Query gi|254780678|ref|YP_003065091.1| hypothetical protein CLIBASIA_02825 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 108 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Sun May 29 21:39:56 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780678.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR02400 trehalose_OtsA alpha 62.6 2.2 5.6E-05 22.5 0.1 13 35-47 167-180 (476) 2 TIGR01472 gmd GDP-mannose 4,6- 42.7 6.8 0.00017 20.1 -0.0 10 78-87 184-193 (365) 3 TIGR01624 LRP1_Cterm LRP1 C-te 29.6 13 0.00032 18.8 -0.4 41 45-85 6-48 (50) 4 PRK10117 trehalose-6-phosphate 23.3 34 0.00087 16.7 0.9 21 26-47 142-162 (474) 5 COG0380 OtsA Trehalose-6-phosp 22.1 35 0.00089 16.6 0.7 20 26-46 166-185 (486) 6 cd03788 GT1_TPS Trehalose-6-Ph 22.1 37 0.00096 16.5 0.9 20 26-46 150-169 (460) 7 pfam00982 Glyco_transf_20 Glyc 20.8 41 0.0011 16.2 0.9 19 26-45 157-175 (470) 8 cd01910 Wali7 This domain is p 20.3 14 0.00035 18.6 -1.6 22 73-108 72-93 (224) 9 pfam05142 DUF702 Domain of unk 20.1 24 0.00062 17.4 -0.4 50 40-89 104-154 (155) 10 pfam11944 DUF3461 Protein of u 20.0 33 0.00083 16.8 0.2 27 78-106 37-66 (125) No 1 >TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming]; InterPro: IPR012766 This enzyme catalyzes the key, penultimate step in biosynthesis of trehalose, a compatible solute made as an osmoprotectant in some species in all three domains of life. The gene symbol OtsA stands for osmotically regulated trehalose synthesis A. Trehalose helps protect against both osmotic and thermal stresses, and is made from two glucose subunits. This entry excludes glucosylglycerol-phosphate synthase, an enzyme of an analogous osmoprotectant system in many cyanobacterial strains. This entry does not identify archaeal examples, as they are more divergent than glucosylglycerol-phosphate synthase. Sequences that score in the gray zone between the trusted and noise cut offs include a number of yeast multidomain proteins in which the N-terminal domain may be functionally equivalent to this family. The gray zone also includes the OtsA of Cornyebacterium glutamicum (and related species), shown to be responsible for synthesis of only trace amounts of trehalose while the majority is synthesized by the TreYZ pathway; the significance of OtsA in this species is unclear (see ).; GO: 0003825 alphaalpha-trehalose-phosphate synthase (UDP-forming) activity, 0005992 trehalose biosynthetic process. Probab=62.58 E-value=2.2 Score=22.52 Aligned_cols=13 Identities=62% Similarity=1.101 Sum_probs=9.5 Q ss_pred EE-EHHHCCCHHHH Q ss_conf 21-02217602332 Q gi|254780678|r 35 KI-LFNHIPFPLRT 47 (108) Q Consensus 35 ki-lfnhipfplrt 47 (108) || .|+|||||-.- T Consensus 167 ~iGFFLHiPfPS~e 180 (476) T TIGR02400 167 KIGFFLHIPFPSSE 180 (476) T ss_pred EEEEECCCCCCCHH T ss_conf 00104178998579 No 2 >TIGR01472 gmd GDP-mannose 4,6-dehydratase; InterPro: IPR006368 This family represent GDP-mannose 4,6-dehydratase, also known as GDP-D-mannose dehydratase. This enzyme converts GDP-mannose to GDP-4-dehydro-6-deoxy-D-mannose, the first of three steps for the conversion of GDP-mannose to GDP-fucose in animals, plants, and bacteria. In bacteria, GDP-L-fucose acts as a precursor of surface antigens such as the extracellular polysaccharide colanic acid of Escherichia