RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780674|ref|YP_003065087.1| pyruvate dehydrogenase complex
dihydrolipoamide acetyltransferase [Candidatus Liberibacter asiaticus
str. psy62]
         (423 letters)



>gnl|CDD|162311 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex
           dihydrolipoamide acetyltransferase, long form.  This
           model represents one of several closely related clades
           of the dihydrolipoamide acetyltransferase subunit of the
           pyruvate dehydrogenase complex. It includes sequences
           from mitochondria and from alpha and beta branches of
           the proteobacteria, as well as from some other bacteria.
           Sequences from Gram-positive bacteria are not included.
           The non-enzymatic homolog protein X, which serves as an
           E3 component binding protein, falls within the clade
           phylogenetically but is rejected by its low score.
          Length = 435

 Score =  482 bits (1242), Expect = e-137
 Identities = 213/446 (47%), Positives = 293/446 (65%), Gaps = 40/446 (8%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           ITMP+LSPTMT G LAKW+K+EGDK++PGD++ EIETDKA MEFE+V+EG + +ILVP G
Sbjct: 2   ITMPALSPTMTTGNLAKWLKKEGDKVNPGDVIAEIETDKATMEFEAVEEGYLAKILVPEG 61

Query: 66  TENIAVNSPILNILMDSTEI-------------------------PPSPPLSKENIVEVR 100
           T+++ VN PI  ++ +  ++                         PPS P       +  
Sbjct: 62  TKDVPVNKPIAVLVEEKEDVADAFKNYKLESSASAPKPSEIAPTAPPSAPKPSPAPQKQS 121

Query: 101 EEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIST 160
            E S  +P+  +E  S +R  ASPLA++LA E GIDLS+++GSGP+GRIVK DIE+ +  
Sbjct: 122 PEPSSPAPLSDKE--SGDRIFASPLAKKLAKEKGIDLSAVAGSGPNGRIVKKDIESFVPQ 179

Query: 161 KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFY 220
                ++    +     ++         +  SYE +P  NIRK IA RL +SKQTIPH+Y
Sbjct: 180 SPASANFQAAATTPATKKAA-----APVSTGSYEDVPLSNIRKIIAKRLLESKQTIPHYY 234

Query: 221 VSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA 280
           VSI+CN+D LL+LR+++N            K+SVND I+KA ALA+ +VPEAN SWT N 
Sbjct: 235 VSIECNVDKLLALRKELNAMA-----SEVYKLSVNDFIIKASALALREVPEANSSWTDNF 289

Query: 281 MIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT 340
           + R+K++DISVAV+ P G++TPI+R AD K +  IS E+K LA+RA+  KLKPEE+QGGT
Sbjct: 290 IRRYKNVDISVAVATPDGLITPIVRNADAKGLSTISNEIKDLAKRARNNKLKPEEFQGGT 349

Query: 341 TSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEE---IKVATIMNATLSADHR 397
            +ISN+GM GI  F A+INPPQ+ ILA+GA E   V  N+E     VA+IM+ TLS DHR
Sbjct: 350 FTISNLGMFGIKDFTAIINPPQACILAVGAVEDVAVVDNDEEKGFAVASIMSVTLSCDHR 409

Query: 398 SVDGAIASKLLAKFKEYIENPVWMLM 423
            +DGA+ ++ L  FK+Y+ENP+ ML+
Sbjct: 410 VIDGAVGAEFLKSFKKYLENPIEMLL 435


>gnl|CDD|183339 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase
           subunit E2; Reviewed.
          Length = 411

 Score =  471 bits (1216), Expect = e-133
 Identities = 152/429 (35%), Positives = 235/429 (54%), Gaps = 26/429 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M+    MP L   MTEG++ +W+ + GD +  G  L E+ETDKA +E  S   G + ++L
Sbjct: 1   MMFEFKMPDLGEGMTEGEIVEWLVKVGDTVKEGQPLAEVETDKATVEIPSPVAGTVAKLL 60

Query: 62  VPAGTENIAVNSPILNIL-------MDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREK 114
           V  G   + V S I  I          + E  P  P  +          +  +       
Sbjct: 61  VEEGDV-VPVGSVIAVIEEEGEAEAAAAAEAAPEAPAPEPAPAAAAAAAAAPAAAAAPAA 119

Query: 115 HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFG 174
            +     ASP  R+LA E G+DLS++ GSGP GRI K D+E   +               
Sbjct: 120 PAAAAAKASPAVRKLARELGVDLSTVKGSGPGGRITKEDVEAAAAAAAPAA--------- 170

Query: 175 LVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLR 234
               +  A      A +  E +P   +RK IA R+ +SK+ IPHF ++ + ++  LL+LR
Sbjct: 171 -AAAAAAAAAPPAAAAEGEERVPLSGMRKAIAKRMVESKREIPHFTLTDEVDVTALLALR 229

Query: 235 EQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVS 294
           +Q+          I  K++V D ++KA ALA+ + PE N SW  +A++  K+++I +AV+
Sbjct: 230 KQLK--------AIGVKLTVTDFLIKAVALALKKFPELNASWDDDAIVLKKYVNIGIAVA 281

Query: 295 IPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSF 354
             GG++ P+IR AD+KS+ +++ E+K LA++A++ KLKPEE QGGT +ISN+GM G + F
Sbjct: 282 TDGGLIVPVIRDADKKSLFELAREIKDLAEKAREGKLKPEELQGGTFTISNLGMFGGDYF 341

Query: 355 CAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEY 414
             +INPP+  IL +GA  ++ V  + EI V  +M  +LS DHR +DGA A++ L   KE 
Sbjct: 342 TPIINPPEVAILGVGAIVERPVVVDGEIVVRKVMPLSLSFDHRVIDGADAARFLKALKEL 401

Query: 415 IENPVWMLM 423
           +ENP  +L+
Sbjct: 402 LENPALLLL 410


>gnl|CDD|178345 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase
           component of pyruvate dehydrogenase complex.
          Length = 539

 Score =  385 bits (991), Expect = e-107
 Identities = 191/444 (43%), Positives = 271/444 (61%), Gaps = 45/444 (10%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MPSLSPTMTEG +A+W+K+EGDK+SPG++LCE+ETDKA +E E ++EG + +I+   G
Sbjct: 115 IGMPSLSPTMTEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVKGDG 174

Query: 66  TENIAVNSPILNILMDSTEI-------------------PPSPPLSKENIVEVREEHSHS 106
            + I V   I   + +  +I                    PSPP  KE   EV +  S  
Sbjct: 175 AKEIKVGEVIAITVEEEEDIGKFKDYKPSSSAAPAAPKAKPSPPPPKEE--EVEKPASSP 232

Query: 107 SPVVVREK---HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN 163
            P   +      S +R  ASPLAR+LA ++ + LSS+ G+GP GRIVK+DIE        
Sbjct: 233 EPKASKPSAPPSSGDRIFASPLARKLAEDNNVPLSSIKGTGPDGRIVKADIE-------- 284

