HHsearch alignment for GI: 254780680 and conserved domain: COG0442

>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis].
Probab=99.69  E-value=8.9e-17  Score=145.41  Aligned_cols=262  Identities=23%  Similarity=0.281  Sum_probs=208.5

Q ss_pred             CCCCCCCCCHHHHCCCCCHHHHHHHCCCCCEEECCHHHHHHHHHHHHHHHHHHHHCCCCEEHHHHHCCHHHHHHHHHCHH
Q ss_conf             56662112202211731000112221675301056488999999999998622320320212356202788986551422
Q gi|254780680|r  135 IHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPK  214 (430)
Q Consensus       135 ~f~~k~H~elge~l~liDfe~a~kvsGsrF~~Lkg~~A~Le~ALi~y~ld~~~~~~Gy~~v~~P~lv~~~~~~gtG~lp~  214 (430)
T Consensus        17 da~~~sh~-ll~rAg~i~~------~~~G~y~~lP~g~rv~~kI~~iir~-em~~~G~~Evl~P~L~p~eLwkEs~r~~~   88 (500)
T COG0442          17 DASEWSHQ-LLLRAGMIRK------PVKGLYVWLPLGLRVLEKIENIIRE-EMDKIGAQEVLFPTLIPAELWKESGRWEG   88 (500)
T ss_pred             HHHHHHHH-HHHHCCCEEE------CCCCEEEECCCHHHHHHHHHHHHHH-HHHHCCCEEEECHHCCHHHHHHHHCHHHC
T ss_conf             23799999-9986686020------2571699776589999999999999-99860850883110587899987485630


Q ss_pred             HHHHHHHHHH----CCEECCCCCCHHHHHHHHHCCCHHHHCCEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEEEEEECC
Q ss_conf             4767764310----002313454114544534205955504208853221078843355434321222210200212127
Q gi|254780680|r  215 FADDMFCTTD----GRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  290 (430)
Q Consensus       215 f~~~~y~~~d----~l~Li~TaEvpL~~~~~~~~l~~~~LPik~~~~s~cfR~EaGs~GkdtrGl~RvHQF~KVE~~~~~  290 (430)
T Consensus        89 f~~El~~v~drg~~~l~L~PTsEe~it~~~~~~i~SYkdLPl~lYQi~~kfRdE~----rpr~gllR~REF~mkdaySfh  164 (500)
T COG0442          89 FGPELFRVKDRGDRPLALRPTSEEVITDMFRKWIRSYKDLPLKLYQIQSKFRDEK----RPRFGLLRGREFLMKDAYSFH  164 (500)
T ss_pred             CCHHHEEEECCCCCEEEECCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEEEECCC----CCCCCCCCHHEEEECCCCCCC
T ss_conf             3644489971699634357886899999999986556518812101345884334----688773000203301112102


Q ss_pred             -CCCCHHHHHHHHHHHHHHHHHHHCCHHHHCCCCCHHCCCHHHEEEEEEEECCCCCCEEEEEEECCCCCHHHHHC-CCEE
Q ss_conf             -86501457898999999999984106753037801178443402410110100483323753102100764532-6847
Q gi|254780680|r  291 -REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRM-NSRY  368 (430)
Q Consensus       291 -~pe~S~~~~e~~~~~~~~i~~~L~lpyRvv~~~sgdlg~~a~~~~DiE~w~P~~~~y~Ev~S~Snc~D~QsrRl-~iry  368 (430)
T Consensus       165 ~~~e~a~~~y~~~~~~Y~~if~~i~l~~~~~~ad~g~~Gg~~S--~eF~~l~pd~-ge~qi~ts~~y~aN~e~a~~~~~~  241 (500)
T COG0442         165 ADEEDAEETYEKMLDAYSRIFLRLPLIFGPVPADEGFIGGSYS--HEFEALMPDG-GEDQIATSHHYGANFEKAFIDIKF  241 (500)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCC--EEEEEECCCC-CCCEEEEECCHHHHHHHHCCCCCC
T ss_conf             8989999999999999999998589538862566778887653--6999985689-854799806266668774467775


Q ss_pred             ECCCCCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCCCEECCCCCC
Q ss_conf             3389984101042004322899999999883468998386582223
Q gi|254780680|r  369 RDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR  414 (430)
Q Consensus       369 ~~~~~~~~~~~htlNgt~~A~~R~l~ailEn~q~~dg~i~iP~~L~  414 (430)
T Consensus       242 ~~~~~~~~~~v~t~--s~~~s~r~~~~~i~i~GDn~G~v-~Pp~vA  284 (500)
T COG0442         242 EDEEEGELEYVHTT--SYGISTRIIGAAILIHGDNEGLV-LPPIVA  284 (500)
T ss_pred             CCCCCCCCEEECCC--CEEEEEEEEEEEEEEECCCCCCC-CCCHHC
T ss_conf             56665541475146--26887400158999714887764-875004