coli. Excluded from this family are members of the clade that are poorly related because of highly dervied (phylogenetically long-branch) sequences, e.g. Aneurinibacillus thermoaerophilus Gmd, described as a bifunctional GDP-mannose 4,6-dehydratase/GDP-6-deoxy-D-lyxo-4-hexulose reductase .; GO: 0008446 GDP-mannose 46-dehydratase activity, 0019673 GDP-mannose metabolic process, 0005622 intracellular. Probab=42.71 E-value=6.8 Score=20.10 Aligned_cols=10 Identities=60% Similarity=1.085 Sum_probs=6.7 Q ss_pred HHHHHHCCCC Q ss_conf 0111114665 Q gi|254780678|r 78 FKGILFNHSK 87 (108) Q Consensus 78 fkgilfnhsk 87 (108) -.||||||.- T Consensus 184 ~nGILFNHES 193 (365) T TIGR01472 184 VNGILFNHES 193 (365) T ss_pred HCCEEECCCC T ss_conf 0352104678 No 3 >TIGR01624 LRP1_Cterm LRP1 C-terminal domain; InterPro: IPR006511 These sequences contain a tightly conserved small domain found in LRP1 and related plant proteins. This family also contains a well-conserved adjacent N-terminal putative zinc finger domain (IPR006510 from INTERPRO). The remaining sequence is highly divergent, and of low-complexity. . Probab=29.55 E-value=13 Score=18.80 Aligned_cols=41 Identities=22% Similarity=0.320 Sum_probs=23.3 Q ss_pred HHHEEEEEEEEEEEEECCCC--EEEEHHHHHHHHHHHHHHHCC Q ss_conf 33202444677542111500--021012101222001111146 Q gi|254780678|r 45 LRTAILALRITLTSISFSPI--KLYTRALSFKYCVFKGILFNH 85 (108) Q Consensus 45 lrtailalritltsisfspi--klytralsfkycvfkgilfnh 85 (108) ++.+-+=-++-.|+|+=..- --|--....-=-||||||++. T Consensus 6 v~a~A~Fkcvrv~a~~dg~~~~yaYQatV~I~GHvFkG~Ly~q 48 (50) T TIGR01624 6 VSAAAVFKCVRVTAIDDGEEDEYAYQATVKIGGHVFKGFLYDQ 48 (50) T ss_pred CCCCCCEEEEEEEEEECCCCCCEEEEEEEEECCEEEEEEEECC T ss_conf 1214210246765655798872355547740635764143037 No 4 >PRK10117 trehalose-6-phosphate synthase; Provisional Probab=23.33 E-value=34 Score=16.66 Aligned_cols=21 Identities=52% Similarity=0.871 Sum_probs=13.0 Q ss_pred HHHCCCCCCEEEHHHCCCHHHH Q ss_conf 5421543402102217602332 Q gi|254780678|r 26 RKRGKHNDRKILFNHIPFPLRT 47 (108) Q Consensus 26 rkrgkhndrkilfnhipfplrt 47 (108) |++|.. .+--.|-|||||-.. T Consensus 142 R~~~~~-~~IgfFlHiPFPs~e 162 (474) T PRK10117 142 RKRGVN-NRIGFFLHIPFPTPE 162 (474) T ss_pred HHHCCC-CCEEEEECCCCCCHH T ss_conf 961899-827988568999979 No 5 >COG0380 OtsA Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism] Probab=22.13 E-value=35 Score=16.60 Aligned_cols=20 Identities=40% Similarity=0.627 Sum_probs=12.5 Q ss_pred HHHCCCCCCEEEHHHCCCHHH Q ss_conf 542154340210221760233 Q gi|254780678|r 26 RKRGKHNDRKILFNHIPFPLR 46 (108) Q Consensus 26 rkrgkhndrkilfnhipfplr 46 (108) |+++-.+ +-..|.|||||-. T Consensus 166 R~~~~~~-~IgfFlHiPfPss 185 (486) T COG0380 166 RERIPDA-KIGFFLHIPFPSS 185 (486) T ss_pred HHHCCCC-EEEEEEECCCCCH T ss_conf 9748876-5898896799998 No 6 >cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain. Probab=22.07 E-value=37 Score=16.45 Aligned_cols=20 Identities=50% Similarity=0.874 Sum_probs=11.5 Q ss_pred HHHCCCCCCEEEHHHCCCHHH Q ss_conf 542154340210221760233 Q gi|254780678|r 26 RKRGKHNDRKILFNHIPFPLR 46 (108) Q Consensus 26 rkrgkhndrkilfnhipfplr 46 (108) |+++. +.+--.