Query: 164 VKDYSTIQSFGLVDE-SIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVS 222
             DY      G     S D+    L     Y  IP+  IRK  A RL QSKQTIPH+Y++
Sbjct: 285 --DYLASGGKGATAPPSTDSKAPAL----DYTDIPNTQIRKVTASRLLQSKQTIPHYYLT 338

Query: 223 IDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMI 282
           +D  +D L++LR Q+N            KISVND+++KA ALA+ +VP+ N SWT + + 
Sbjct: 339 VDTRVDKLMALRSQLN---SLQEASGGKKISVNDLVIKAAALALRKVPQCNSSWTDDYIR 395

Query: 283 RHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTS 342
           ++ +++I+VAV    G+  P+++ AD+K +  I+ EVKQLAQ+A++  LKPE+Y+GGT +
Sbjct: 396 QYHNVNINVAVQTENGLYVPVVKDADKKGLSTIAEEVKQLAQKARENSLKPEDYEGGTFT 455

Query: 343 ISNM-GMLGINSFCAVINPPQSTILAIGAGEKKVV--FQNEEIKVATIMNATLSADHRSV 399
           +SN+ G  GI  FCA+INPPQS ILA+G+ EK+V+     ++   A+ M+ TLS DHR +
Sbjct: 456 VSNLGGPFGIKQFCAIINPPQSAILAVGSAEKRVIPGSGPDQYNFASFMSVTLSCDHRVI 515

Query: 400 DGAIASKLLAKFKEYIENPVWMLM 423
           DGAI ++ L  FK YIENP  ML+
Sbjct: 516 DGAIGAEWLKAFKGYIENPESMLL 539


>gnl|CDD|183338 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed.
          Length = 547

 Score =  246 bits (630), Expect = 1e-65
 Identities = 121/427 (28%), Positives = 207/427 (48%), Gaps = 29/427 (6%)

Query: 16  TEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPI 75
           TE ++ +W+ + GD +     L  +ETDKA ME  S   G++ EI V  G + ++V S +
Sbjct: 131 TEVEVIEWLVKVGDTVEEDQSLITVETDKATMEIPSPVAGVVKEIKVKVG-DKVSVGSLL 189

Query: 76  LNI--LMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKH-------SKNRPIASPLA 126
           + I     +     +P  +              +                   P ASP  
Sbjct: 190 VVIEVAAAAPAAAAAPAAAAPAAAAAAAPAPAPAAAAAPAAAAPAAAAAPGKAPHASPAV 249

Query: 127 RRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILN 186
           RRLA E G+DLS + G+G  GRI K D++  +    +        +      +     L 
Sbjct: 250 RRLARELGVDLSQVKGTGKKGRITKEDVQAFVKGAMSAA-----AAAAAAAAAAGGGGLG 304

Query: 187 L-------FAKD-SYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMN 238
           L       F+K    E  P   I+K  A  L +S  TIPH     + +I +L +LR+Q+ 
Sbjct: 305 LLPWPKVDFSKFGEIETKPLSRIKKISAANLHRSWVTIPHVTQFDEADITDLEALRKQLK 364

Query: 239 RTLQFHREEISNKISVNDIILKAFALAMIQVPEAN--VSWTTNAMIRHKHIDISVAVSIP 296
           +  +  +  +  K+++    +KA   A+ + P  N  +    + +   K+ +I  AV  P
Sbjct: 365 K--EAEKAGV--KLTMLPFFIKAVVAALKEFPVFNASLDEDGDELTYKKYFNIGFAVDTP 420

Query: 297 GGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCA 356
            G+V P+I+  D+KS+L+I+ E+ +LA++A+  KLKP++ QGG  +IS++G +G  +F  
Sbjct: 421 NGLVVPVIKDVDKKSLLEIAREIAELAKKARDGKLKPDDMQGGCFTISSLGGIGGTAFTP 480

Query: 357 VINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIE 416
           +IN P+  IL +G  + K V+  +E     ++  +LS DHR +DGA A++     K+ + 
Sbjct: 481 IINAPEVAILGVGKSQMKPVWDGKEFVPRLMLPLSLSYDHRVIDGATAARFTNYLKQLLA 540

Query: 417 NPVWMLM 423
           +P  ML+
Sbjct: 541 DPRRMLL 547



 Score = 56.4 bits (137), Expect = 1e-08
 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 2/89 (2%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M     +P +   + E ++ +W+ +EGD +     L  +ETDKA ME  S   G++ EI 
Sbjct: 1  MAIEFKVPDIG-EVVEVEVIEWLVKEGDTVEEDQPLVTVETDKATMEIPSPAAGVVKEIK 59

Query: 62 VPAGTENIAVNSPILNILMDSTEIPPSPP 90
          V  G + ++V   +  I         + P
Sbjct: 60 VKVG-DTVSVGGLLAVIEAAGAAAAAAAP 87


>gnl|CDD|162309 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex
           dihydrolipoamide succinyltransferase (E2 component).
           dihydrolipoamide acetyltransferase. The seed for this
           model includes mitochondrial and Gram-negative bacterial
           forms. Mycobacterial candidates are highly derived,
           differ in having and extra copy of the lipoyl-binding
           domain at the N-terminus. They score below the trusted
           cutoff, but above the noise cutoff and above all
           examples of dihydrolipoamide acetyltransferase.
          Length = 403

 Score =  216 bits (551), Expect = 1e-56
 Identities = 131/426 (30%), Positives = 207/426 (48%), Gaps = 33/426 (7%)

Query: 5   TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
            I +P L+ ++TEG +A+W K+ GD +   + + EIETDK ++E  S  +G++ EIL   
Sbjct: 2   EIKVPELAESITEGTVAEWHKKVGDTVKRDENIVEIETDKVVLEVPSPADGVLQEILFKE 61

Query: 65  GTENIAVNSPI--LNILMDSTEIPPSP-PLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           G   +     +  L    D+T  PP+     KE         + ++          NRP 
Sbjct: 62  GD-TVESGQVLAILEEGNDATAAPPAKSGEEKEETPAASAAAAPTAA--------ANRPS 112

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESID 181
            SP ARRLA EHGIDLS++ G+G  GR+ K DI      K      S             
Sbjct: 113 LSPAARRLAKEHGIDLSAVPGTGVTGRVTKEDII-----KKTEAPASAQAPAPA-----A 162

Query: 182 ANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTL 241
           A           E +    +R+ IA RL++++ +        + ++  ++ LR++     
Sbjct: 163 AAKAPANFTRPEERVKMTRLRQRIAERLKEAQNSTAMLTTFNEVDMSAVMELRKR----- 217

