RPSBLAST alignment for GI: 254780674 and conserved domain: cd06849

>gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid dehydrogenase multienzyme complexes, like pyruvate dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH) and branched-chain 2-oxo acid dehydrogenase (BCDH), contain at least three different enzymes, 2-oxo acid dehydrogenase (E1), dihydrolipoyl acyltransferase (E2) and dihydrolipoamide dehydrogenase (E3) and play a key role in redox regulation. E2, the central component of the complex, catalyzes the transfer of the acyl group of CoA from E1 to E3 via reductive acetylation of a lipoyl group covalently attached to a lysine residue. Length = 74
 Score = 99.8 bits (250), Expect = 1e-21
 Identities = 31/74 (41%), Positives = 45/74 (60%), Gaps = 1/74 (1%)

Query: 5  TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
           I MP L  +MTEG + +W+ +EGD +  GD+L E+ETDKA +E E+   G++ +ILV  
Sbjct: 2  EIKMPDLGESMTEGTIVEWLVKEGDSVEEGDVLAEVETDKATVEVEAPAAGVLAKILVEE 61

Query: 65 GTENIAVNSPILNI 78
          G   + V   I  I
Sbjct: 62 GDT-VPVGQVIAVI 74