RPSBLAST alignment of GI: 254780674 and protein with PDBid: 3l60

>3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} Length = 250
 Score =  213 bits (543), Expect = 6e-56
 Identities = 57/234 (24%), Positives = 110/234 (47%), Gaps = 12/234 (5%)

Query: 194 EVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKIS 253
           +V P   +   +A ++  S + IP    S++     LL LR++            + +I+
Sbjct: 15  DVRPVHGVHARMAEKMTLSHKEIPTAKASVEVICAELLRLRDRFV--------SAAPEIT 66

Query: 254 VNDIILKAFALAMIQVPEANVSWTT----NAMIRHKHIDISVAVSIPGGIVTPIIRQADQ 309
              + L+   +A+      N +W        +  H+ + +    +   G++ P++  A  
Sbjct: 67  PFALTLRLLVIALKHNVILNSTWVDSGEGPQVHVHRGVHLGFGAATERGLLVPVVTDAQD 126

Query: 310 KSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIG 369
           K+  +++  V +L   A++  L P E +G T ++SN G LG++    VIN P++ IL +G
Sbjct: 127 KNTRELASRVAELITGAREGTLTPAELRGSTFTVSNFGALGVDDGVPVINHPEAAILGLG 186

Query: 370 AGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM 423
           A + + V    E+     M  T   DHR VDGA  ++ + + ++ IE+P   L+
Sbjct: 187 AIKPRPVVVGGEVVARPTMTLTCVFDHRVVDGAQVAQFMCELRDLIESPETALL 240