Query: 242 QFHREEISNKISVN----DIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPG 297
             ++EE   K  V        +KA   A+ + PE N     + ++   + DISVAVS   
Sbjct: 218 --YKEEFEKKHGVKLGFMSFFVKAVVAALKRFPEVNAEIDGDDIVYKDYYDISVAVSTDR 275

Query: 298 GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAV 357
           G+V P++R AD+ S  DI  E+  L ++A+  KL  E+  GGT +I+N G+ G      +
Sbjct: 276 GLVVPVVRNADRMSFADIEKEIADLGKKARDGKLTLEDMTGGTFTITNGGVFGSLMSTPI 335

Query: 358 INPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIEN 417
           INPPQS IL +   +++ V  N +I++  +M   LS DHR +DG  A   L   KE +E+
Sbjct: 336 INPPQSAILGMHGIKERPVAVNGQIEIRPMMYLALSYDHRLIDGKEAVTFLVTIKELLED 395

Query: 418 PVWMLM 423
           P  +L+
Sbjct: 396 PRRLLL 401


>gnl|CDD|180214 PRK05704, PRK05704, dihydrolipoamide succinyltransferase;
           Validated.
          Length = 407

 Score =  207 bits (529), Expect = 5e-54
 Identities = 124/431 (28%), Positives = 210/431 (48%), Gaps = 34/431 (7%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
           MM+  I +P+L  ++TE  +A W K+ GD +   ++L EIETDK ++E  +   G++ EI
Sbjct: 1   MMVE-IKVPTLPESVTEATIATWHKKPGDAVKRDEVLVEIETDKVVLEVPAPAAGVLSEI 59

Query: 61  LVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRP 120
           L   G + + V   +  I   +     +   +           + ++        ++   
Sbjct: 60  LAEEG-DTVTVGQVLGRIDEGAAAGAAAAAAAAAAAAAAAPAQAQAAAA------AEQSN 112

Query: 121 IA-SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDES 179
            A SP AR+LA E+G+D S++ G+G  GR+ K D+   ++                   +
Sbjct: 113 DALSPAARKLAAENGLDASAVKGTGKGGRVTKEDVLAALAAAAAAPAAPA-------AAA 165

Query: 180 IDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNR 239
             A    L A+   E +P   +RKTIA RL +++ T        + ++  ++ LR+Q   
Sbjct: 166 PAAAPAPLGAR-PEERVPMTRLRKTIAERLLEAQNTTAMLTTFNEVDMTPVMDLRKQ--Y 222

Query: 240 TLQFHREEISNKISVNDIIL-------KAFALAMIQVPEANVSWTTNAMIRHKHIDISVA 292
              F ++        + + L       KA   A+ + PE N S   + ++ H + DI +A
Sbjct: 223 KDAFEKK--------HGVKLGFMSFFVKAVVEALKRYPEVNASIDGDDIVYHNYYDIGIA 274

Query: 293 VSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGIN 352
           V  P G+V P++R ADQ S  +I  ++ +LA++A+  KL  EE  GGT +I+N G+ G  
Sbjct: 275 VGTPRGLVVPVLRDADQLSFAEIEKKIAELAKKARDGKLSIEELTGGTFTITNGGVFGSL 334

Query: 353 SFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFK 412
               +INPPQS IL +   +++ V  N +I +  +M   LS DHR +DG  A   L   K
Sbjct: 335 MSTPIINPPQSAILGMHKIKERPVAVNGQIVIRPMMYLALSYDHRIIDGKEAVGFLVTIK 394

Query: 413 EYIENPVWMLM 423
           E +E+P  +L+
Sbjct: 395 ELLEDPERLLL 405


>gnl|CDD|183337 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase;
           Validated.
          Length = 633

 Score =  199 bits (507), Expect = 2e-51
 Identities = 111/430 (25%), Positives = 196/430 (45%), Gaps = 33/430 (7%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P +     E ++ + + + GDK+     L  +E DKA ME  +   G + EI V  G
Sbjct: 209 VNVPDIG--GDEVEVTEVMVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNVG 266

Query: 66  TENIAVNSPILNILMDST---EIPPSPPLSKENIVEVREEHSHSSPVVVREKHSK----- 117
            + +   S I+   ++       P     +       + E   ++P    E  S+     
Sbjct: 267 DK-VKTGSLIMRFEVEGAAPAAAPAKQEAAAPAPAAAKAEAPAAAPAAKAEGKSEFAEND 325

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVD 177
               A+PL RRLA E G++L+ + G+G  GRI+K D++        VKD           
Sbjct: 326 AYVHATPLVRRLAREFGVNLAKVKGTGRKGRILKEDVQAY------VKDAVKRAEAAPAA 379

Query: 178 ESIDANILNL-------FAK-DSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229
            +       L       F+K    E +    I+K     L ++   IPH       +I  
Sbjct: 380 AAAGGGGPGLLPWPKVDFSKFGEIEEVELGRIQKISGANLHRNWVMIPHVTQFDKADITE 439

Query: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWT--TNAMIRHKHI 287
           L + R+Q N   +  + ++  KI+    I+KA A A+ Q+P  N S +     +   K++
Sbjct: 440 LEAFRKQQNA--EAEKRKLGVKITPLVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYV 497

Query: 288 DISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMG 347
           +I +AV  P G+V P+ +  ++K I+++S E+  ++++A+  KL   + QGG  +IS++G
Sbjct: 498 NIGIAVDTPNGLVVPVFKDVNKKGIIELSRELMDISKKARDGKLTAGDMQGGCFTISSIG 557

Query: 348 MLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKL 407
            LG   F  ++N P+  IL +     + V+  +E     ++  +LS DHR +DGA     
Sbjct: 558 GLGTTHFTPIVNAPEVAILGVSKSAMEPVWNGKEFAPRLMLPLSLSYDHRVIDGADG--- 614

Query: 408 LAKFKEYIEN 417
            A+F   I +
Sbjct: 615 -ARFITIIND 623



 Score = 49.2 bits (118), Expect = 2e-06
 Identities = 24/93 (25%), Positives = 41/93 (44%), Gaps = 4/93 (4%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
          M   I +P +     E ++ + + + GDK+     L  +E DKA ME  S   G++ EI 
Sbjct: 1  MAIEIKVPDIG--ADEVEVTEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIK 58

Query: 62 VPAGTENIAVNSPILNILMDSTEIPPSPPLSKE 94
          V  G + +   + I+ I   +     + P   E
Sbjct: 59 VKVG-DKVETGALIM-IFESADGAADAAPAQAE 89



 Score = 40.4 bits (95), Expect = 9e-04
 Identities = 19/89 (21%), Positives = 39/89 (43%), Gaps = 3/89 (3%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           + +P +     E ++ + + + GD +     L  +E DKA ME  +   G + EI V  G
Sbjct: 108 VHVPDIG--SDEVEVTEILVKVGDTVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNVG 165

