HHsearch alignment for GI: 254780680 and conserved domain: COG0441

>COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis].
Probab=99.73  E-value=1.4e-17  Score=151.30  Aligned_cols=265  Identities=23%  Similarity=0.340  Sum_probs=207.0

Q ss_pred             CCCCCCCHHHHCCCCCHHHHHHHCCCCCEEECCHHHHHHHHHHHHHHHHHHHHCCCCEEHHHHHCCHHHHHHHHHCHHHH
Q ss_conf             66211220221173100011222167530105648899999999999862232032021235620278898655142247
Q gi|254780680|r  137 LSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFA  216 (430)
Q Consensus       137 ~~k~H~elge~l~liDfe~a~kvsGsrF~~Lkg~~A~Le~ALi~y~ld~~~~~~Gy~~v~~P~lv~~~~~~gtG~lp~f~  216 (430)
T Consensus       188 ~krdHrklg~el~LF~~~~---~~~~G~~~~~pkG~~ir~~le~y~~~~~-~~~Gy~~V~TP~~~~~~l~~~SGH~~~y~  263 (589)
T COG0441         188 KKRDHRKLGKELDLFSFSP---EEGPGLPFWHPKGATIRNLLEDYVRTKL-RSYGYQEVKTPVLADLELWELSGHWDNYK  263 (589)
T ss_pred             CCCCHHHHHHHHCCEEECC---CCCCCCEEECCCCCCHHHHHHHHHHHHH-HHCCCEEECCCEEEECCCCHHCCCHHHCC
T ss_conf             2786476877621434144---4588506987884669999999999898-75585271287363000010112045513


Q ss_pred             HHHHHHH---HCCEECCCCCCHHHHHHHHHCCCHHHHCCEEEEEECCCCCCC-CCCCCCCCCEEEEEEEEEEEEEECCCC
Q ss_conf             6776431---000231345411454453420595550420885322107884-335543432122221020021212786
Q gi|254780680|r  217 DDMFCTT---DGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEA-GSAGRDTRGMLRQHQFWKCELVSITRE  292 (430)
Q Consensus       217 ~~~y~~~---d~l~Li~TaEvpL~~~~~~~~l~~~~LPik~~~~s~cfR~Ea-Gs~GkdtrGl~RvHQF~KVE~~~~~~p  292 (430)
T Consensus       264 e~mf~~~~~~~~~~lKpmNCpgh~~ifk~~~~SYR~LP~r~~E~g~v~R~E~SGa----l~GL~RvR~ftqdD~Hifc~~  339 (589)
T COG0441         264 EDMFLTESDDREYALKPMNCPGHILIFKSGLRSYRELPLRLAEFGYVYRYEKSGA----LHGLMRVRGFTQDDAHIFCTP  339 (589)
T ss_pred             CCCEEECCCCHHHEEEECCCHHHHHHHHCCCCCEECCCHHHHHCCEEECCCCCCH----HHCCCCCCCEEECCCCEECCH
T ss_conf             6606621377233064107876899985378611004404331442211567642----222400113224562014046


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCH-HHHCCCCCHH--CC-------C-----HHHEEEEEEEECC-CCCCEE--------
Q ss_conf             501457898999999999984106-7530378011--78-------4-----4340241011010-048332--------
Q gi|254780680|r  293 EDSFTEHERMLSCAEEILKRLDLH-YRVVSLCTGD--LG-------F-----SACKTYDLEVWLA-GQNLYR--------  348 (430)
Q Consensus       293 e~S~~~~e~~~~~~~~i~~~L~lp-yRvv~~~sgd--lg-------~-----~a~~~~DiE~w~P-~~~~y~--------  348 (430)
T Consensus       340 dQi~~E~~~~~~~i~~v~~~fg~~~y~~-~ls~r~k~ig~d~~W~~a~~~l~~al~~~~~~~~~~~G~gaFyGPKid~~v  418 (589)
T COG0441         340 DQIKDEFKGILELILEVYKDFGFTDYEV-KLSTRPKFIGSDEMWDKAEAALREALKEIGVEYVEEPGEGAFYGPKIDFQV  418 (589)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEEE-EEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEECCCCEEEECCCCCEEE
T ss_conf             7889999999999999998469753799-996477646873556778899998887608603646873579776642488


Q ss_pred             -----EEEEECC-CCCHHHH-HCCCEEECCCCCCCCEEEEE-CCCHHHHHHHHHHHHHHCCCCCCCEECCCCCCCC
Q ss_conf             -----3753102-1007645-32684733899841010420-0432289999999988346899838658222310
Q gi|254780680|r  349 -----EISSCST-CGNFQSR-RMNSRYRDPNSKSLKFTHTL-NGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY  416 (430)
Q Consensus       349 -----Ev~S~Sn-c~D~Qsr-Rl~iry~~~~~~~~~~~htl-Ngt~~A~~R~l~ailEn~q~~dg~i~iP~~L~py  416 (430)
T Consensus       419 ~Dalgr~~q~~TIQlDf~lpeRF~l~Yv~~d~~~-~~PvmiHrai~GSiERfi~iLiE~~~---G--~~P~WLaPv  488 (589)
T COG0441         419 KDALGREWQLGTIQLDFNLPERFDLEYVDEDGEK-KRPVIIHRAILGSIERFIGILLEHYA---G--ALPTWLAPV  488 (589)
T ss_pred             EECCCCCEECCEEEEECCCHHHCEEEEECCCCCC-CCCEEEEECCCHHHHHHHHHHHHHCC---C--CCCCCCCCC
T ss_conf             7356861005617870377242147998577875-38789992464148999999998646---9--887657851