107 ---EEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAA 163

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                   A  S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 164 APAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEA 223

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S   + ++ H + D+S+AVS P G+V
Sbjct: 224 FEKR---HGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLV 280

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI  ++K+LA + +  KL  E+  GG  +I+N G+ G      +INP
Sbjct: 281 TPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP 340

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++++  +M   LS DHR +DG  +   L   KE +E P  
Sbjct: 341 PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEEPTR 400

Query: 421 MLM 423
           +L+
Sbjct: 401 LLL 403


>gi|312171762|emb|CBX80020.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate
           dehydrogenase complex [Erwinia amylovora ATCC BAA-2158]
          Length = 406

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 98/423 (23%), Positives = 184/423 (43%), Gaps = 19/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +G+++ I
Sbjct: 1   MSSVDIVVPDLPESVADATVATWHKKPGDSVKRDEVLVEIETDKVVLEVPASADGVLEAI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G   +     +  +   ++    +   ++ N     +  + S              
Sbjct: 61  LEEEGA-TVISRQALGRLKEGNSGGKETSAKAEANESTPAQRQTASL------------- 106

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                +          L +     P           +              +     E+ 
Sbjct: 107 --EEESNDALSPAIRRLIAEHSLDPAAIKGSGVGGRITREDVEKHLAQAAPATKAAPEAA 164

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
           +A +    A  S + +P   +RK +A RL ++K +        + N+  +++LR+Q    
Sbjct: 165 EAAVPADLANRSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMQPIMALRKQYGEA 224

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S     ++ H + D+S+AVS P G+V
Sbjct: 225 FEKR---HGVRLGFMSFYIKAVVEALKRYPEVNASIDGTDVVYHNYFDVSIAVSTPRGLV 281

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP+++  D  S+ DI  ++K+LA + +  KL  +E  GG  +I+N G+ G      +INP
Sbjct: 282 TPVLKDVDALSMADIEKKIKELAVKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINP 341

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++ +  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 342 PQSAILGMHAIKDRPMAVNGQVVILPMMYLALSYDHRLIDGRESVGYLVAIKELLEDPAR 401

Query: 421 MLM 423
           +L+
Sbjct: 402 LLL 404


>gi|59711431|ref|YP_204207.1| dihydrolipoamide acetyltransferase [Vibrio fischeri ES114]
 gi|59479532|gb|AAW85319.1| dihydrolipoyltranssuccinase [Vibrio fischeri ES114]
          Length = 403

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 98/422 (23%), Positives = 184/422 (43%), Gaps = 21/422 (4%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +P L  ++ +  +A W KQ GD +   +IL +IETDK ++E  + + G+++ IL
Sbjct: 1   MTIEILVPDLPESVADATVATWHKQPGDAVERDEILVDIETDKVVLEVPAPEAGVLETIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   +     +  I   +                V  E +            K    
Sbjct: 61  EDEGA-TVLSKQLLARIKPGA----------------VVGEPTTDVTTATESSPDKRHTA 103

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
           +       A    +             +  + +   I+ +      + +++    +++ D
Sbjct: 104 SLSEESNDALSPAVRRLLGEHDIAPSDVKGTGVGGRITREDVDAHIAALKAAPKAEKAAD 163

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
                L    S + +P   +RKT+A RL ++K +        + N+  ++ LR+Q     
Sbjct: 164 KPAEALAH-RSEKRVPMTRLRKTVANRLLEAKNSTAMLTTFNEVNMKPIMDLRKQYKDQF 222

Query: 242 QFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVT 301
           +        ++      +KA   A+ + PE N S   + ++ H + DIS+AVS P G+VT
Sbjct: 223 EER---HGTRLGFMSFYVKAVTEALKRYPEVNASIDGDDIVYHNYFDISMAVSTPRGLVT 279

Query: 302 PIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPP 361
           P+++  D     DI   +K+LA + +  KL  E+  GG  +I+N G+ G      +INPP
Sbjct: 280 PVLKDCDTLGFADIEKGIKELAIKGRDGKLAVEDLMGGNFTITNGGVFGSLMSTPIINPP 339

Query: 362 QSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWM 421
           Q+ IL +   + + +  + ++++  +M   LS DHR +DG  +   L   KE +E+P  +
Sbjct: 340 QAAILGMHKIQDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARL 399

Query: 422 LM 423
           L+
Sbjct: 400 LL 401


>gi|149926158|ref|ZP_01914420.1| dihydrolipoamide acetyltransferase [Limnobacter sp. MED105]
 gi|149824976|gb|EDM84188.1| dihydrolipoamide acetyltransferase [Limnobacter sp. MED105]
          Length = 428

