RPSBLAST alignment of GI: 254780674 and protein with PDBid: 1iyu

>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Length = 79
 Score = 68.6 bits (168), Expect = 2e-12
 Identities = 17/74 (22%), Positives = 34/74 (45%), Gaps = 4/74 (5%)

Query: 5  TITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPA 64
           I +P +     +G++ + + + GD I     L  +E+ KA ME  S   G++  + V  
Sbjct: 3  IIRVPDI---GGDGEVIELLVKTGDLIEVEQGLVVLESAKASMEVPSPKAGVVKSVSVKL 59

Query: 65 GTENIAVNSPILNI 78
          G + +     I+ +
Sbjct: 60 G-DKLKEGDAIIEL 72