Query: 66  TENIAVNSPILNILMDSTEIPPSPPLSKE 94
            + ++  S I+   +       +P  ++ 
Sbjct: 166 -DKVSTGSLIMVFEVAGEAPAAAPAAAEA 193


>gnl|CDD|178143 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component.
          Length = 416

 Score =  196 bits (500), Expect = 8e-51
 Identities = 113/414 (27%), Positives = 216/414 (52%), Gaps = 19/414 (4%)

Query: 17  EGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPIL 76
           E +L +W  +EGD++     LCE+++DKA +E  S  +G + +I    G + + V   +L
Sbjct: 12  ECELLRWFVKEGDQVEEFQPLCEVQSDKATIEITSRYKGKVAQINFSPG-DIVKVGETLL 70

Query: 77  NILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI-ASPLARRLAGEHGI 135
            I+++ ++   S  L            + S      E+ S    + ++P  R LA ++GI
Sbjct: 71  KIMVEDSQHLRSDSLLLPTDSSNIVSLAESD-----ERGSNLSGVLSTPAVRHLAKQYGI 125

Query: 136 DLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYE- 194
           DL+ + G+G  GR++K D+    + K  VKD S+ +   + ++   +  ++   + SYE 
Sbjct: 126 DLNDILGTGKDGRVLKEDVLKYAAQKGVVKDSSSAEEATIAEQEEFSTSVSTPTEQSYED 185

Query: 195 -VIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKIS 253
             IP    ++ +   +  + + +PHF+   + N+D L+ L+     + Q +  + + K +
Sbjct: 186 KTIPLRGFQRAMVKTMTAAAK-VPHFHYVEEINVDALVELK----ASFQENNTDPTVKHT 240

Query: 254 VNDIILKAFALAMIQVPEANVSWTTNAM-IRHK--HIDISVAVSIPGGIVTPIIRQADQK 310
               ++K+ ++A+ + P  N  +      IR K  H +I VA++   G+V P I+     
Sbjct: 241 FLPFLIKSLSMALSKYPLLNSCFNEETSEIRLKGSH-NIGVAMATEHGLVVPNIKNVQSL 299

Query: 311 SILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGA 370
           S+L+I+ E+ +L   A + KL PE+  GGT ++SN+G +G      V+N P+  I+A+G 
Sbjct: 300 SLLEITKELSRLQHLAAENKLNPEDITGGTITLSNIGAIGGKFGSPVLNLPEVAIIALGR 359

Query: 371 GEKKVVFQNEE-IKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
            +K   F ++  +  A+IM  T+ ADHR +DGA  ++   ++K Y+E P  +++
Sbjct: 360 IQKVPRFVDDGNVYPASIMTVTIGADHRVLDGATVARFCNEWKSYVEKPELLML 413


>gnl|CDD|185477 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase;
           Provisional.
          Length = 418

 Score =  184 bits (470), Expect = 3e-47
 Identities = 111/423 (26%), Positives = 190/423 (44%), Gaps = 52/423 (12%)

Query: 3   IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           I  I +P++  +++EG + +W K+ GD +   +++C IETDK  ++  +   G+I +I  
Sbjct: 44  IKVIKVPTMGDSISEGTVVEWKKKVGDYVKEDEVICIIETDKVSVDIRAPASGVITKIFA 103

Query: 63  PAGTENIAVNSPILNILMDSTEIPPSPPLSK--ENIVEVREEHSHSSPVVVREKHSKNRP 120
             G + + V +P+  I  D+   PP+   +       E        +     E  + ++P
Sbjct: 104 EEG-DTVEVGAPLSEI--DTGGAPPAAAPAAAAAAKAEKTTPEKPKAAAPTPEPPAASKP 160

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESI 180
                A+                 P  +   + +      +T V                
Sbjct: 161 TPPAAAKPPEPA------------PAAKPPPTPVARADPRETRV---------------- 192

Query: 181 DANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRT 240
                           P   +R+ IA RL+ S+ T        +C++  L+ LR++    
Sbjct: 193 ----------------PMSRMRQRIAERLKASQNTCAMLTTFNECDMSALMELRKEYKDD 236

Query: 241 LQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIV 300
            Q   ++   K+      +KA  +A+ ++P  N     + ++   ++DISVAV+ P G+V
Sbjct: 237 FQ---KKHGVKLGFMSAFVKASTIALKKMPIVNAYIDGDEIVYRNYVDISVAVATPTGLV 293

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
            P+IR  + KS  +I  E+  LA++A+  KL  E+  GGT +ISN G+ G      +INP
Sbjct: 294 VPVIRNCENKSFAEIEKELADLAEKARNNKLTLEDMTGGTFTISNGGVFGSLMGTPIINP 353

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           PQS IL + A +K+ V    EI +  IM   L+ DHR +DG  A   L K K+ IE+P  
Sbjct: 354 PQSAILGMHAIKKRPVVVGNEIVIRPIMYLALTYDHRLIDGRDAVTFLKKIKDLIEDPAR 413

Query: 421 MLM 423
           ML+
Sbjct: 414 MLL 416


>gnl|CDD|184847 PRK14843, PRK14843, dihydrolipoamide acetyltransferase;
           Provisional.
          Length = 347

 Score =  180 bits (458), Expect = 7e-46
 Identities = 97/303 (32%), Positives = 162/303 (53%), Gaps = 9/303 (2%)

Query: 123 SPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDA 182
           SPLA+R+A EH I    + G+G  G+I+K D+  L+          +      V+E  D 
Sbjct: 52  SPLAKRIALEHNIAWQEIQGTGHRGKIMKKDVLALLPENIENDSIKSPAQIEKVEEVPD- 110

Query: 183 NILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ 242
              N+      E IP   +RK IA R+ +S  T P F ++ + ++  +L+LR+++   + 
Sbjct: 111 ---NVTPYGEIERIPMTPMRKVIAQRMVESYLTAPTFTLNYEVDMTEMLALRKKVLEPIM 167

Query: 243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNA--MIRHKHIDISVAVSIPGGIV 300
              E    K +V D++  A    +++ P  N S T +   +I H ++++++AV +  G++
Sbjct: 168 ---EATGKKTTVTDLLSLAVVKTLMKHPYINASLTEDGKTIITHNYVNLAMAVGMDNGLM 224

Query: 301 TPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINP 360
           TP++  A++ S+ ++ +  K +  R    KL P E Q  T +ISN+GM G+ SF  +IN 
Sbjct: 225 TPVVYNAEKMSLSELVVAFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGPIINQ 284

Query: 361 PQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVW 420
           P S IL + +  +K V  N EI +  IM+  L+ DHR VDG   +K +   KE IE P+ 
Sbjct: 285 PNSAILGVSSTIEKPVVVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKELIETPIS 344

