BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780679|ref|YP_003065092.1| hypothetical protein
CLIBASIA_02830 [Candidatus Liberibacter asiaticus str. psy62]
         (129 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780679|ref|YP_003065092.1| hypothetical protein CLIBASIA_02830 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 129

 Score =  263 bits (671), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 129/129 (100%), Positives = 129/129 (100%)

Query: 1   MSYLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKHNTASFHRA 60
           MSYLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKHNTASFHRA
Sbjct: 1   MSYLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKHNTASFHRA 60

Query: 61  SLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLREKKQPQRKPITKQKKNPIPLASRS 120
           SLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLREKKQPQRKPITKQKKNPIPLASRS
Sbjct: 61  SLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLREKKQPQRKPITKQKKNPIPLASRS 120

Query: 121 NPMQNNNDR 129
           NPMQNNNDR
Sbjct: 121 NPMQNNNDR 129


>gi|254780943|ref|YP_003065356.1| glucosamine--fructose-6-phosphate aminotransferase [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 608

 Score = 24.6 bits (52), Expect = 0.55,   Method: Composition-based stats.
 Identities = 10/22 (45%), Positives = 13/22 (59%)

Query: 29  LICSLKYFPRNIYKIFSNIYQQ 50
           LI SL   PR ++ +  NIY Q
Sbjct: 431 LIRSLVEIPRKMFDVLQNIYSQ 452


>gi|254780137|ref|YP_003064550.1| malic enzyme [Candidatus Liberibacter asiaticus str. psy62]
          Length = 779

 Score = 23.5 bits (49), Expect = 1.3,   Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 14/26 (53%)

Query: 96  REKKQPQRKPITKQKKNPIPLASRSN 121
           REKK  + K +  QK  P PL+   N
Sbjct: 244 REKKFDKWKSVYAQKSGPKPLSETMN 269


>gi|254780869|ref|YP_003065282.1| beta-lactamase domain-containing protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 559

 Score = 22.3 bits (46), Expect = 2.9,   Method: Composition-based stats.
 Identities = 11/44 (25%), Positives = 22/44 (50%)

Query: 79  QLISTNTNKDKKPRINLREKKQPQRKPITKQKKNPIPLASRSNP 122
           QLI   T    +PR  L +  + + + +   +K+ +  +SR+ P
Sbjct: 293 QLIVIATGSQGEPRSALAQLSRGEMRNVKLAEKDTVIFSSRAIP 336


>gi|254781107|ref|YP_003065520.1| phosphoglucomutase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 542

 Score = 21.9 bits (45), Expect = 3.8,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 51  KHNTASFHRASLQKKDIGATPTKKGNSSQLISTN 84
           K+NT+S   AS Q+ +     +KK  S Q+I  N
Sbjct: 125 KYNTSSGGSASEQQTEDIFEESKKITSYQIIEAN 158


>gi|254780227|ref|YP_003064640.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 426

 Score = 21.6 bits (44), Expect = 5.5,   Method: Composition-based stats.
 Identities = 12/61 (19%), Positives = 28/61 (45%)

Query: 58  HRASLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLREKKQPQRKPITKQKKNPIPLA 117
           ++  L    I  T   + N+ QL+S   +     R+ L       ++ + K+ +NP+ ++
Sbjct: 71  YQGLLLDDKITITEDMRQNAEQLLSYGGSPIGNSRVKLTNFSDCIKRGLIKKDENPLEVS 130

Query: 118 S 118
           +
Sbjct: 131 A 131


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.320    0.132    0.393 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 84,202
Number of Sequences: 1233
Number of extensions: 3108
Number of successful extensions: 18
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 8
Number of HSP's gapped (non-prelim): 12
length of query: 129
length of database: 328,796
effective HSP length: 65
effective length of query: 64
effective length of database: 248,651
effective search space: 15913664
effective search space used: 15913664
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 33 (17.3 bits)