RPSBLAST alignment of GI: 254780674 and protein with PDBid: 1w85

>1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* Length = 49
 Score = 66.5 bits (163), Expect = 1e-11
 Identities = 16/44 (36%), Positives = 27/44 (61%)

Query: 116 SKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLIS 159
              R IA P  R+ A E G+D+  + G+G +GR++K DI+  ++
Sbjct: 3   PNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLA 46