Query: 421 MLM 423
           ML+
Sbjct: 345 MLI 347


>gnl|CDD|162310 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex
           dihydrolipoamide acetyltransferase, long form.  This
           model describes a subset of pyruvate dehydrogenase
           complex dihydrolipoamide acetyltransferase specifically
           close by both phylogenetic and per cent identity (UPGMA)
           trees. Members of this set include two or three copies
           of the lipoyl-binding domain. E. coli AceF is a member
           of this model, while mitochondrial and some other
           bacterial forms belong to a separate model.
          Length = 546

 Score =  178 bits (454), Expect = 2e-45
 Identities = 109/418 (26%), Positives = 193/418 (46%), Gaps = 33/418 (7%)

Query: 28  GDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNILMDSTEIPP 87
           GD +S    L  +E+DKA ME  +   G++  + V  G   +     IL  L  +   P 
Sbjct: 140 GDTVSADQSLITLESDKASMEVPAPASGVVKSVKVKVGDS-VPTGDLIL-TLSVAGSTPA 197

Query: 88  SPPLSK----ENIVEVREEHSHS-----------SPVVVREKHSKNRPIASPLARRLAGE 132
           + P               +   +           +P     ++      A+P  RRLA E
Sbjct: 198 TAPAPASAQPAAQSPAATQPEPAAAPAAAKAQAPAPQQAGTQNPAKVDHAAPAVRRLARE 257

Query: 133 HGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNL----F 188
            G+DLS++ G+G  GRI++ D++  +   +     +   + G          L      F
Sbjct: 258 FGVDLSAVKGTGIKGRILREDVQRFVKEPSVRAQAAAASAAGGA-----PGALPWPNVDF 312

Query: 189 AK-DSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREE 247
           +K    E +    IRK     L ++   IPH       +I  + + R+Q N       E+
Sbjct: 313 SKFGEVEEVDMSRIRKISGANLTRNWTMIPHVTHFDKADITEMEAFRKQQNAA----VEK 368

Query: 248 ISNKISVNDIILKAFALAMIQVPEANVSW--TTNAMIRHKHIDISVAVSIPGGIVTPIIR 305
              K++V  I++KA A A+ + P+ N S       +I  K+++I VAV  P G++ P+I+
Sbjct: 369 EGVKLTVLHILMKAVAAALKKFPKFNASLDLGGEQLILKKYVNIGVAVDTPNGLLVPVIK 428

Query: 306 QADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTI 365
             D+K I +++LE+  LA++A+  KL P+E QG   +IS++G +G  +F  ++N P+  I
Sbjct: 429 DVDRKGITELALELSDLAKKARDGKLTPDEMQGACFTISSLGGIGGTAFTPIVNAPEVAI 488

Query: 366 LAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           L +     + V+  +E +   ++  +LS DHR +DGA A++      E + +   +L+
Sbjct: 489 LGVSKSGMEPVWNGKEFEPRLMLPLSLSYDHRVIDGADAARFTTYICESLADIRRLLL 546



 Score = 39.1 bits (91), Expect = 0.002
 Identities = 19/38 (50%), Positives = 22/38 (57%)

Query: 28 GDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
          GDK+  G  L  +E+DKA ME  S   GII EI V  G
Sbjct: 24 GDKVEAGQSLITLESDKASMEVPSSAAGIIKEIKVKVG 61


>gnl|CDD|183363 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta;
          Provisional.
          Length = 464

 Score =  145 bits (368), Expect = 2e-35
 Identities = 51/97 (52%), Positives = 69/97 (71%), Gaps = 4/97 (4%)

Query: 1  MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
          M I  I MP+LSPTM EG LAKW+K+EGDK+  GD++ EIETDKA ME E+VDEG + +I
Sbjct: 1  MAIE-ILMPALSPTMEEGTLAKWLKKEGDKVKSGDVIAEIETDKATMEVEAVDEGTLGKI 59

Query: 61 LVPAGTENIAVNSPILNILMD---STEIPPSPPLSKE 94
          LVP GTE + VN+PI  +L +   +++   +P  + E
Sbjct: 60 LVPEGTEGVKVNTPIAVLLEEGESASDAGAAPAAAAE 96


>gnl|CDD|131973 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component,
           dihydrolipoamide succinyltransferase.  This model
           represents an Actinobacterial clade of E2 enzyme, a
           component of the 2-oxoglutarate dehydrogenase complex
           involved in the TCA cycle. These proteins have multiple
           domains including the catalytic domain (pfam00198), one
           or two biotin domains (pfam00364) and an E3-component
           binding domain (pfam02817).
          Length = 590

 Score =  144 bits (363), Expect = 5e-35
 Identities = 113/452 (25%), Positives = 190/452 (42%), Gaps = 50/452 (11%)

Query: 6   ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           I MP L  ++TEG + +W+K  GDKI   + + E+ TDK   E  S   G I EIL  A 
Sbjct: 138 IEMPELGESVTEGTITQWLKAVGDKIEVDEPILEVSTDKVDTEIPSPVAGTILEIL--AE 195

Query: 66  TENIAVNSPILNILMDSTEIP-------------------PSPPLSKENIVEVREEHSHS 106
            ++       +  + D+                         P   K+   E   +   +
Sbjct: 196 EDDTVDVGAEIAKIGDAGAAAAEDAKAEEEAEAKAEAKPEEKPDPKKDEAAEPEPDEPEA 255

Query: 107 SPVVVREK--------HSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLI 158
                +E+        +S   P  +PL R+LA EHGIDL+S+ G+G  GRI K D+    
Sbjct: 256 EKAEKKEEKAAAAPAANSDGSPYVTPLVRKLAAEHGIDLNSVKGTGIGGRIRKQDVLAAA 315

Query: 159 STKTNVKDYSTIQSFGLVDESIDANILNL---FAKDSYEVIPHDNIRKTIACRLQQSKQT 215
                  +    ++      +  A   +     A         + IR+  A + +++ Q 
Sbjct: 316 EGAKAAAEAPAAEAAAAAPAAAAAASASPAPAKAHLRGTTQKANRIREITAKKTREALQA 375

Query: 216 IPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQV----PE 271
                   + ++  + +LR +        +   + K  VN   L  FA A+I      P 
Sbjct: 376 SAQLTQLHEVDMTKIAALRAR-------AKAAFAEKEGVNLTFLPFFAKAVIDALKAHPN 428

Query: 272 ANVSWT--TNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQR 329
            N S+   T  +  H    +  AV    G+++P+I  A   S+ +I+  +  +A RA+  
Sbjct: 429 VNASYNADTKEITYHAAEHLGFAVDTDAGLLSPVIHNAGDLSLGEIAKAIADIAARARNG 488

Query: 330 KLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVV-----FQNEEIKV 384
           KLKP++  GGT +I+N+G  G      ++ PPQ+ IL  GA  K+          + I +
Sbjct: 489 KLKPDDLAGGTFTITNIGSEGALFDTPILIPPQAAILGTGAIVKRPRVITDEDGIDSIAI 548

