RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780679|ref|YP_003065092.1| hypothetical protein CLIBASIA_02830 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) >gnl|CDD|182605 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional. Length = 638 Score = 31.7 bits (72), Expect = 0.063 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Query: 62 LQKKDIGATPTKKGNSSQLISTNTNKDKKPR-INLREKKQPQRKPITKQKK 111 +QK++ K N++ S KD+K R LR + QP RK I + +K Sbjct: 522 VQKQENQTDEAPKENNAN--SAQARKDQKRREAELRTQTQPLRKEIARLEK 570 >gnl|CDD|182751 PRK10811, rne, ribonuclease E; Reviewed. Length = 1068 Score = 31.2 bits (71), Expect = 0.086 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 97 EKKQPQRKPITKQKKNPIPLASRSNPMQNNN-DR 129 E+ +PQ +P K + P R P QNN DR Sbjct: 584 EETKPQEQPAPKAEAKPERQQDRRKPRQNNRRDR 617 >gnl|CDD|177754 PLN00151, PLN00151, potassium transporter; Provisional. Length = 852 Score = 30.9 bits (70), Expect = 0.098 Identities = 8/26 (30%), Positives = 18/26 (69%), Gaps = 4/26 (15%) Query: 4 LNWFDLLTIMLLCIIFTCTFKSILHL 29 +NWF ++++C++ C+F+SI + Sbjct: 474 INWF----LLVMCLVVVCSFRSITDI 495 >gnl|CDD|150922 pfam10326, 7TM_GPCR_Str, Serpentine type 7TM GPCR chemoreceptor Str. Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Str is a member of the Str superfamily of chemoreceptors. Almost a quarter (22.5%) of str and srj family genes and pseudogenes in C. elegans appear to have been newly formed by gene duplications since the species split. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'. Length = 307 Score = 29.4 bits (67), Expect = 0.27 Identities = 11/62 (17%), Positives = 24/62 (38%), Gaps = 11/62 (17%) Query: 3 YLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKHNTASFHRASL 62 +L W + +++L I +F I + C K++ + + + R L Sbjct: 189 HLRWKSFIGLLILTFIMGISFSII--IYCG--------IKMYFKMKKLLSLGSEKTR-KL 237 Query: 63 QK 64 Q+ Sbjct: 238 QR 239 >gnl|CDD|151926 pfam11489, DUF3210, Protein of unknown function (DUF3210). This is a family of proteins conserved in yeasts. The function is not known. The Schizosaccharomyces pombe member is the uncharacterized serine-rich protein C18E5.07 and the Saccharomyces cerevisiae member is the uncharacterized protein YIR003W. Length = 672 Score = 27.2 bits (60), Expect = 1.4 Identities = 11/40 (27%), Positives = 19/40 (47%) Query: 76 NSSQLISTNTNKDKKPRINLREKKQPQRKPITKQKKNPIP 115 + + + +++ KP I R K+ P K+K PIP Sbjct: 498 ETPEEVKSSSPGVTKPAIPSRPKEGSPTSPTEKRKPPPIP 537 >gnl|CDD|152138 pfam11702, DUF3295, Protein of unknown function (DUF3295). This family is conserved in fungi but the function is not known. Length = 507 Score = 26.8 bits (59), Expect = 1.5 Identities = 14/53 (26%), Positives = 21/53 (39%), Gaps = 6/53 (11%) Query: 67 IGATPTKKGNSSQLISTNT------NKDKKPRINLREKKQPQRKPITKQKKNP 113 + +T +G S IS++ NK P + PQ KP +KK Sbjct: 157 VKSTSVVRGFSPSHISSSYRSTAQLNKAPSPTKSAEPTAAPQAKPELPKKKQA 209 >gnl|CDD|182486 PRK10473, PRK10473, multidrug efflux system protein MdtL; Provisional. Length = 392 Score = 25.4 bits (56), Expect = 4.0 Identities = 7/22 (31%), Positives = 10/22 (45%) Query: 2 SYLNWFDLLTIMLLCIIFTCTF 23 S + L I L+C F+ F Sbjct: 289 SPSHAVSLFGITLICAGFSVGF 310 >gnl|CDD|162346 TIGR01414, autotrans_barl, outer membrane autotransporter barrel domain. A number of Gram-negative bacterial proteins, mostly found in pathogens and associated with virulence, contain a conserved C-terminal domain that integrates into the outer membrane and enables the N-terminal region to be delivered across the membrane. This C-terminal autotransporter domain is about 400 amino acids in length and includes the aromatic amino acid-rich OMP signal, typically ending with a Phe or Trp residue, at the extreme C-terminus. Length = 429 Score = 24.6 bits (54), Expect = 6.6 Identities = 6/23 (26%), Positives = 10/23 (43%) Query: 66 DIGATPTKKGNSSQLISTNTNKD 88 +IG + G+ L+ N D Sbjct: 52 NIGGEGAQTGDGITLVEVNGGSD 74 >gnl|CDD|177753 PLN00149, PLN00149, potassium transporter; Provisional. Length = 779 Score = 24.8 bits (54), Expect = 7.1 Identities = 10/26 (38%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Query: 4 LNWFDLLTIMLLCIIFTCTFKSILHL 29 +NW T+MLLC+ T F+ L Sbjct: 401 INW----TLMLLCLAVTVGFRDTKRL 422 >gnl|CDD|162097 TIGR00898, 2A0119, cation transport protein. Length = 505 Score = 24.6 bits (54), Expect = 8.4 Identities = 5/18 (27%), Positives = 8/18 (44%) Query: 6 WFDLLTIMLLCIIFTCTF 23 T+ L+ + FT F Sbjct: 324 NLRKTTLCLMMLWFTTAF 341 >gnl|CDD|177538 PHA03136, PHA03136, thymidine kinase; Provisional. Length = 378 Score = 24.3 bits (52), Expect = 8.8 Identities = 16/78 (20%), Positives = 22/78 (28%), Gaps = 17/78 (21%) Query: 38 RNIYKIFSNIYQQKHNTASFHRASLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLRE 97 NIY F N A + KD ++ + DKK + + Sbjct: 228 HNIYICFMNTITYAKQAPIMWDADKKDKDALSSAI------------FDDDKKECLEAAD 275 Query: 98 KKQPQRKPITKQKKNPIP 115 I KKNP Sbjct: 276 S-----PEIVGGKKNPSI 288 >gnl|CDD|179540 PRK03113, PRK03113, putative disulfide oxidoreductase; Provisional. Length = 139 Score = 24.3 bits (53), Expect = 8.9 Identities = 11/29 (37%), Positives = 14/29 (48%), Gaps = 5/29 (17%) Query: 3 YLNWFDLLTIMLLC-----IIFTCTFKSI 26 Y+NWF +TI L I C+F I Sbjct: 108 YINWFGFVTIPFLALIAFITIAVCSFIVI 136 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.320 0.132 0.393 Gapped Lambda K H 0.267 0.0617 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,914,344 Number of extensions: 98133 Number of successful extensions: 219 Number of sequences better than 10.0: 1 Number of HSP's gapped: 218 Number of HSP's successfully gapped: 30 Length of query: 129 Length of database: 5,994,473 Length adjustment: 83 Effective length of query: 46 Effective length of database: 4,201,009 Effective search space: 193246414 Effective search space used: 193246414 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (23.7 bits)