RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780677|ref|YP_003065090.1| hypothetical protein CLIBASIA_02820 [Candidatus Liberibacter asiaticus str. psy62] (152 letters) >gnl|CDD|182678 PRK10724, PRK10724, hypothetical protein; Provisional. Length = 158 Score = 68.4 bits (167), Expect = 7e-13 Identities = 34/139 (24%), Positives = 73/139 (52%), Gaps = 5/139 (3%) Query: 9 IVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYACMQREFMT 68 +V +S++QM LV+D++ YP+F+P C + E + + A++ ++ A + + F T Sbjct: 22 LVPYSAEQMYQLVNDVQSYPQFLPGCTGSRVLES---TPGQ-MTAAVDVSKAGISKTFTT 77 Query: 69 QVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLFDMMLKAIF 128 + ++ + I ++ + F L W F +S+ C++ F + +E N+L ++ +F Sbjct: 78 RNQLTSNQS-ILMQLVDGPFKKLIGGWKFTPLSQEACRIEFHLDFEFTNKLIELAFGRVF 136 Query: 129 DPSFLSFAKAFEERAHKIY 147 + +AF RA ++Y Sbjct: 137 KELASNMVQAFTVRAKEVY 155 >gnl|CDD|181887 PRK09472, ftsA, cell division protein FtsA; Reviewed. Length = 420 Score = 27.1 bits (60), Expect = 2.2 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 15/73 (20%) Query: 15 QQMLSLVSDIE-RYPEFVPLCKKVVIHERDNYGENEV---LVASMTIN---------YAC 61 +Q L+ V IE RY E + L + ++ ++ + V L A + + AC Sbjct: 290 RQTLAEV--IEPRYTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVLTGGAAQIEGLAAC 347 Query: 62 MQREFMTQVRINQ 74 QR F TQVRI Sbjct: 348 AQRVFHTQVRIGA 360 >gnl|CDD|129363 TIGR00261, traB, pheromone shutdown-related protein TraB. traB is a plasmid encoded gene that functions in the shutdown of the peptide sex pheromone cPD1 which is produced by the plasmid free recipient cell prior to conjugative transfer in Enterococcus faecalis. Once the recipient acquires the plasmid, production of cPD1 is shut down. The gene product may play another role in the other species in the family. Length = 380 Score = 26.0 bits (57), Expect = 4.8 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Query: 15 QQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTIN 58 Q LS + ++ + P KKV+I ERD + N++L N Sbjct: 155 QDALSKI--MKELSKISPKVKKVLIDERDEFMANKLLEGEGNKN 196 >gnl|CDD|162140 TIGR00970, leuA_yeast, 2-isopropylmalate synthase, yeast type. A larger family of homologous proteins includes homocitrate synthase, distinct lineages of 2-isopropylmalate synthase, several distinct, uncharacterized, orthologous sets in the Archaea, and other related enzymes. This model describes a family of 2-isopropylmalate synthases as found in yeasts and in a minority of studied bacteria. Length = 564 Score = 25.6 bits (56), Expect = 5.1 Identities = 11/32 (34%), Positives = 17/32 (53%) Query: 22 SDIERYPEFVPLCKKVVIHERDNYGENEVLVA 53 S+++ V C K+ +HER YG + V A Sbjct: 301 SNLDEIRRTVEYCNKIPVHERHPYGGDLVYTA 332 >gnl|CDD|132063 TIGR03018, pepcterm_TyrKin, exopolysaccharide/PEPCTERM locus tyrosine autokinase. Members of this protein family are related to a known protein-tyrosine autokinase and to numerous homologs from exopolysaccharide biosynthesis region proteins, many of which are designated as chain length determinants. Most members of this family contain a short region, immediately C-terminal to the region modeled here, with an abundance of Tyr residues. These C-terminal tyrosine residues are likely to be autophosphorylation sites. Some members of this family are fusion proteins. Length = 207 Score = 25.0 bits (55), Expect = 7.7 Identities = 8/18 (44%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Query: 13 SSQQMLSLVSDI-ERYPE 29 +SQ+M SL+ ++ RYP+ Sbjct: 132 ASQRMRSLLHELARRYPD 149 >gnl|CDD|119007 pfam10487, Nup188, Nucleoporin subcomplex protein binding to Pom34. This is one of the many peptides that make up the nucleoporin complex (NPC), and is found across eukaryotes. The Nup188 subcomplex (Nic96p-Nup188p-Nup192p-Pom152p) is one of at least six that make up the NPC, and as such is symmetrically localized on both faces of the NPC at the nuclear end, being integrally bound to the C-terminus of Pom34p. Length = 931 Score = 24.8 bits (54), Expect = 8.8 Identities = 8/30 (26%), Positives = 13/30 (43%) Query: 1 MYHFTADRIVNHSSQQMLSLVSDIERYPEF 30 Y ++N SS +++ L S YP Sbjct: 455 DYDHKPPDVINDSSTELIRLQSPKLVYPPL 484 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.326 0.136 0.409 Gapped Lambda K H 0.267 0.0735 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,477,128 Number of extensions: 144696 Number of successful extensions: 353 Number of sequences better than 10.0: 1 Number of HSP's gapped: 352 Number of HSP's successfully gapped: 12 Length of query: 152 Length of database: 5,994,473 Length adjustment: 85 Effective length of query: 67 Effective length of database: 4,157,793 Effective search space: 278572131 Effective search space used: 278572131 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 53 (24.2 bits)