RPSBLAST alignment for GI: 254780674 and conserved domain: TIGR01348

>gnl|CDD|162310 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form. This model describes a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and per cent identity (UPGMA) trees. Members of this set include two or three copies of the lipoyl-binding domain. E. coli AceF is a member of this model, while mitochondrial and some other bacterial forms belong to a separate model. Length = 546
 Score =  178 bits (454), Expect = 2e-45
 Identities = 109/418 (26%), Positives = 193/418 (46%), Gaps = 33/418 (7%)

Query: 28  GDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNILMDSTEIPP 87
           GD +S    L  +E+DKA ME  +   G++  + V  G   +     IL  L  +   P 
Sbjct: 140 GDTVSADQSLITLESDKASMEVPAPASGVVKSVKVKVGDS-VPTGDLIL-TLSVAGSTPA 197

Query: 88  SPPLSK----ENIVEVREEHSHS-----------SPVVVREKHSKNRPIASPLARRLAGE 132
           + P               +   +           +P     ++      A+P  RRLA E
Sbjct: 198 TAPAPASAQPAAQSPAATQPEPAAAPAAAKAQAPAPQQAGTQNPAKVDHAAPAVRRLARE 257

Query: 133 HGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNL----F 188
            G+DLS++ G+G  GRI++ D++  +   +     +   + G          L      F
Sbjct: 258 FGVDLSAVKGTGIKGRILREDVQRFVKEPSVRAQAAAASAAGGA-----PGALPWPNVDF 312

Query: 189 AK-DSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREE 247
           +K    E +    IRK     L ++   IPH       +I  + + R+Q N       E+
Sbjct: 313 SKFGEVEEVDMSRIRKISGANLTRNWTMIPHVTHFDKADITEMEAFRKQQNAA----VEK 368

Query: 248 ISNKISVNDIILKAFALAMIQVPEANVSW--TTNAMIRHKHIDISVAVSIPGGIVTPIIR 305
              K++V  I++KA A A+ + P+ N S       +I  K+++I VAV  P G++ P+I+
Sbjct: 369 EGVKLTVLHILMKAVAAALKKFPKFNASLDLGGEQLILKKYVNIGVAVDTPNGLLVPVIK 428

Query: 306 QADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTI 365
             D+K I +++LE+  LA++A+  KL P+E QG   +IS++G +G  +F  ++N P+  I
Sbjct: 429 DVDRKGITELALELSDLAKKARDGKLTPDEMQGACFTISSLGGIGGTAFTPIVNAPEVAI 488

Query: 366 LAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           L +     + V+  +E +   ++  +LS DHR +DGA A++      E + +   +L+
Sbjct: 489 LGVSKSGMEPVWNGKEFEPRLMLPLSLSYDHRVIDGADAARFTTYICESLADIRRLLL 546