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 112/430 (26%), Positives = 181/430 (42%), Gaps = 11/430 (2%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M I  + +P LS ++ E  L  W K+ GD +   + L ++ETDK ++E  +   G+I EI
Sbjct: 1   MAIVEVVVPQLSESVAEATLLNWYKKPGDAVKRDENLIDVETDKVVLEVPAPSAGVIVEI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREK------ 114
           L   G   +     +  I  +++    +P                +S             
Sbjct: 61  LCEDGA-TVVAGQVLAKIDTEASASASAPAAPSAPAASAPTPAPAASASTPSASVDGSVA 119

Query: 115 HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFG 174
                 + +      A   G         G     + +               +  +   
Sbjct: 120 MPAAAKMMAENNLSPAQVAGSGKDGRITKGDVIGTLSAPAAAPAPAAKPAAAPAAAKPVS 179

Query: 175 LVDESIDANILNLFAKDSYE-VIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSL 233
           L+ E       +   +   E  +P   +R  +A RL QS+QT        + N+  ++ L
Sbjct: 180 LLPEVKAPLDPSTLIEGRPEQRVPMSRLRARVAERLVQSQQTNAILTTFNEVNMKPVMDL 239

Query: 234 REQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAV 293
           R +     +        K+      +KA   A+ + P  N S   N ++ H + DI +AV
Sbjct: 240 RNKYKDKFEKE---HGAKLGFMGFFVKAAVAALKKYPVLNASVDGNDIVYHGYFDIGIAV 296

Query: 294 SIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINS 353
             P G+V PIIR ADQ SI DI +++ +  Q+AK  KL  ++  GGT SISN G+ G   
Sbjct: 297 GSPRGLVVPIIRNADQMSIADIEMKIAEFGQKAKDGKLSLDDLTGGTFSISNGGVFGSML 356

Query: 354 FCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKE 413
              +INPPQS IL I A +++ V +N EI +  +    +S DHR +DG  A   L   KE
Sbjct: 357 STPIINPPQSAILGIHATKERAVVENGEIVIRPMNYLAMSYDHRIIDGREAVLGLVAMKE 416

Query: 414 YIENPVWMLM 423
            +E+P  +L+
Sbjct: 417 ALEDPARLLL 426


>gi|126725379|ref|ZP_01741221.1| branched-chain alpha-keto acid dehydrogenase E2 subunit
           [Rhodobacterales bacterium HTCC2150]
 gi|126704583|gb|EBA03674.1| branched-chain alpha-keto acid dehydrogenase E2 subunit
           [Rhodobacterales bacterium HTCC2150]
          Length = 425

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 161/428 (37%), Positives = 241/428 (56%), Gaps = 11/428 (2%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ + GD ++ GD++ EIETDKA MEFE+VDEG+I E+L
Sbjct: 1   MPTEILMPALSPTMEEGTLAKWLVKAGDTVNSGDLIAEIETDKATMEFEAVDEGVISELL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           V  G+E +AVN+ I  +L+D  E    P    +         +  S VV           
Sbjct: 61  VAEGSEGVAVNTAIAILLVDGEEAGTKPTAKPKETAAAPAPAASVSAVVSSVSPQPLAEK 120

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST------KTNVKDYSTIQSFGL 175
              +            + +      G      I                   +      +
Sbjct: 121 GDRVFATPLARRIAKQNGVDLGAVSGSGPHGRIIKADVEGLSATAAPVATSTAPAAKQEI 180

Query: 176 VDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLRE 235
              +   ++  ++A   Y+ IP + +RK IA RL ++KQTIPHFY+  D  +D LL+ R 
Sbjct: 181 ASSATSDSVKAMYADREYKEIPLNGMRKIIAGRLTEAKQTIPHFYLRRDILLDELLAFRS 240

Query: 236 QMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSI 295
            +N+ L         K+SVND I+KA ALA+  VP AN  W  + +++    D++VAV+I
Sbjct: 241 TLNKKLAARE----IKLSVNDFIIKACALALQDVPAANAVWAEDRVLQMVKSDVAVAVAI 296

Query: 296 PGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFC 355
            GG+ TP+++ +D K++  +S E+K LA RA+ +KL P EYQGG+ +ISN+GM+G+++F 
Sbjct: 297 DGGLFTPVLQDSDTKTLSTLSTEMKDLAARARDKKLAPHEYQGGSFAISNLGMMGVDNFD 356

Query: 356 AVINPPQSTILAIGAGEKKVVF-QNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEY 414
           AVINPP   ILA+GAG++K V   N ++  AT+M+ TLS DHR +DGA+ ++LL    +Y
Sbjct: 357 AVINPPHGAILAVGAGKRKPVVGPNGDLTSATVMSVTLSVDHRVIDGALGAELLQSIVDY 416

