RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780679|ref|YP_003065092.1| hypothetical protein CLIBASIA_02830 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) >gnl|CDD|36277 KOG1059, KOG1059, KOG1059, Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport]. Length = 877 Score = 28.0 bits (62), Expect = 0.72 Identities = 17/72 (23%), Positives = 32/72 (44%) Query: 44 FSNIYQQKHNTASFHRASLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLREKKQPQR 103 FS+ +K N + RA + D+ + +K + N +K + +++K + + Sbjct: 798 FSDFEDKKGNPSDEERALDIELDLPLSRLEKNLIVKDEKDNLKDTEKVIVIVKKKSKKKN 857 Query: 104 KPITKQKKNPIP 115 K TK K P P Sbjct: 858 KKKTKAKNVPEP 869 >gnl|CDD|147467 pfam05285, SDA1, SDA1. This family consists of several SDA1 protein homologues. SDA1 is a Saccharomyces cerevisiae protein which is involved in the control of the actin cytoskeleton. The protein is essential for cell viability and is localized in the nucleus. Length = 317 Score = 27.3 bits (61), Expect = 1.2 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 23/56 (41%) Query: 73 KKGNSSQLISTNTNKDKKPRIN-----------------LREKKQPQRKPITKQKK 111 K+G S+ TNK+K + N LR+K++ R I +QKK Sbjct: 266 KEGKST------TNKEKARKKNFMMTLHKKRVRSKQKRSLRDKQKVLRAHILRQKK 315 >gnl|CDD|177241 MTH00193, ND1, NADH dehydrogenase subunit 1; Provisional. Length = 306 Score = 27.0 bits (61), Expect = 1.6 Identities = 8/27 (29%), Positives = 12/27 (44%) Query: 1 MSYLNWFDLLTIMLLCIIFTCTFKSIL 27 + YL W L + L ++F K L Sbjct: 280 LMYLAWKSFLPLSLNYLLFFFGLKIFL 306 >gnl|CDD|38455 KOG3245, KOG3245, KOG3245, Uncharacterized conserved protein [Function unknown]. Length = 106 Score = 26.2 bits (57), Expect = 2.4 Identities = 11/57 (19%), Positives = 19/57 (33%) Query: 59 RASLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLREKKQPQRKPITKQKKNPIP 115 + ++ P +K + SQ + P L E P + K+ P P Sbjct: 17 AWRAARSELLCHPLRKTSKSQGAFQELLRQSLPLPMLPEGDAPHPSHLEKEPLKPWP 73 >gnl|CDD|146621 pfam04086, SRP-alpha_N, Signal recognition particle, alpha subunit, N-terminal. SRP is a complex of six distinct polypeptides and a 7S RNA that is essential for transferring nascent polypeptide chains that are destined for export from the cell to the translocation apparatus of the endoplasmic reticulum (ER) membrane. SRP binds hydrophobic signal sequences as they emerge from the ribosome, and arrests translation. Length = 235 Score = 26.2 bits (58), Expect = 2.5 Identities = 10/32 (31%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 17 IIFTCTFKSILHLICSLKYFPRNIYKIFSNIY 48 ++F ++ ILHL K +I IF ++Y Sbjct: 39 LVFVVVYQKILHLSYIDK-LLDDIRTIFRDLY 69 >gnl|CDD|39135 KOG3932, KOG3932, KOG3932, CDK5 kinase activator p35/Nck5a [Cell cycle control, cell division, chromosome partitioning]. Length = 357 Score = 26.2 bits (57), Expect = 2.6 Identities = 18/100 (18%), Positives = 33/100 (33%), Gaps = 15/100 (15%) Query: 43 IFSNIYQQKHNTASFHRASLQKKDIGATPTKKGNSSQLISTNT---------------NK 87 + + K A + L K + T +SS+ +S +T N Sbjct: 53 VLISALNWKRIVAVSAKKKLPKSGSSSEATSSKSSSKKVSPSTSSQYGKISISLDNNQNL 112 Query: 88 DKKPRINLREKKQPQRKPITKQKKNPIPLASRSNPMQNNN 127 PR + P + ++ P +R +P+ NN Sbjct: 113 KSVPRPSPTTTIIPNYYSLREEVPTGPPANTRQDPVNNNL 152 >gnl|CDD|36688 KOG1475, KOG1475, KOG1475, Ribosomal protein RPL1/RPL2/RL4L4 [RNA processing and modification]. Length = 363 Score = 25.5 bits (55), Expect = 4.4 Identities = 14/68 (20%), Positives = 26/68 (38%), Gaps = 9/68 (13%) Query: 53 