|-|||||-. T Consensus 150 R~~~~-~~~igfFlHiPFPs~ 169 (460) T cd03788 150 RERGP-DARIGFFLHIPFPSS 169 (460) T ss_pred HHHCC-CCEEEEEECCCCCCH T ss_conf 98589-984898870799998 No 7 >pfam00982 Glyco_transf_20 Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,. Probab=20.84 E-value=41 Score=16.25 Aligned_cols=19 Identities=47% Similarity=0.700 Sum_probs=11.5 Q ss_pred HHHCCCCCCEEEHHHCCCHH Q ss_conf 54215434021022176023 Q gi|254780678|r 26 RKRGKHNDRKILFNHIPFPL 45 (108) Q Consensus 26 rkrgkhndrkilfnhipfpl 45 (108) |+++.. .+--.|-|||||- T Consensus 157 R~~~~~-~~IgfFlHiPFPs 175 (470) T pfam00982 157 RKRLPD-AKIGFFLHIPFPS 175 (470) T ss_pred HHHCCC-CEEEEEECCCCCC T ss_conf 984899-8389886189999 No 8 >cd01910 Wali7 This domain is present in Wali7, a protein of unknown function, expressed in wheat and induced by aluminum. Wali7 has a single domain similar to the glutamine amidotransferase domain of glucosamine-fructose 6-phosphate synthase (GLMS or GFAT), glutamine phosphoribosylpyrophosphate (Prpp) amidotransferase (GPATase), asparagine synthetase B (AsnB), beta lactam synthetase (beta-LS) and glutamate synthase (GltS). The Wali7 domain is also somewhat similar to the Ntn hydrolase fold of the proteasomal alph and beta subunits. Probab=20.27 E-value=14 Score=18.58 Aligned_cols=22 Identities=41% Similarity=0.759 Sum_probs=15.0 Q ss_pred HHHHHHHHHHHCCCCCCCEECCHHCCCCCCCCCCCC Q ss_conf 122200111114665585342011048886110159 Q gi|254780678|r 73 FKYCVFKGILFNHSKKHPFIFPRLQNIPSGRTQYAL 108 (108) Q Consensus 73 fkycvfkgilfnhskkhpfifprlqnipsgrtqyal 108 (108) =-||+|.|. |.|+++-+.||.| T Consensus 72 dIfClF~G~--------------LdNl~~L~qqYGL 93 (224) T cd01910 72 DIFCLFQGH--------------LDNLGSLKQQYGL 93 (224) T ss_pred CEEEEEECC--------------HHHHHHHHHHHCC T ss_conf 879998663--------------3338889998673 No 9 >pfam05142 DUF702 Domain of unknown function (DUF702). Members of this family are found in various putative zinc finger proteins. Probab=20.10 E-value=24 Score=17.38 Aligned_cols=50 Identities=20% Similarity=0.356 Sum_probs=31.1 Q ss_pred HCCCHHHHEEEEEEEEEEEEECC-CCEEEEHHHHHHHHHHHHHHHCCCCCC Q ss_conf 17602332024446775421115-000210121012220011111466558 Q gi|254780678|r 40 HIPFPLRTAILALRITLTSISFS-PIKLYTRALSFKYCVFKGILFNHSKKH 89 (108) Q Consensus 40 hipfplrtailalritltsisfs-piklytralsfkycvfkgilfnhskkh 89 (108) +.|--++..-+--.+-+++|.-. .---|--+.+.---||||||+.+.-.| T Consensus 104 ~fP~eV~s~AvFRCVRVs~idd~e~e~AYQt~V~IgGHvFKGiLYDqGpe~ 154 (155) T pfam05142 104 SFPPEVSSPAVFRCVRVSSVDDGDAEYAYQTTVNIGGHVFKGILYDQGPEH 154 (155) T ss_pred CCCHHHCCCCEEEEEEEECCCCCCCCEEEEEEEEECCEEEEEEEECCCCCC T ss_conf 397122761158899873246875526778878788658605750457777 No 10 >pfam11944 DUF3461 Protein of unknown function (DUF3461). This family of proteins are functionally uncharacterized. This protein is found in bacteria. Proteins in this family are about 130 amino acids in length. This protein has two conserved sequence motifs: KFK and HLE. Probab=19.96 E-value=33 Score=16.75 Aligned_cols=27 Identities=48% Similarity=0.694 Sum_probs=18.5 Q ss_pred HHHHHHCCCCCCCEECCHHCCCC---CCCCCC Q ss_conf 01111146655853420110488---861101 Q gi|254780678|r 78 FKGILFNHSKKHPFIFPRLQNIP---SGRTQY 106 (108) Q Consensus 78 fkgilfnhskkhpfifprlqnip---sgrtqy 106 (108) -||-+|..|.| |.|||-+..- ||..+| T Consensus 37 ~kGe~faKSvK--FKypRq~K~V~~d~g~~~y 66 (125) T pfam11944 37 EKGDLFAKSVK--FKFPRQRKTVLVDSGSQSY 66 (125) T ss_pred CCCHHHHHHHC--CCCCCCCEEEEECCCCCCC T ss_conf 65505454001--0056632068864898650 Done!