RPSBLAST alignment for GI: 254780674 and conserved domain: PRK11854

>gnl|CDD|183337 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated. Length = 633
 Score =  199 bits (507), Expect = 2e-51
 Identities = 111/430 (25%), Positives = 196/430 (45%), Gaps = 33/430 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P +     E ++ + + + GDK+     L  +E DKA ME  +   G + EI V  G
Sbjct: 209 VNVPDIG--GDEVEVTEVMVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNVG 266

Query: 66  TENIAVNSPILNILMDST---EIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK----- 117
            + +   S I+   ++       P     +       + E   ++P    E  S+     
Sbjct: 267 DK-VKTGSLIMRFEVEGAAPAAAPAKQEAAAPAPAAAKAEAPAAAPAAKAEGKSEFAEND 325

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
               A+PL RRLA E G++L+ + G+G  GRI+K D++        VKD           
Sbjct: 326 AYVHATPLVRRLAREFGVNLAKVKGTGRKGRILKEDVQAY------VKDAVKRAEAAPAA 379

Query: 178 ESIDANILNL-------FAK-DSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
            +       L       F+K    E +    I+K     L ++   IPH       +I  
Sbjct: 380 AAAGGGGPGLLPWPKVDFSKFGEIEEVELGRIQKISGANLHRNWVMIPHVTQFDKADITE 439

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWT--TNAMIRHKHI 287
           L + R+Q N   +  + ++  KI+    I+KA A A+ Q+P  N S +     +   K++
Sbjct: 440 LEAFRKQQNA--EAEKRKLGVKITPLVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYV 497

Query: 288 DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMG 347
           +I +AV  P G+V P+ +  ++K I+++S E+  ++++A+  KL   + QGG  +IS++G
Sbjct: 498 NIGIAVDTPNGLVVPVFKDVNKKGIIELSRELMDISKKARDGKLTAGDMQGGCFTISSIG 557

Query: 348 MLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKL 407
            LG   F  ++N P+  IL +     + V+  +E     ++  +LS DHR +DGA     
Sbjct: 558 GLGTTHFTPIVNAPEVAILGVSKSAMEPVWNGKEFAPRLMLPLSLSYDHRVIDGADG--- 614

Query: 408 LAKFKEYIEN 417
            A+F   I +
Sbjct: 615 -ARFITIIND 623