NTASFHRASLQKKDIGATPTKKGNSSQLISTNTNKDKKP---------RINLREKKQPQR 103 N+ S +K + G ++L + K P + ++KK+ ++ Sbjct: 293 NSDELQAKSDEKGKVAGKKPVVGKKNKLKNKGVLKRLNPYAKKKAAATKKPAKKKKKAEK 352 Query: 104 KPITKQKK 111 K TK KK Sbjct: 353 KKTTKVKK 360 >gnl|CDD|35427 KOG0206, KOG0206, KOG0206, P-type ATPase [General function prediction only]. Length = 1151 Score = 25.6 bits (56), Expect = 4.6 Identities = 10/55 (18%), Positives = 20/55 (36%), Gaps = 7/55 (12%) Query: 1 MSYLNWFDLLTI---MLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKH 52 SY W + + I +LL +F + + I + P Y + ++ Sbjct: 1001 TSYWTWINHIVIWGSILLWFVFLFIYSELTPAIST----PDPFYGVAEHLLSSPS 1051 >gnl|CDD|177081 CHL00177, ccs1, c-type cytochrome biogenensis protein; Validated. Length = 426 Score = 24.6 bits (54), Expect = 8.0 Identities = 16/84 (19%), Positives = 28/84 (33%), Gaps = 18/84 (21%) Query: 5 NWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKHNTASFHRASLQK 64 WF L ++ + CT + SLK + +Q N F + + Sbjct: 74 WWFLSLLLLFGLSLLLCTLLQ---QLPSLK---------IARRWQFYTNKNQFKKLQIST 121 Query: 65 KDIGATPTKKGNSSQLISTNTNKD 88 KK + S+L +K+ Sbjct: 122 N------LKKFSLSKLAYKLKSKN 139 >gnl|CDD|145714 pfam02705, K_trans, K+ potassium transporter. This is a family of K+ potassium transporters that are conserved across phyla, having both bacterial (KUP), yeast (HAK), and plant (AtKT) sequences as members. Length = 731 Score = 24.6 bits (54), Expect = 8.2 Identities = 8/25 (32%), Positives = 12/25 (48%), Gaps = 4/25 (16%) Query: 5 NWFDLLTIMLLCIIFTCTFKSILHL 29 NW +M+ CI T F+ +L Sbjct: 371 NWL----LMIGCIAVTAGFRDTSNL 391 >gnl|CDD|38768 KOG3560, KOG3560, KOG3560, Aryl-hydrocarbon receptor [Transcription]. Length = 712 Score = 24.7 bits (53), Expect = 8.6 Identities = 10/28 (35%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Query: 102 QRKPITKQKKNPIPLASRSNPMQNNNDR 129 +R+P+ KQ+ P ++SNP + + DR Sbjct: 13 RRRPLQKQRP-PPKALTKSNPSKRHRDR 39 >gnl|CDD|35601 KOG0380, KOG0380, KOG0380, Sterol O-acyltransferase/Diacylglycerol O-acyltransferase [Lipid transport and metabolism]. Length = 523 Score = 24.6 bits (53), Expect = 9.3 Identities = 10/47 (21%), Positives = 18/47 (38%), Gaps = 6/47 (12%) Query: 6 WFDLLTIML-LCIIFTCTFKSILHLICS-----LKYFPRNIYKIFSN 46 LL +M+ +I+ F I H + ++ R Y + N Sbjct: 349 IERLLKLMIPGILIWLLFFYLIFHCWLNAVAELTRFADREFYGDWWN 395 >gnl|CDD|145540 pfam02453, Reticulon, Reticulon. Reticulon, also know as neuroendocrine-specific protein (NSP), is a protein of unknown function which associates with the endoplasmic reticulum. This family represents the C-terminal domain of the three reticulon isoforms and their homologues. Length = 164 Score = 24.5 bits (54), Expect = 9.4 Identities = 7/20 (35%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Query: 1 MSYL-NWFDLLTIMLLCIIF 19 +SYL + F LT++ + +I Sbjct: 117 LSYLGSLFSFLTLLYIGVIL 136 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.132 0.393 Gapped Lambda K H 0.267 0.0694 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,485,390 Number of extensions: 65599 Number of successful extensions: 210 Number of sequences better than 10.0: 1 Number of HSP's gapped: 210 Number of HSP's successfully gapped: 25 Length of query: 129 Length of database: 6,263,737 Length adjustment: 83 Effective length of query: 46 Effective length of database: 4,470,190 Effective search space: 205628740 Effective search space used: 205628740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (23.9 bits)