RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780679|ref|YP_003065092.1| hypothetical protein CLIBASIA_02830 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) >2r9r_B Paddle chimera voltage gated potassium channel KV1.2-KV2.1; voltage sensor, voltage dependent, ION channel, shaker, membrane protein; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 2a79_B* Length = 514 Score = 26.4 bits (57), Expect = 2.2 Identities = 10/61 (16%), Positives = 21/61 (34%) Query: 2 SYLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKHNTASFHRAS 61 + +N D++ I+ + T + L I++I + K + S Sbjct: 272 NIMNIIDIVAIIPYYVTIFLTESNKSVLQFQNVRRVVQIFRIMRILRIFKLSRHSKGLQI 331 Query: 62 L 62 L Sbjct: 332 L 332 >3hb3_B Cytochrome C oxidase subunit 2; electron transfer, proton transfer, proton pumping, membrane protein, cell inner membrane, cell membrane, copper; HET: HEA LDA LMT; 2.25A {Paracoccus denitrificans} PDB: 1ar1_B* 3ehb_B* 1qle_B* Length = 298 Score = 25.8 bits (56), Expect = 3.1 Identities = 8/39 (20%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Query: 1 MSYLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRN 39 W D + ++ + F +L LIC +++ R Sbjct: 57 AHDQQWLDHFVLYIITAVT--IFVCLLLLICIVRFNRRA 93 >3f9m_A Glucokinase; hexokinase IV, alternative splicing, ATP- binding, diabetes mellitus, disease mutation, glycolysis, nucleotide-binding, polymorphism; HET: GLC MRK; 1.50A {Homo sapiens} PDB: 1v4s_A* 3a0i_X* 3fr0_A* 3goi_A* 3imx_A* 3h1v_X* 1v4t_A* Length = 470 Score = 25.2 bits (55), Expect = 4.0 Identities = 6/24 (25%), Positives = 11/24 (45%) Query: 92 RINLREKKQPQRKPITKQKKNPIP 115 + + E ++ Q TK + IP Sbjct: 93 LVKVGEGEEGQWSVKTKHQMYSIP 116 >2gsm_B Cytochrome C oxidase subunit 2; transmembrane protein complex, oxidoreductase; HET: DMU HEA TRD; 2.00A {Rhodobacter sphaeroides} SCOP: b.6.1.2 f.17.2.1 PDB: 3dtu_B* 3fye_B* 3fyi_B* 1m56_B* 1m57_B* Length = 262 Score = 24.7 bits (53), Expect = 6.0 Identities = 5/52 (9%), Positives = 15/52 (28%), Gaps = 4/52 (7%) Query: 1 MSYLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKH 52 + ++W D ++++ I + LI + + Sbjct: 26 ATQIHWLDGFILVIIAAITIF----VTLLILYAVWRFHEKRNKVPARFTHNS 73 >2wwb_H 60S ribosomal protein L4-B; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Triticum aestivum} PDB: 2wwa_H 2ww9_H 1s1i_D Length = 362 Score = 24.5 bits (53), Expect = 6.8 Identities = 7/20 (35%), Positives = 10/20 (50%) Query: 95 LREKKQPQRKPITKQKKNPI 114 +R Q +K KKNP+ Sbjct: 299 IRPAGQATQKRTHVLKKNPL 318 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.320 0.132 0.393 Gapped Lambda K H 0.267 0.0450 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 988,409 Number of extensions: 37269 Number of successful extensions: 100 Number of sequences better than 10.0: 1 Number of HSP's gapped: 100 Number of HSP's successfully gapped: 11 Length of query: 129 Length of database: 5,693,230 Length adjustment: 82 Effective length of query: 47 Effective length of database: 3,705,222 Effective search space: 174145434 Effective search space used: 174145434 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.1 bits)