RPSBLAST alignment of GI: 254780674 and protein with PDBid: 1gjx

>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Length = 81
 Score = 66.7 bits (163), Expect = 9e-12
 Identities = 19/78 (24%), Positives = 35/78 (44%), Gaps = 2/78 (2%)

Query: 6  ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
          + +P +        +       GD I+  D L  +ETDKA M+  +   G++ E+ V  G
Sbjct: 5  LKVPDI-GGHENVDIIAVEVNVGDTIAVDDTLITLETDKATMDVPAEVAGVVKEVKVKVG 63

Query: 66 TENIAVNSPILNILMDST 83
           + I+    I+ +  + T
Sbjct: 64 -DKISEGGLIVVVEAEGT 80