RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780678|ref|YP_003065091.1| hypothetical protein CLIBASIA_02825 [Candidatus Liberibacter asiaticus str. psy62] (108 letters) >gnl|CDD|185412 PTZ00046, PTZ00046, rifin; Provisional. Length = 358 Score = 29.1 bits (66), Expect = 0.26 Identities = 7/24 (29%), Positives = 9/24 (37%) Query: 81 ILFNHSKKHPFIFPRLQNIPSGRT 104 IL + K HP P + R Sbjct: 17 ILVYNQKNHPSTTPHTTTTTTTRL 40 >gnl|CDD|129146 TIGR00035, asp_race, aspartate racemase. Length = 229 Score = 28.2 bits (63), Expect = 0.51 Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 24 THRKRGKHNDRKILFNHIPFPLRTA 48 T KR + + ++LFN+ P RTA Sbjct: 26 TKAKRDQEHPAEVLFNNPNIPDRTA 50 >gnl|CDD|184692 PRK14466, PRK14466, ribosomal RNA large subunit methyltransferase N; Provisional. Length = 345 Score = 26.3 bits (58), Expect = 1.8 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 2/21 (9%) Query: 69 RALSFKYCVFKGILFNHSKKH 89 R +SF+Y VFKG N S KH Sbjct: 249 RRVSFEYIVFKG--LNDSLKH 267 >gnl|CDD|180138 PRK05573, rplU, 50S ribosomal protein L21; Validated. Length = 103 Score = 26.2 bits (59), Expect = 2.1 Identities = 6/11 (54%), Positives = 9/11 (81%) Query: 19 KRKKNTHRKRG 29 KR+KN +K+G Sbjct: 78 KRRKNYRKKQG 88 >gnl|CDD|182249 PRK10117, PRK10117, trehalose-6-phosphate synthase; Provisional. Length = 474 Score = 25.9 bits (57), Expect = 2.2 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Query: 26 RKRGKHNDRKILFNHIPFP 44 RKRG N+R F HIPFP Sbjct: 142 RKRGV-NNRIGFFLHIPFP 159 >gnl|CDD|183019 PRK11179, PRK11179, DNA-binding transcriptional regulator AsnC; Provisional. Length = 153 Score = 25.8 bits (57), Expect = 2.3 Identities = 12/47 (25%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Query: 54 ITLTSISFSPIKLYTRALSFKYCVFKGILFNHSKKHPFIFPRLQNIP 100 IT T + +P + L + C F GI+ +K +P +L+++ Sbjct: 53 ITGTRVDVNP-----KQLGYDVCCFIGIILKSAKDYPSALAKLESLD 94 >gnl|CDD|184712 PRK14501, PRK14501, putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional. Length = 726 Score = 25.7 bits (57), Expect = 3.0 Identities = 9/18 (50%), Positives = 11/18 (61%), Gaps = 1/18 (5%) Query: 28 RGKHNDRKI-LFNHIPFP 44 R + D +I F HIPFP Sbjct: 152 RERLPDARIGFFLHIPFP 169 >gnl|CDD|182106 PRK09841, PRK09841, cryptic autophosphorylating protein tyrosine kinase Etk; Provisional. Length = 726 Score = 25.6 bits (56), Expect = 3.3 Identities = 14/43 (32%), Positives = 23/43 (53%) Query: 20 RKKNTHRKRGKHNDRKILFNHIPFPLRTAILALRITLTSISFS 62 RKKN + +H + I F + P +A+ A+R TS+ F+ Sbjct: 483 RKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFA 525 >gnl|CDD|130225 TIGR01157, pufL, photosynthetic reaction center L subunit. This model describes the photosynthetic reaction center L subunit in non-oxygenic photosynthetic bacteria. Reaction center is an integral membrane pigment-protein that carries out light-driven electron transfer reactions. At the core of reaction center is a collection light-harvesting cofactors and closely associated polypeptides. The core protein complex is made of L, M and H subunits. The common cofactors include bacterichlorophyll, bacteriopheophytins, ubiquinone and no-heme ferrous iron. The net result of electron tranfer reactions is the establishment of proton electrochemical gradient and production of reducing equivalents in form of NADH. Ultimately the process results in the reduction of C02 to carbohydrates(C6H12O6) In non-oxygenic organisms, the electron donor is some organic acid and not water. Much of our current functional understanding of photosynthesis comes from the structural determination, spectroscopic studies and mutational analysis on the reaction center of Rhodobacter sphaeroides. Length = 239 Score = 25.1 bits (55), Expect = 4.2 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Query: 40 HIPFPLRTAILALRITLTSISFSPIKLYTRALSFKYCVF 78 HIPF AILA LT + P+ + +F Y ++ Sbjct: 83 HIPFAFSFAILAY---LTLVVIRPVMMGAWGYAFPYGIW 118 >gnl|CDD|180158 PRK05601, PRK05601, DNA polymerase III subunit epsilon; Validated. Length = 377 Score = 24.8 bits (54), Expect = 4.7 Identities = 9/26 (34%), Positives = 13/26 (50%) Query: 20 RKKNTHRKRGKHNDRKILFNHIPFPL 45 R +N +RG R+ HIP P+ Sbjct: 156 RNRNRGNRRGGRGRRRQRVGHIPKPV 181 >gnl|CDD|162840 TIGR02400, trehalose_OtsA, alpha,alpha-trehalose-phosphate synthase [UDP-forming]. This enzyme catalyzes the key, penultimate step in biosynthesis of trehalose, a compatible solute made as an osmoprotectant in some species in all three domains of life. The gene symbol OtsA stands for osmotically regulated trehalose synthesis A. Trehalose helps protect against both osmotic and thermal stresses, and is made from two glucose subunits. This model excludes glucosylglycerol-phosphate synthase, an enzyme of an analogous osmoprotectant system in many cyanobacterial strains. This model does not identify archaeal examples, as they are more divergent than glucosylglycerol-phosphate synthase. Sequences that score in the gray zone between the trusted and noise cutoffs include a number of yeast multidomain proteins in which the N-terminal domain may be functionally equivalent to this family. The gray zone also includes the OtsA of Cornyebacterium glutamicum (and related species), shown to be responsible for synthesis of only trace amounts of trehalose while the majority is synthesized by the TreYZ pathway; the significance of OtsA in this species is unclear (see Wolf, et al., PubMed:12890033). Length = 456 Score = 24.2 bits (53), Expect = 9.1 Identities = 6/7 (85%), Positives = 6/7 (85%) Query: 38 FNHIPFP 44 F HIPFP Sbjct: 157 FLHIPFP 163 >gnl|CDD|180994 PRK07480, PRK07480, putative aminotransferase; Validated. Length = 456 Score = 24.1 bits (53), Expect = 9.5 Identities = 7/10 (70%), Positives = 9/10 (90%) Query: 1 MISAPPLLIT 10 MI +PPL+IT Sbjct: 422 MIISPPLVIT 431 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.327 0.142 0.427 Gapped Lambda K H 0.267 0.0749 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,746,831 Number of extensions: 96038 Number of successful extensions: 220 Number of sequences better than 10.0: 1 Number of HSP's gapped: 220 Number of HSP's successfully gapped: 25 Length of query: 108 Length of database: 5,994,473 Length adjustment: 74 Effective length of query: 34 Effective length of database: 4,395,481 Effective search space: 149446354 Effective search space used: 149446354 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.0 bits)