BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780679|ref|YP_003065092.1| hypothetical protein CLIBASIA_02830 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254780679|ref|YP_003065092.1| hypothetical protein CLIBASIA_02830 [Candidatus Liberibacter asiaticus str. psy62] gi|254040356|gb|ACT57152.1| hypothetical protein CLIBASIA_02830 [Candidatus Liberibacter asiaticus str. psy62] Length = 129 Score = 238 bits (608), Expect = 1e-61, Method: Composition-based stats. Identities = 129/129 (100%), Positives = 129/129 (100%) Query: 1 MSYLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKHNTASFHRA 60 MSYLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKHNTASFHRA Sbjct: 1 MSYLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKHNTASFHRA 60 Query: 61 SLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLREKKQPQRKPITKQKKNPIPLASRS 120 SLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLREKKQPQRKPITKQKKNPIPLASRS Sbjct: 61 SLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLREKKQPQRKPITKQKKNPIPLASRS 120 Query: 121 NPMQNNNDR 129 NPMQNNNDR Sbjct: 121 NPMQNNNDR 129 >gi|315122210|ref|YP_004062699.1| hypothetical protein CKC_02300 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495612|gb|ADR52211.1| hypothetical protein CKC_02300 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 99 Score = 49.3 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 39/100 (39%), Positives = 55/100 (55%), Gaps = 3/100 (3%) Query: 1 MSYLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKHNTASFHRA 60 M +N FD+LTI++LCII T F LI + + I K FS IY+ + N + Sbjct: 1 MLNVNVFDILTIVVLCIILTLNFHYFWSLIRNPINSYKRIRKAFSEIYKSQRNISPNSST 60 Query: 61 SLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLREKKQ 100 L KKD+ PT+K +S+ +T NK K P INL +K+ Sbjct: 61 PL-KKDLEIKPTRKKQTSK-DTTEENKKKHP-INLAMRKE 97 >gi|153803852|gb|AAW55994.2| DNA polymerase [Myodes glareolus rhadinovirus 1] Length = 749 Score = 38.1 bits (87), Expect = 0.38, Method: Composition-based stats. Identities = 31/110 (28%), Positives = 54/110 (49%), Gaps = 7/110 (6%) Query: 14 LLCIIFTCTFKSIL--HLICSLKYFPRNIYKIFSNIYQQKHNTASFHRASLQKKDIGATP 71 +L + F + SI+ H +C Y P NI ++SN+ + ++T FH +S + P Sbjct: 576 ILVVDFASLYPSIIQAHNLCYSTYIPSNILPLYSNLTPEDYDT--FHLSSGTVHFV--KP 631 Query: 72 TKKGN-SSQLISTNTNKDKKPRINLREKKQPQRKPITKQKKNPIPLASRS 120 KK + S L++ NK K + L P++K I +++N I + S Sbjct: 632 HKKESLLSILLTKWLNKRKSLKNRLATCTDPKQKTILDKQQNAIKVTCNS 681 >gi|124185|sp|P14379|IE68_HHV2 RecName: Full=Immediate-early protein IE4; AltName: Full=IE68 gi|555152|gb|AAA45848.1| immediate early protein 4 [Human herpesvirus 2] Length = 197 Score = 37.4 bits (85), Expect = 0.68, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 5/55 (9%) Query: 80 LISTNTNKDKKPRINLREKKQPQRK-----PITKQKKNPIPLASRSNPMQNNNDR 129 L+ T K K+PRINLR P R+ P + PI A P Q++ DR Sbjct: 111 LVDTPPRKSKRPRINLRLTSSPDRRAGVVFPEVWRSDRPIRAAQPQAPAQSSGDR 165 >gi|149239014|ref|XP_001525383.