RPSBLAST alignment for GI: 254780674 and conserved domain: KOG0558

>gnl|CDD|35778 KOG0558, KOG0558, KOG0558, Dihydrolipoamide transacylase (alpha-keto acid dehydrogenase E2 subunit) [Energy production and conversion]. Length = 474
 Score =  184 bits (467), Expect = 5e-47
 Identities = 118/413 (28%), Positives = 206/413 (49%), Gaps = 25/413 (6%)

Query: 17  EGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPIL 76
           E  + +W  +EGD +   D LCE+++DKA +   S  +G + +I      +   V  P++
Sbjct: 78  EVTVKEWFVKEGDTVEQFDPLCEVQSDKASVTITSRYDGKVKKIYHSPD-DIAKVGKPLV 136

Query: 77  NILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGID 136
           ++ ++ ++   SP  S E+      E             S  + +A+P  RRLA E+GID
Sbjct: 137 DLEVEDSQ--DSPEDSDESPAVSLGESKQGE-------ESLLKTLATPAVRRLAKENGID 187

Query: 137 LSSLSGSGPHGRIVKSDIETLISTKT--NVKDYSTIQSFGLVDESIDANILNLFAKDSYE 194
           L+ ++G+G  GR++K D+   +            +  +             NL A    +
Sbjct: 188 LAEVTGTGKDGRVLKEDVLRFLGQVPGFVTDPSPSEHAVIPGPSPSTKASSNLEAD---K 244

Query: 195 VIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISV 254
            +P     + +   + ++ + IPHF    + N D+L+ LR++    L+ + +E   K++ 
Sbjct: 245 TVPLRGFSRAMVKTMTEALK-IPHFGYVDEINCDSLVKLRQE----LKENAKERGIKLTF 299

Query: 255 NDIILKAFALAMIQVPEANVSWTTNAM-IRHK--HIDISVAVSIPGGIVTPIIRQADQKS 311
               +KA +LA+++ P  N S+   +  I  K  H +I VA+    G+V P I+     S
Sbjct: 300 MPFFIKAASLALLKYPIVNSSFDEESENIILKGSH-NIGVAMDTEQGLVVPNIKNVQSLS 358

Query: 312 ILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAG 371
           I +I+ E+ +L +     +L PE+  GGT ++SN+G +G      VI PP+  I A+G  
Sbjct: 359 IFEIAKELNRLQELGANGQLSPEDLTGGTFTLSNIGAIGGTFASPVIMPPEVAIGALGRI 418

Query: 372 EKKVVF-QNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           EK   F +  E+  A+IM  + SADHR +DGA  ++   ++KEY+ENP  ML+
Sbjct: 419 EKVPRFNKKGEVYPASIMMVSWSADHRVIDGATMARFSNQWKEYLENPALMLL 471