HHsearch alignment for GI: 254780680 and conserved domain: COG0172

>COG0172 SerS Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis].
Probab=100.00  E-value=0  Score=1155.78  Aligned_cols=424  Identities=53%  Similarity=0.872  Sum_probs=410.5

Q ss_pred             CCCHHHHHCCHHHHHHHHHHCCCC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             988447851999999999846989-5889999999999999999999999999999999998644998799999999999
Q gi|254780680|r    1 MLDIQWIRQNPEHLDIALKKRHLE-PQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSLVDALKNETST   79 (430)
Q Consensus         1 MLDik~IRen~e~v~~~l~~R~~~-~~id~il~Ld~~rr~l~~e~e~LraerN~lSKeIg~~k~~~~~~~~~~Lk~e~~~   79 (430)
T Consensus         1 mld~k~ir~n~d~v~~~l~~r~~~~~~~~~~~~ld~~~r~~~~~~e~l~~~rn~~sk~ig~~~~~~~~-~~~~l~~e~~~   79 (429)
T COG0172           1 MLDLKLIRENPDAVREKLKKRGGDALDVDKLLELDEERRKLLRELEELQAERNELSKEIGRALKRGED-DAEELIAEVKE   79 (429)
T ss_pred             CCHHHHHHHCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCH-HHHHHHHHHHH
T ss_conf             96487765099999998763488376789999999999999999999999988999999987632621-48999998898


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHCCCCCCCEEEEEECCCCC--CCCCCCCCCCHHHHCCCCCHHHHH
Q ss_conf             998864446666677888774431002258811221135554024200015656--656662112202211731000112
Q gi|254780680|r   80 LKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGKKPS--AIHLSREHFEIGEALGLMDFDRAT  157 (430)
Q Consensus        80 Lk~eik~le~~~~~le~el~~lll~IPNi~~~~VP~G~de~dNv~i~~~G~~~~--f~f~~k~H~elge~l~liDfe~a~  157 (430)
T Consensus        80 l~~~l~~~e~~~~~~~~el~~~ll~ipNi~~~~VPvg~de~~n~~vr~~g~~~~~~~~f~pk~H~~lge~l~~~Df~~aa  159 (429)
T COG0172          80 LKEKLKELEAALDELEAELDTLLLTIPNIPHESVPVGKDEDDNVEVRRWGEPPVFVFDFEPKDHVELGEKLGLLDFERAA  159 (429)
T ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHCCCCHHHHHC
T ss_conf             88998724377999999999999709999865668688865654889973376544467853099876542762456650


Q ss_pred             HHCCCCCEEECCHHHHHHHHHHHHHHHHHHHHCCCCEEHHHHHCCHHHHHHHHHCHHHHHHHHHHHH-CCEECCCCCCHH
Q ss_conf             2216753010564889999999999986223203202123562027889865514224767764310-002313454114
Q gi|254780680|r  158 KLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-GRWLIPTSEVSL  236 (430)
Q Consensus       158 kvsGsrF~~Lkg~~A~Le~ALi~y~ld~~~~~~Gy~~v~~P~lv~~~~~~gtG~lp~f~~~~y~~~d-~l~Li~TaEvpL  236 (430)
T Consensus       160 KvsGsrf~~~~~~~a~L~rAL~~f~ld~~~-~~Gf~e~~~P~lv~~e~m~gtgqlpkf~e~~y~v~~~~~~LipTaEvpl  238 (429)
T COG0172         160 KVSGSRFYFYKGKGARLERALIQFMLDLHT-KHGFTEVLPPYLVNLESMFGTGQLPKFEEDLYKVEDPDLYLIPTAEVPL  238 (429)
T ss_pred             CCCCCCEEEECCHHHHHHHHHHHHHHHHHH-HCCCEEEECCEEECHHHHHCCCCCCCCCCCCEEECCCCEEEEECCHHHH
T ss_conf             207874389807789999999999999998-7696586576060598862237898880121584589879970202156


Q ss_pred             HHHHHHHCCCHHHHCCEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCH
Q ss_conf             54453420595550420885322107884335543432122221020021212786501457898999999999984106
Q gi|254780680|r  237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLH  316 (430)
Q Consensus       237 ~~~~~~~~l~~~~LPik~~~~s~cfR~EaGs~GkdtrGl~RvHQF~KVE~~~~~~pe~S~~~~e~~~~~~~~i~~~L~lp  316 (430)
T Consensus       239 ~~l~~~Eil~~~~LP~k~~~~S~cFR~EAGs~GrdtrGliRvHQF~KVE~v~~~~Pe~S~~~~E~m~~~ae~il~~LeLP  318 (429)
T COG0172         239 TNLHRDEILDEEDLPIKYTAYSPCFRSEAGSAGKDTRGLIRVHQFDKVELVVITKPEESEEELEEMLGNAEEVLQELELP  318 (429)
T ss_pred             HHHHCCCCCCCCCCCEEEEEECHHHHCCCCCCCCCCCCEEEEEEEEEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             78651620152127802678772542145656643553014664355899997070116999999999999999970898


Q ss_pred             HHHCCCCCHHCCCHHHEEEEEEEECCCCCCEEEEEEECCCCCHHHHHCCCEEECCCCCCCCEEEEECCCHHHHHHHHHHH
Q ss_conf             75303780117844340241011010048332375310210076453268473389984101042004322899999999
Q gi|254780680|r  317 YRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAI  396 (430)
Q Consensus       317 yRvv~~~sgdlg~~a~~~~DiE~w~P~~~~y~Ev~S~Snc~D~QsrRl~iry~~~~~~~~~~~htlNgt~~A~~R~l~ai  396 (430)
T Consensus       319 yRvv~lctGDlgf~a~kkYDlEvWlP~q~~yrEisScSnc~DfQaRR~~~Ryr~~~~~k~~~vhTLNGsglA~~R~l~Ai  398 (429)
T COG0172         319 YRVVNLCTGDLGFSAAKKYDLEVWLPGQNKYREISSCSNCTDFQARRLNIRYRDKEEGKREFVHTLNGSGLAVGRTLVAI  398 (429)
T ss_pred             CEEEEECCCCCCCCCCCCEEEEEEECCCCCCEEEEEEECCCCHHHHHHHCCCCCCCCCCCEEEEECCCHHHHHHHHHHHH
T ss_conf             36843256776886467323799853778740212443454288898754056365799669995464277999999999


Q ss_pred             HHHCCCCCCCEECCCCCCCCCCCEEEECCC
Q ss_conf             883468998386582223101880130733
Q gi|254780680|r  397 LENYLNADGSVTIPTVLRPYMNNLAVIKKE  426 (430)
Q Consensus       397 lEn~q~~dg~i~iP~~L~pym~g~~~i~~~  426 (430)
T Consensus       399 lENyq~~dG~v~IPevL~~y~gg~~~i~~~  428 (429)
T COG0172         399 LENYQQEDGSVKIPEVLRPYMGGLEIIPKP  428 (429)
T ss_pred             HHCCCCCCCCEECCHHHHHHCCCCEECCCC
T ss_conf             971537899863447887327853005899