Query: 415 IENPVWML 422
           +E+P+ ML
Sbjct: 417 LESPIAML 424


>gi|310767023|gb|ADP11973.1| dihydrolipoamide succinyltransferase [Erwinia sp. Ejp617]
          Length = 405

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 101/423 (23%), Positives = 190/423 (44%), Gaps = 20/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  +  +G+++ I
Sbjct: 1   MSSVEIVVPDLPESVADATVATWHKKPGDSVKRDEVLVEIETDKVVLEVPASADGVLEAI 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G   +     +  +   ++    +   ++                V     ++ + 
Sbjct: 61  LEDEGA-TVISRQALGRLKEGNSGGKETSAKAE----------------VNESTPAQRQT 103

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
            +       A    I       S     I  S +   I+ +   K  +   +     ++ 
Sbjct: 104 ASLEEESNDALSPAIRRLIAEHSLDPAAIKGSGVGGRITREDVEKHLAQAPAEKAEPKAA 163

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
           +A      A  S + +P   +RK +A RL ++K +        + N+  +++LR+Q    
Sbjct: 164 EAAAPVGLANRSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMQPIMALRKQYGEA 223

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S     ++ H + D+S+AVS P G+V
Sbjct: 224 FEKR---HGVRLGFMSFYIKAVVEALKRYPEVNASIDGTDVVYHNYFDVSIAVSTPRGLV 280

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP+++  D  S+ DI  ++K+LA + +  KL  +E  GG  +I+N G+ G      +INP
Sbjct: 281 TPVLKDVDALSMADIEKKIKELAVKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINP 340

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++ +  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 341 PQSAILGMHAIKDRPMAVNGQVVIQPMMYLALSYDHRLIDGRESVGYLVAIKELLEDPAR 400

Query: 421 MLM 423
           +L+
Sbjct: 401 LLL 403


>gi|291616729|ref|YP_003519471.1| SucB [Pantoea ananatis LMG 20103]
 gi|291151759|gb|ADD76343.1| SucB [Pantoea ananatis LMG 20103]
 gi|327393155|dbj|BAK10577.1| dihydrolipoyllysine-residue succinyltransferase component of 2-
           oxoglutarate dehydrogenase complex SucB [Pantoea
           ananatis AJ13355]
          Length = 407

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 97/423 (22%), Positives = 179/423 (42%), Gaps = 18/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +S  +++ EIETDK ++E  +  +G+++ +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDAVSRDEVIVEIETDKVVLEVPASADGVLEAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G   +     +  +   ++    S   ++ N     +  + S      +  S    
Sbjct: 61  LEDEGA-TVTSRQILGRLKEGNSAGKESSAKAESNDTTPAQRQTASLEEESSDALSPAIR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A                 +                              + 
Sbjct: 120 RLIAEHNLDA--------------AQIKGTGVGGRLTREDVEKHLANKPQAEKAAAPAAG 165

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
            A      A  S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 166 AATAQQPVANRSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEINMKPIMDLRKQYGDA 225

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S     ++ H + D+S+AVS P G+V
Sbjct: 226 FEKR---HGVRLGFMSFYIKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLV 282

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D  S+ DI  ++K+LA + +  KL  ++  GG  +I+N G+ G      +INP
Sbjct: 283 TPVLRDVDALSMADIEKKIKELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINP 342

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  N ++ +  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 343 PQSAILGMHAIKDRPMAVNGQVVILPMMYLALSYDHRLIDGRESVGYLVAVKEMLEDPAR 402

Query: 421 MLM 423
           +L+
Sbjct: 403 LLL 405


>gi|253687631|ref|YP_003016821.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251754209|gb|ACT12285.1| 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
           succinyltransferase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 407

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 100/423 (23%), Positives = 174/423 (41%), Gaps = 18/423 (4%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           M    I +P L  ++ +  +A W K+ GD +   ++L EIETDK ++E  + + GI+D +
Sbjct: 1   MSSVDILVPDLPESVADATVATWHKKPGDSVQRDEVLVEIETDKVVLEVPASEAGILDAV 60

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G   +     +  I    +    +   S+       + H+        +  S    
Sbjct: 61  LEEEGA-TVTSRQLLGRIRRGDSSGKETSEKSQSKESTPAQRHTAGLEEENSDALSPAIR 119

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                    A                 +                      +S   V    
Sbjct: 120 RLIAEHDLDASAI--------------KGSGVGGRITREDVDKYLAAQKKESGKAVKSEA 165

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
            A         S + +P   +RK +A RL ++K +        + N+  ++ LR+Q    
Sbjct: 166 PAAPAPALGARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEINMQPIMDLRKQYGEA 225

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            +        ++      +KA   A+ + PE N S     ++ H + D+S+AVS P G+V
Sbjct: 226 FEKR---HGVRLGFMSFYIKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLV 282

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++R  D   + DI   +K LA + +  KL  EE  GG  +I+N G+ G      +INP
Sbjct: 283 TPVLRDVDALGMADIEKRIKDLAVKGRDGKLTVEELLGGNFTITNGGVFGSLMSTPIINP 342

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A + + +  + ++ +  +M   LS DHR +DG  +   L   KE +E+P  
Sbjct: 343 PQSAILGMHAIKDRPMAVDGQVVILPMMYLALSYDHRLIDGRESVGFLVTVKEMLEDPAR 402

Query: 421 MLM 423
           +L+
Sbjct: 403 LLL 405


>gi|150011003|gb|ABR57158.1| 2-oxoglutarate dehydrogenase complex dihydrolipoamide
           succinyltransferase E2 component [Staphylococcus
           xylosus]
          Length = 420

 Score =  289 bits (739), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 98/420 (23%), Positives = 176/420 (41%), Gaps = 5/420 (1%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            + +P L+ ++TEG +A+W+KQ GD +  G+ + E+ETDK  +E  S + G++ E+L   
Sbjct: 3   EVKVPELAESITEGTIAEWLKQVGDSVDKGEAIVELETDKVNVEVVSEEAGVLQELLADE 62

Query: 65  GTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASP 124
           G + + V   I  +   S       P  +E+       ++        E   +     + 
Sbjct: 63  G-DTVEVGQAIAVVGEGSGNNTSESPAKQEDTKATDNSNNEQQSSESTESKPEASSQDNG 121

Query: 125 LARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANI 184
                                      +D+        + K  +T QS     E      
Sbjct: 122 QRVNATPSARKYAREKGIDLSEVSPSSNDVVRKSHVDQSQKQSNTQQSQPAAKEETKKPA 181

Query: 185 LNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFH 244
               +K           +KT A +L +            + ++ N++ LR++        
Sbjct: 182 QQNPSKPVI-REKMSRRKKTAAKKLLEVSNNTAMLTTFNEIDMTNVMDLRKRKKEQFIKD 240

Query: 245 REEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPII 304
            +    K+       KA   A+ + PE N     + MI  ++ DI VAVS   G++ P +
Sbjct: 241 HD--GTKLGFMSFFTKAAVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTEDGLLVPFV 298

Query: 305 RQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQST 364
           R  D+K+  +I  E+  LA++A+ +KL  ++   G+ +I+N G+ G      +IN  Q+ 
Sbjct: 299 RDCDKKNFAEIEDEIGNLAKKARDKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGSQAA 358

Query: 365 ILAIGAGEKKVVFQN-EEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           IL + +   + +  + + I+   +M   LS DHR +DG  A   L   KE IENP  +L+
Sbjct: 359 ILGMHSIITRPIAIDADTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL 418


>gi|114768962|ref|ZP_01446588.1| Dihydrolipoamide acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [alpha proteobacterium HTCC2255]
 gi|114549879|gb|EAU52760.1| Dihydrolipoamide acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [alpha proteobacterium HTCC2255]
          Length = 420

 Score =  289 bits (739), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 166/424 (39%), Positives = 247/424 (58%), Gaps = 6/424 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I MP+LSPTM EG LAKW+ +EGD +  GD++ EIETDKA MEFE+VDEG+I +I+
Sbjct: 1   MPINIQMPALSPTMEEGTLAKWLVKEGDTVESGDVMAEIETDKATMEFEAVDEGVIGKII 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVE-VREEHSHSSPVVVREKHSKNRP 120
           VP G+  I VN  I  +L D            EN  + V    +     V++ +++  + 
Sbjct: 61  VPEGSTGIKVNEIIAILLEDGENSSNIKTNDPENKQDVVDIIKNDEKTPVIKSENTDLKF 120

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
               +            +++  +   G      I        N           +     
Sbjct: 121 SKERIFATPLARRIAQSTNVDLANIKGSGPYGRIVKADVQSKNAIALEKAPKTQITSSVT 180

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
              I  ++    +  IP D +RK IA RL ++KQTIPHFY+    N+D LL +R +MN  
Sbjct: 181 SETIKAMYKDREFAEIPLDGMRKVIANRLTEAKQTIPHFYLRKSVNLDKLLIVRSEMNTG 240

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
           L     +   KISVND I+KA +LA+  +P+ANV W  + +++    D++VAVS+ GG+ 
Sbjct: 241 L----IDQGIKISVNDFIIKASSLALQDIPQANVVWAQDRILQMTSSDVAVAVSVEGGLY 296

Query: 30