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] gi|146450876|gb|EDK45132.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] Length = 544 Score = 35.8 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 20/68 (29%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Query: 52 HNTASFHRASLQKKDIGATPTKKGNSSQLISTNTNKDKKP-RINLREKKQPQRKPITKQK 110 H + + R + + D ++ T KG S ++ TN+ K P + N +E Q +RK I++++ Sbjct: 441 HKSTAKSRLAREIHDKPSSMTNKGVSDKVALTNSTKTSLPVKFNDKENLQVRRKIISRKR 500 Query: 111 KNPIPLAS 118 P PL++ Sbjct: 501 LAPKPLSA 508 >gi|19113759|ref|NP_592847.1| chitin synthase regulatory factor Chr3 (predicted) [Schizosaccharomyces pombe 972h-] gi|1351653|sp|Q09897|CHR3_SCHPO RecName: Full=Chitin synthase regulatory factor 3; AltName: Full=Chs four homolog 1 gi|1061298|emb|CAA91775.1| chitin synthase regulatory factor Chr3 (predicted) [Schizosaccharomyces pombe] Length = 932 Score = 35.8 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 29/98 (29%), Positives = 47/98 (47%), Gaps = 12/98 (12%) Query: 32 SLKYFPRNIYKIFSN--IYQQKHNTAS---FHRASLQKKDIGATPT-----KKGNSSQLI 81 +L++ P + Y S+ +Y + +S +RAS+ +G P+ KK S ++ Sbjct: 45 TLQFRPTSRYPTLSHEPVYTNVLDLSSRIDANRASIMSATMGTPPSALKFSKKKISRPVV 104 Query: 82 STNTNKDKKPRINLREKKQPQRKPITKQKKNPIPLASR 119 S +T KDK PR + K +PQ P K P P + R Sbjct: 105 SEDTFKDKLPRATIPVKPEPQ--PQYKIPAAPAPTSKR 140 >gi|156542072|ref|XP_001602204.1| PREDICTED: similar to LOC553328 protein [Nasonia vitripennis] Length = 653 Score = 35.8 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 28/109 (25%), Positives = 51/109 (46%), Gaps = 8/109 (7%) Query: 23 FKSILHLICSLKYFPRNIYKIFSNIYQQKHNTASFHRASLQKKDIGATPTKKGNSSQLIS 82 +K ++HL+ K I K F + K +T + R +++ + A P K+ + + Sbjct: 99 YKRLMHLLSQSKVLSSFIMKKFEPKDKDK-DTKAPKRTGIEEAE-SAVPNKRTRRALKQT 156 Query: 83 TNTNKDK------KPRINLREKKQPQRKPITKQKKNPIPLASRSNPMQN 125 NT+K+K + ++NL KK + +K K+ P SNP+ N Sbjct: 157 ENTDKNKAKSRRGRKKLNLNIKKAEAEELASKCKEEPSGDKENSNPIDN 205 >gi|313214180|emb|CBY42676.1| unnamed protein product [Oikopleura dioica] Length = 649 Score = 35.4 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 16/80 (20%), Positives = 43/80 (53%) Query: 49 QQKHNTASFHRASLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLREKKQPQRKPITK 108 ++++N + ++ + ++ A + G ++ S+ T D +P+IN+++KKQ + Sbjct: 28 EEENNVSDCSEEAISEDEVPAEESSIGGAAPQPSSGTAVDARPQINVQKKKQGWESSGDE 87 Query: 109 QKKNPIPLASRSNPMQNNND 128 +++ P++ +N N N+ Sbjct: 88 DEEDDAPVSEMANLKTNGNE 107 >gi|118396898|ref|XP_001030785.1| hypothetical protein TTHERM_01014390 [Tetrahymena thermophila] gi|89285100|gb|EAR83122.1| hypothetical protein TTHERM_01014390 [Tetrahymena thermophila SB210] Length = 1218 Score = 35.1 bits (79), Expect = 3.0, Method: Composition-based stats. Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Query: 59 RASLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLREKKQPQRKPITKQKKNPIPLAS 118 + +QKKD+ TP KK S+L S ++D + IN K+ K ++ +K NP +S Sbjct: 705 KQQIQKKDLCKTPLKKNRQSKLPS-QKHQDDQSSINKIVSKKSTEKDVSSKKDNPNNQSS 763 Query: 119 RSNPMQNNNDR 129 S N N + Sbjct: 764 ASILTYNKNGK 774 >gi|313221012|emb|CBY31844.1| unnamed protein product [Oikopleura dioica] Length = 222 Score = 35.1 bits (79), Expect = 3.2, Method: Composition-based stats. Identities = 16/80 (20%), Positives = 43/80 (53%) Query: 49 QQKHNTASFHRASLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLREKKQPQRKPITK 108 ++++N + ++ + ++ A + G ++ S+ T D +P+IN+++KKQ + Sbjct: 28 EEENNVSDCSEDAISEDEVQAEESSIGGAAPQPSSGTAVDARPQINVQKKKQGWESSGDE 87 Query: 109 QKKNPIPLASRSNPMQNNND 128 +++ P++ +N N N+ Sbjct: 88 DEEDDAPVSEMANLKTNGNE 107 >gi|291088398|dbj|BAI82451.1| immidiate early protain [Human herpesvirus 2] Length = 414 Score = 35.1 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 5/54 (9%) Query: 80 LISTNTNKDKKPRINLREKKQPQRK-----PITKQKKNPIPLASRSNPMQNNND 128 L+ T K K+PRINLR P R+ P + PI A P Q++ D Sbjct: 111 LVDTPPRKSKRPRINLRLTSSPDRRAGVVFPEVWRNDRPIRAAQPQAPAQSSGD 164 >gi|68490671|ref|XP_710858.1| potential zinc finger protein [Candida albicans SC5314] gi|46432111|gb|EAK91614.1| potential zinc finger protein [Candida albicans SC5314] Length = 476 Score = 35.1 bits (79), Expect = 3.5, Method: Composition-based stats. Identities = 20/82 (24%), Positives = 44/82 (53%), Gaps = 4/82 (4%) Query: 49 QQKHNTASFHRASLQKKDIGATPTKKG--NSSQLISTNTNKDKKPRINLREKKQPQRKPI 106 Q+ H + +HR +L+++ P + NS TNT + K+ ++ +E+++ +++ I Sbjct: 91 QRSHMKSEWHRYNLKRRVAQLPPITEDLFNSKVSTLTNTEETKQKQLTKKEQRRKEKEAI 150 Query: 107 TKQKKNPIPLASRS--NPMQNN 126 +QK+ + A ++ MQ N Sbjct: 151 LEQKRQILEQAKKAMLAKMQEN 172 >gi|213407344|ref|XP_002174443.1| 50S ribosomal protein L1 [Schizosaccharomyces japonicus yFS275] gi|212002490|gb|EEB08150.1| 50S ribosomal protein L1 [Schizosaccharomyces japonicus yFS275] Length = 240 Score = 35.1 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 30/81 (37%), Positives = 39/81 (48%), Gaps = 10/81 (12%) Query: 37 PRNIYKIFSNIYQQKHNTASFHRASLQKKDIGATP--TKKGNSSQLISTNTNKDKKPRIN 94 PRN+ + KH TAS SL K G TP +KG SQ+I + D+K N Sbjct: 146 PRNL------MPSVKHGTASNDIISLVKTFKGTTPFRERKGMISQVIGPQSYSDEKLAAN 199 Query: 95 LREKKQPQRKPITK--QKKNP 113 L+ RK I+K QK+ P Sbjct: 200 LKAILAGIRKCISKMEQKRKP 220 >gi|241948849|ref|XP_002417147.1| conserved hypothetical protein [Candida dubliniensis CD36] gi|223640485|emb|CAX44737.1| conserved hypothetical protein [Candida dubliniensis CD36] Length = 401 Score = 34.7 bits (78), Expect = 4.2, Method: Composition-based