HHsearch alignment for GI: 254780680 and conserved domain: CHL00201

>CHL00201 syh histidine-tRNA synthetase; Provisional.
Probab=97.75  E-value=0.00021  Score=53.40  Aligned_cols=145  Identities=19%  Similarity=0.280  Sum_probs=102.2

Q ss_pred             HCCCCCEEECCHHHHHHHHHHHHHHHHHHHHCCCCEEHHHHHCCHHHHHHH-HHCHH-HHHHHHHHHH----CCEECCCC
Q ss_conf             216753010564889999999999986223203202123562027889865-51422-4767764310----00231345
Q gi|254780680|r  159 LSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGT-GQIPK-FADDMFCTTD----GRWLIPTS  232 (430)
Q Consensus       159 vsGsrF~~Lkg~~A~Le~ALi~y~ld~~~~~~Gy~~v~~P~lv~~~~~~gt-G~lp~-f~~~~y~~~d----~l~Li~Ta  232 (430)
T Consensus         7 ~kG~r--D~lp~e~~~~~~i~~~i~~~-f~~~Gf~~I~TP~lE~~e~~~~~~g~~~d~i~k~~y~f~D~~g~~l~LRpD~   83 (424)
T CHL00201          7 LRGTK--DILPDEIEYWQFIHEKAATL-LKLANYQEIRTPIFENTELFDRGIGEETDIVNKEMYRFFDRGNRSITLRPEG   83 (424)
T ss_pred             CCCCC--CCCHHHHHHHHHHHHHHHHH-HHHCCCEEEECCCCCCHHHHCCCCCCCCHHHHHHHEEEECCCCCEEEECCCC
T ss_conf             99998--78999999999999999999-9985992504754041988623578742056665325455999888867877


Q ss_pred             CCHHHHHHHHHCCCHHHHCCEEEEEECCCCCCCCCCCCCCCCEEEE-EEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             4114544534205955504208853221078843355434321222-210200212127865014578989999999999
Q gi|254780680|r  233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQ-HQFWKCELVSITREEDSFTEHERMLSCAEEILK  311 (430)
Q Consensus       233 EvpL~~~~~~~~l~~~~LPik~~~~s~cfR~EaGs~GkdtrGl~Rv-HQF~KVE~~~~~~pe~S~~~~e~~~~~~~~i~~  311 (430)
T Consensus        84 T~piaR~~~~~~~~~~~~P~r~~y~g~vfR~e~pq~-----GR~REF~Q~-gvEiiG~~~~~----aDaEvi~l~~~~l~  153 (424)
T CHL00201         84 TASIVRAFIENRMAYHMRPQRLWYSGPMFRYERPQS-----GRQRQFHQL-GIEFIGSSDPR----ADMEVIHLAMTLFN  153 (424)
T ss_pred             HHHHHHHHHHCCCCCCCCCEEEEEECCEEECCCCCC-----CCCCHHHHC-CEEEECCCCHH----HHHHHHHHHHHHHH
T ss_conf             099999999747655799878998754780589878-----864210414-62000689828----78999999999998


Q ss_pred             HHCCH
Q ss_conf             84106
Q gi|254780680|r  312 RLDLH  316 (430)
Q Consensus       312 ~L~lp  316 (430)
T Consensus       154 ~lgl~  158 (424)
T CHL00201        154 ELPVH  158 (424)
T ss_pred             HCCCC
T ss_conf             65965