Query: 385 ATIMNATLSADHRSVDGAIASKLLAKFKEYIE 416
             + +  L+ DH+ +DGA A + L   K+ +E
Sbjct: 549 RQMCHLPLTYDHQLIDGADAGRFLTTIKDRLE 580



 Score = 47.8 bits (113), Expect = 5e-06
 Identities = 23/59 (38%), Positives = 35/59 (59%)

Query: 2  MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEI 60
          M  ++ MP+L  ++TEG + +W+K EGD +   + L E+ TDK   E  S   G+I EI
Sbjct: 1  MAFSVEMPALGESVTEGTITQWLKAEGDTVELDEPLLEVSTDKVDTEIPSPAAGVILEI 59


>gnl|CDD|183340 PRK11857, PRK11857, dihydrolipoamide acetyltransferase; Reviewed.
          Length = 306

 Score =  136 bits (345), Expect = 9e-33
 Identities = 89/303 (29%), Positives = 155/303 (51%), Gaps = 10/303 (3%)

Query: 121 IASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNV-KDYSTIQSFGLVDES 179
           +A+P+AR LA + GID+S L GSG  G+I+  D+E  I +  +                +
Sbjct: 3   LATPIARALAKKLGIDISLLKGSGRDGKILAEDVENFIKSLKSAPTPAEAASVSSAQQAA 62

Query: 180 IDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNID--NLLSLREQM 237
             A       K   +      IRK IA  +  S   +   YV++   ID   L  LR+ +
Sbjct: 63  KTAAPAAAPPKLEGKREKVAPIRKAIARAMTNSWSNVA--YVNLVNEIDMTKLWDLRKSV 120

Query: 238 NRTLQFHREEISNKISVNDIILKAFALAMIQVP--EANVSWTTNAMIRHKHIDISVAVSI 295
              +    +    K++    I KA  +A+ + P   A     T+ ++    +++ +AV  
Sbjct: 121 KDPVL---KTEGVKLTFLPFIAKAILIALKEFPIFAAKYDEATSELVYPDTLNLGIAVDT 177

Query: 296 PGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFC 355
             G++ P+I+ A + SI++I+ E+ +LA+ A++RK+KP+E +GG+ +I+N G +G     
Sbjct: 178 EAGLMVPVIKNAQKLSIVEIAKEISRLAKAARERKIKPDEMKGGSFTITNYGSVGSLYGV 237

Query: 356 AVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYI 415
            VIN P+  I  +GA   K + +N +I    +M+ T++ADHR +DGA   +  ++ KE +
Sbjct: 238 PVINYPELAIAGVGAIIDKAIVKNGQIVAGKVMHLTVAADHRWIDGATIGRFASRVKELL 297

Query: 416 ENP 418
           E P
Sbjct: 298 EKP 300


>gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component.
          Length = 463

 Score =  102 bits (255), Expect = 2e-22
 Identities = 66/234 (28%), Positives = 116/234 (49%), Gaps = 3/234 (1%)

Query: 190 KDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEIS 249
           K+    +P   +RK +A RL+ S+ T        + ++ NL+ LR Q         E+  
Sbjct: 231 KERERRVPMTRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSQYKDAFY---EKHG 287

Query: 250 NKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQ 309
            K+ +    +KA   A+   P  N     + +I   ++DIS+AV    G+V P+IR AD+
Sbjct: 288 VKLGLMSGFIKAAVSALQHQPVVNAVIDGDDIIYRDYVDISIAVGTSKGLVVPVIRGADK 347

Query: 310 KSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIG 369
            +  +I   +  LA++A +  +  +E  GG+ ++SN G+ G      +INPPQS IL + 
Sbjct: 348 MNFAEIEKTINGLAKKANEGTISIDEMAGGSFTVSNGGVYGSLISTPIINPPQSAILGMH 407

Query: 370 AGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           +   + +     +    +M   L+ DHR +DG  A   L + K+ +E+P  +L+
Sbjct: 408 SIVSRPMVVGGSVVPRPMMYVALTYDHRLIDGREAVYFLRRVKDVVEDPQRLLL 461



 Score = 44.7 bits (105), Expect = 4e-05
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 19/127 (14%)

Query: 8   MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG-- 65
           +P +  ++T+G LA ++K+ G+++   + + +IETDK  ++  S   G+I E LV  G  
Sbjct: 96  VPHMGESITDGTLATFLKKPGERVQADEAIAQIETDKVTIDIASPASGVIQEFLVKEGDT 155

Query: 66  ------TENIAVNSPILNILMDSTEIP------PSPPLSKENIVEVREEHSHSSPVVVRE 113
                    I+ +    + +  S +IP      PSPP   +   +V      S+PV  + 
Sbjct: 156 VEPGTKVAIISKSEDAASQVTPSQKIPETTDPKPSPPAEDKQKPKV-----ESAPVAEKP 210

Query: 114 KHSKNRP 120
           K   + P
Sbjct: 211 KAPSSPP 217


>gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit
           dihydrolipoyllysine-residue acetyltransferase;
           Provisional.
          Length = 371

 Score = 96.9 bits (242), Expect = 8e-21
 Identities = 42/153 (27%), Positives = 64/153 (41%), Gaps = 32/153 (20%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
            I  ITMP    +MTEGK+A W+ QEGD++  GD L ++ETDK   E E+   G +   +
Sbjct: 1   SITPITMPKWGLSMTEGKVAGWLVQEGDEVEKGDELLDVETDKITNEVEAPAAGTLRRQV 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
              G   + V + +  ++ D+ E+  +         E+                      
Sbjct: 61  AQEGET-LPVGALL-AVVADA-EVSDA---------EIDA-------------------F 89

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDI 154
            +P ARR A E GID      +    RI    +
Sbjct: 90  IAPFARRFAPE-GIDEEDAGPAPRKARIGGRTV 121


>gnl|CDD|183391 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed.
          Length = 1228

 Score = 62.6 bits (153), Expect = 2e-10
 Identities = 48/193 (24%), Positives = 85/193 (44%), Gaps = 26/193 (13%)

Query: 227 IDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFAL--AMIQVPEANVSWTTN----A 280
           IDN    R  +N  L+  R     K+S   +I   +AL  A+   P  N  +        
Sbjct: 152 IDN----RIVINNHLKRTRGG---KVSFTHLI--GYALVQALKAFPNMNRHYAEVDGKPT 202

Query: 281 MIRHKHIDISVAVSIPG-----GIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEE 335
           ++   H+++ +A+ +P       +V P I+ A+           + + +RA+  KL  ++
Sbjct: 203 LVTPAHVNLGLAIDLPKKDGSRQLVVPAIKGAETMDFAQFWAAYEDIVRRARDGKLTADD 262