stats. Identities = 18/74 (24%), Positives = 41/74 (55%), Gaps = 2/74 (2%) Query: 49 QQKHNTASFHRASLQKKDIGATPTKKG--NSSQLISTNTNKDKKPRINLREKKQPQRKPI 106 Q+ H + +HR +L+++ P + NS TNT + K+ ++ +E+++ +++ I Sbjct: 31 QRSHMKSDWHRYNLKRRVAQLPPITEDLFNSKVSTLTNTEETKQKQLTKKEQRRKEKEAI 90 Query: 107 TKQKKNPIPLASRS 120 +QK+ + A R+ Sbjct: 91 LEQKRQILEQAKRA 104 >gi|84999042|ref|XP_954242.1| sir2-like histone deacetylase [Theileria annulata] gi|65305240|emb|CAI73565.1| sir2-like histone deacetylase, putative [Theileria annulata] Length = 928 Score = 33.9 bits (76), Expect = 6.6, Method: Composition-based stats. Identities = 19/45 (42%), Positives = 22/45 (48%) Query: 82 STNTNKDKKPRINLREKKQPQRKPITKQKKNPIPLASRSNPMQNN 126 +TNT DK N REK+ Q P+TK KK S P NN Sbjct: 79 NTNTKHDKAKDTNCREKQNEQYGPLTKSKKRRKLTDSACIPSMNN 123 >gi|68490646|ref|XP_710870.1| potential zinc finger protein [Candida albicans SC5314] gi|46432125|gb|EAK91627.1| potential zinc finger protein [Candida albicans SC5314] Length = 475 Score = 33.9 bits (76), Expect = 7.3, Method: Composition-based stats. Identities = 17/74 (22%), Positives = 41/74 (55%), Gaps = 2/74 (2%) Query: 49 QQKHNTASFHRASLQKKDIGATPTKKG--NSSQLISTNTNKDKKPRINLREKKQPQRKPI 106 Q+ H + +HR +L+++ P + NS TNT + K+ ++ +E+++ +++ I Sbjct: 91 QRSHMKSEWHRYNLKRRVAQLPPITEDLFNSKVSTLTNTEETKQKQLTKKEQRRKEKEAI 150 Query: 107 TKQKKNPIPLASRS 120 +QK+ + A ++ Sbjct: 151 LEQKRQILEQAKKA 164 >gi|322836633|ref|YP_004209942.1| conjugal transfer protein [Yersinia pestis Java 9] gi|321161166|gb|ADW66875.1| conjugal transfer protein [Yersinia pestis Java 9] Length = 372 Score = 33.9 bits (76), Expect = 7.9, Method: Composition-based stats. Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 1/80 (1%) Query: 42 KIFSNIYQQKHNTASFHRASLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLREKKQP 101 KI+ N Y ++ TAS +A +G T G + ++ T D P+ + P Sbjct: 57 KIYKNFYAEEPQTASTTKADDNASQVGKVRTGMGQNFDPVANETTSDSVPQDAGNKTGSP 116 Query: 102 QRKPITK-QKKNPIPLASRS 120 + T+ QK IP++ +S Sbjct: 117 DKPVATQFQKYLSIPVSGQS 136 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.320 0.132 0.393 Lambda K H 0.267 0.0406 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,186,549,910 Number of Sequences: 14124377 Number of extensions: 44081205 Number of successful extensions: 183333 Number of sequences better than 10.0: 119 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 82 Number of HSP's that attempted gapping in prelim test: 183173 Number of HSP's gapped (non-prelim): 207 length of query: 129 length of database: 4,842,793,630 effective HSP length: 95 effective length of query: 34 effective length of database: 3,500,977,815 effective search space: 119033245710 effective search space used: 119033245710 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 75 (33.5 bits)