HHsearch alignment for GI: 254780680 and conserved domain: COG0124

>COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis].
Probab=97.85  E-value=0.0001  Score=55.76  Aligned_cols=146  Identities=19%  Similarity=0.312  Sum_probs=104.6

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCEEHHHHHCCHHHHH-HHHHCHH-HHHHHHHHHH----CCEECCCCCCHHHHHHHH
Q ss_conf             648899999999999862232032021235620278898-6551422-4767764310----002313454114544534
Q gi|254780680|r  169 GHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMY-GTGQIPK-FADDMFCTTD----GRWLIPTSEVSLTNLYSH  242 (430)
Q Consensus       169 g~~A~Le~ALi~y~ld~~~~~~Gy~~v~~P~lv~~~~~~-gtG~lp~-f~~~~y~~~d----~l~Li~TaEvpL~~~~~~  242 (430)
T Consensus        15 p~d~~~~~~i~~~~~~v-~~~yGf~eI~TPifE~telf~r~~Ge~td~v~kemY~F~Dkggr~laLRpe~Tapv~R~~~e   93 (429)
T COG0124          15 PEDMALREYIESTIRKV-FESYGFSEIRTPIFEYTELFARKSGEETDVVEKEMYTFKDKGGRSLALRPELTAPVARAVAE   93 (429)
T ss_pred             HHHHHHHHHHHHHHHHH-HHHCCCEECCCCCCCCHHHHHHCCCCCCCCCCCCEEEEEECCCCEEEECCCCCHHHHHHHHH
T ss_conf             67789999999999999-99809976557551116676201697433332102899948998898446674999999995


Q ss_pred             HCCCHHHHCCEEEEEECCCCCCCCCCCCCCCCEEEE-EEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCH-HHHC
Q ss_conf             205955504208853221078843355434321222-21020021212786501457898999999999984106-7530
Q gi|254780680|r  243 EIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQ-HQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLH-YRVV  320 (430)
Q Consensus       243 ~~l~~~~LPik~~~~s~cfR~EaGs~GkdtrGl~Rv-HQF~KVE~~~~~~pe~S~~~~e~~~~~~~~i~~~L~lp-yRvv  320 (430)
T Consensus        94 n~~~~~-~p~k~yy~g~vfRyErPQ-----~GR~RqF~Q~g-~E~iG~~~~~~----DAEvi~l~~~~l~~lGi~~~~l~  162 (429)
T COG0124          94 NKLDLP-KPLKLYYFGPVFRYERPQ-----KGRYRQFYQFG-VEVIGSDSPDA----DAEVIALAVEILEALGIGGFTLE  162 (429)
T ss_pred             CCCCCC-CCEEEEEECCEECCCCCC-----CCCCEEEEECC-EEEECCCCCCC----CHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             622036-872599833562378888-----88750368767-67767998653----89999999999997499867999


Q ss_pred             CCCCHH
Q ss_conf             378011
Q gi|254780680|r  321 SLCTGD  326 (430)
Q Consensus       321 ~~~sgd  326 (430)
T Consensus       163 iN~~g~  168 (429)
T COG0124         163 INSRGI  168 (429)
T ss_pred             ECCCCC
T ss_conf             817644