Query: 336 YQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQN------EEIKVATIMN 389
           +QG T S++N G +G       +   Q  I+ +GA E    FQ        E+ ++ +M 
Sbjct: 263 FQGTTISLTNPGGIGTVHSVPRLMKGQGAIIGVGAMEYPAEFQGASEERLAELGISKVMT 322

Query: 390 ATLSADHRSVDGA 402
            T + DHR + GA
Sbjct: 323 LTSTYDHRIIQGA 335


>gnl|CDD|181754 PRK09282, PRK09282, pyruvate carboxylase subunit B; Validated.
          Length = 592

 Score = 32.9 bits (76), Expect = 0.14
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 18  GKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILN 77
           G + K   +EGDK+  GD +  +E  K   E ++  +G + EILV  G + +     ++ 
Sbjct: 531 GTVVKVKVKEGDKVKAGDTVLVLEAMKMENEIQAPVDGTVKEILVKEG-DRVNPGDVLME 589

Query: 78  I 78
           I
Sbjct: 590 I 590


>gnl|CDD|162205 TIGR01108, oadA, oxaloacetate decarboxylase alpha subunit.  This
           model describes the bacterial oxaloacetate decarboxylase
           alpha subunit and its equivalents in archaea. The
           oxaloacetate decarboxylase Na+ pump is the paradigm of
           the family of Na+ transport decarboxylases that present
           in bacteria and archaea. It a multi subunit enzyme
           consisting of a peripheral alpha-subunit and integral
           membrane subunits beta and gamma. The energy released by
           the decarboxylation reaction of oxaloacetate is coupled
           to Na+ ion pumping across the membrane.
          Length = 582

 Score = 32.8 bits (75), Expect = 0.16
 Identities = 15/48 (31%), Positives = 24/48 (50%)

Query: 18  GKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           G + K    EG  ++ G++L  +E  K   E ++   G + EILV  G
Sbjct: 526 GSIVKVKVSEGQTVAEGEVLLILEAMKMETEIKAAAAGTVREILVKVG 573


>gnl|CDD|178564 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA
           carboxylase.
          Length = 274

 Score = 32.5 bits (74), Expect = 0.19
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 28  GDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNI 78
           GDK+  G ++C IE  K + E E+   G I EIL   G + ++V++P+  I
Sbjct: 223 GDKVQKGQVVCIIEAMKLMNEIEADQSGTIVEILAEDG-KPVSVDTPLFVI 272


>gnl|CDD|162983 TIGR02712, urea_carbox, urea carboxylase.  Members of this family are
            ATP-dependent urea carboxylase, including characterized
            members from Oleomonas sagaranensis (alpha class
            Proteobacterium) and yeasts such as Saccharomyces
            cerevisiae. The allophanate hydrolase domain of the yeast
            enzyme is not included in this model and is represented
            by an adjacent gene in Oleomonas sagaranensis. The fusion
            of urea carboxylase and allophanate hydrolase is
            designated urea amidolyase. The enzyme from Oleomonas
            sagaranensis was shown to be highly active on acetamide
            and formamide as well as urea.
          Length = 1201

 Score = 31.5 bits (72), Expect = 0.46
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 18   GKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
            G   K + + GD++  G  L  +E  K  M   +   G + +IL   G
Sbjct: 1141 GNFWKVLVEVGDRVEAGQPLVILEAMKMEMPVSAPVAGKVTKILCQPG 1188


>gnl|CDD|183386 PRK11930, PRK11930, putative bifunctional
           UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine
           ligase/alanine racemase; Provisional.
          Length = 822

 Score = 31.1 bits (71), Expect = 0.61
 Identities = 19/93 (20%), Positives = 36/93 (38%), Gaps = 4/93 (4%)

Query: 116 SKNRPIASPLARRLAGEHGIDLSSLSGSGPHG--RIVKSDIETLISTKTNVKDYSTIQSF 173
             N  I+S + +       I  S      P     + K +  T+IS     +D+     F
Sbjct: 223 GDNELISSCITKSNLTLKLISWSRKDPEAPLYIPFVEKKEDHTVISYTYKGEDFHFEIPF 282

Query: 174 GLVDESIDANILNLFAKDSYEVIPHDNIRKTIA 206
             +D++   N+++  A   Y     D I++ +A
Sbjct: 283 --IDDASIENLIHCIAVLLYLGYSADQIQERMA 313


>gnl|CDD|184472 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisional.
          Length = 593

 Score = 31.1 bits (71), Expect = 0.65
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 5/63 (7%)

Query: 18  GKLAKWIKQEGDKISPGDILCEIETDKAIMEFE--SVDEGIIDEILVPAGTENIAVNSPI 75
           G + K I  EG  ++ GD+L  +E  K  ME E  +   G +  I V  G + +AV   +
Sbjct: 533 GNIFKVIVTEGQTVAEGDVLLILEAMK--METEIRAAQAGTVRGIAVKEG-DAVAVGDTL 589

Query: 76  LNI 78
           L +
Sbjct: 590 LTL 592


>gnl|CDD|180522 PRK06302, PRK06302, acetyl-CoA carboxylase biotin carboxyl carrier
           protein subunit; Validated.
          Length = 155

 Score = 30.9 bits (71), Expect = 0.66
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 28  GDKISPGDILCEIETDKAIMEFESVDEGIIDEILV 62
           GD +  G  LC IE  K + E E+   G++ EILV
Sbjct: 105 GDTVKEGQTLCIIEAMKVMNEIEADKSGVVTEILV 139


>gnl|CDD|180378 PRK06064, PRK06064, acetyl-CoA acetyltransferase; Provisional.
          Length = 389

 Score = 31.0 bits (71), Expect = 0.67
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 12/56 (21%)

Query: 377 FQNEEIKVATIMNATLSAD-----HRS--VDGAIASKLLA---KFKEYIENPVWML 422
           FQ E I V  ++N+   AD       S   DGA A+ +LA   K KEY + PVW+ 
Sbjct: 184 FQKE-ITVEQVLNSPPVADPLKLLDCSPITDGA-AAVILASEEKAKEYTDTPVWIK 237


>gnl|CDD|180286 PRK05848, PRK05848, nicotinate-nucleotide pyrophosphorylase;
          Provisional.
          Length = 273

 Score = 30.4 bits (69), Expect = 0.82
 Identities = 10/32 (31%), Positives = 18/32 (56%)

Query: 16 TEGKLAKWIKQEGDKISPGDILCEIETDKAIM 47
            G    +  ++G++   GDIL EIE D +++
Sbjct: 55 MTGIECVFTIKDGERFKKGDILMEIEGDFSML 86


>gnl|CDD|129622 TIGR00531, BCCP, acetyl-CoA carboxylase, biotin carboxyl carrier
           protein.  The gene name is accB or fabE.
          Length = 156

 Score = 29.4 bits (66), Expect = 1.8
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 28  GDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
           GDK+  G I+C +E  K + E E+   G + EILV  G
Sbjct: 106 GDKVKKGQIVCIVEAMKLMNEIEAEVAGKVVEILVENG 143


