RPSBLAST alignment for GI: 254780674 and conserved domain: COG0511

>gnl|CDD|30857 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism]. Length = 140
 Score = 39.7 bits (92), Expect = 0.002
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 18  GKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILN 77
           G + K   + GD +  G  L  IE  K   E E+  +G++ EILV  G + +    P+  
Sbjct: 79  GTVYKPFVEVGDTVKAGQTLAIIEAMKMENEIEAPADGVVKEILVKNG-DPVEYGDPLAV 137

Query: 78  I 78
           I
Sbjct: 138 I 138