>gnl|CDD|180783 PRK06978, PRK06978, nicotinate-nucleotide pyrophosphorylase;
           Provisional.
          Length = 294

 Score = 28.9 bits (65), Expect = 2.6
 Identities = 9/34 (26%), Positives = 19/34 (55%), Gaps = 4/34 (11%)

Query: 8   MPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIE 41
           M ++ P++       W  +EGD+++    +CE+E
Sbjct: 75  MRAVDPSIE----VTWRYREGDRMTADSTVCELE 104


>gnl|CDD|181304 PRK08225, PRK08225, acetyl-CoA carboxylase biotin carboxyl
          carrier protein subunit; Validated.
          Length = 70

 Score = 28.6 bits (64), Expect = 3.2
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 16 TEGKLAKWIKQEGDKISPGDILCEIE 41
            G + K   QEGD ++ GD+L EIE
Sbjct: 45 EAGTVKKINVQEGDFVNEGDVLLEIE 70


>gnl|CDD|183835 PRK12999, PRK12999, pyruvate carboxylase; Reviewed.
          Length = 1146

 Score = 28.6 bits (65), Expect = 3.4
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 10/54 (18%)

Query: 18   GKLAKWIKQEGDKISPGDILCEIETDKAIMEFES-----VDEGIIDEILVPAGT 66
            G +   + +EGD++  GD L  IE     M+ E+     VD G +  +LV AG 
Sbjct: 1085 GSVVTVLVKEGDEVKAGDPLAVIE----AMKMETTITAPVD-GTVKRVLVKAGD 1133


>gnl|CDD|172536 PRK14042, PRK14042, pyruvate carboxylase subunit B; Provisional.
          Length = 596

 Score = 28.1 bits (62), Expect = 3.9
 Identities = 12/41 (29%), Positives = 24/41 (58%)

Query: 1   MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIE 41
           ++I  + M +       G +A+ + Q+GDK++PG +L  +E
Sbjct: 554 LVIEAMKMETEIKAPANGVVAEILCQKGDKVTPGQVLIRVE 594


>gnl|CDD|162114 TIGR00928, purB, adenylosuccinate lyase.  This family consists of
           adenylosuccinate lyase, the enzyme that catalyzes step 8
           in the purine biosynthesis pathway for de novo synthesis
           of IMP and also the final reaction in the two-step
           sequence from IMP to AMP.
          Length = 435

 Score = 28.1 bits (63), Expect = 3.9
 Identities = 13/72 (18%), Positives = 26/72 (36%), Gaps = 3/72 (4%)

Query: 148 RIVKSDIETLIST-KTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVI-PH-DNIRKT 204
            + + D++ ++   K           FG     I    L L  +D+ E+I P    +   
Sbjct: 67  AVTRHDVKAVVYALKEKCGAEGEFIHFGATSNDIVDTALALLLRDALEIILPKLKQLIDR 126

Query: 205 IACRLQQSKQTI 216
           +     + K T+
Sbjct: 127 LKDLAVEYKDTV 138


>gnl|CDD|169947 PRK09534, btuF, corrinoid ABC transporter substrate-binding
           protein; Reviewed.
          Length = 359

 Score = 28.0 bits (62), Expect = 4.5
 Identities = 25/100 (25%), Positives = 41/100 (41%), Gaps = 22/100 (22%)

Query: 57  IDEILVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHS 116
           I  ++  AG  N+A ++               P LS+E IV+   +      V+V    S
Sbjct: 216 IGALIEAAGGHNVAADA----------TTDGYPQLSEEVIVQQDPD------VIVVATAS 259

Query: 117 KNRPIASPLARRLAGEHG----IDLSSLSGSGPHGRIVKS 152
                  P A   AGE G    ++++ ++   P  RIV+S
Sbjct: 260 ALVAETEPYASTTAGETGNVVTVNVNHINQPAP--RIVES 297


>gnl|CDD|150733 pfam10093, DUF2331, Uncharacterized protein conserved in bacteria
           (DUF2331).  Members of this family of hypothetical
           bacterial proteins have no known function.
          Length = 373

 Score = 28.0 bits (63), Expect = 4.8
 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 7/24 (29%)

Query: 125 LARRLAGEHGI-------DLSSLS 141
           LAR+LA EHG        DLS+ +
Sbjct: 20  LARQLAAEHGHQVRLWVDDLSAFA 43


>gnl|CDD|180868 PRK07188, PRK07188, nicotinate phosphoribosyltransferase;
           Provisional.
          Length = 352

 Score = 28.0 bits (63), Expect = 5.4
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 5/47 (10%)

Query: 27  EGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNS 73
           +GD I+P + + EIE       F    EGIID IL  A   ++A N+
Sbjct: 79  DGDIINPFETVLEIEGPYENFGFL---EGIIDGIL--ARRTSVATNA 120


>gnl|CDD|181624 PRK09050, PRK09050, beta-ketoadipyl CoA thiolase; Validated.
          Length = 401

 Score = 27.6 bits (62), Expect = 6.4
 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 10/62 (16%)

Query: 291 VAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLG 350
           V V+IP     P++   D+    + +LE   LA      KLKP     GT +  N    G
Sbjct: 206 VPVTIPQKKGDPVVVDRDEHPRPETTLE--ALA------KLKPVFRPDGTVTAGNAS--G 255

Query: 351 IN 352
           +N
Sbjct: 256 VN 257


>gnl|CDD|179776 PRK04192, PRK04192, V-type ATP synthase subunit A; Provisional.
          Length = 586

 Score = 27.1 bits (61), Expect = 9.3
 Identities = 21/83 (25%), Positives = 32/83 (38%), Gaps = 30/83 (36%)

Query: 6   ITMPSLSPTMTEGKLAKW----IKQEGDKISPGDILCEIETDKAIMEFESVD-------- 53
           + +P+L          KW      + GDK+  GDIL  ++      E  S++        
Sbjct: 107 VYVPALDRE------KKWEFTPTVKVGDKVEAGDILGTVQ------ETPSIEHKIMVPPG 154

Query: 54  -EGIIDEILVPAGT----ENIAV 71
             G + EI V  G     + IAV
Sbjct: 155 VSGTVKEI-VSEGDYTVDDTIAV 176


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.316    0.132    0.368 

Gapped
Lambda     K      H
   0.267   0.0638    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 6,821,172
Number of extensions: 441739
Number of successful extensions: 1051
Number of sequences better than 10.0: 1
Number of HSP's gapped: 994
Number of HSP's successfully gapped: 68
Length of query: 423
Length of database: 5,994,473
Length adjustment: 96
Effective length of query: 327
Effective length of database: 3,920,105
Effective search space: 1281874335
Effective search space used: 1281874335
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 58 (26.3 bits)