HHsearch alignment for GI: 254780680 and conserved domain: KOG1637

>KOG1637 consensus.
Probab=99.55  E-value=3e-14  Score=126.65  Aligned_cols=246  Identities=23%  Similarity=0.366  Sum_probs=186.4

Q ss_pred             CCCCCCHHHHCCCCCHHHHHHHCCCCCEEECCHHHHHHHHHHHHHHHHHHHHCCCCEEHHHHHCCHHHHHHHHHCHHHHH
Q ss_conf             62112202211731000112221675301056488999999999998622320320212356202788986551422476
Q gi|254780680|r  138 SREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFAD  217 (430)
Q Consensus       138 ~k~H~elge~l~liDfe~a~kvsGsrF~~Lkg~~A~Le~ALi~y~ld~~~~~~Gy~~v~~P~lv~~~~~~gtG~lp~f~~  217 (430)
T Consensus       162 ~rdHRkig~~qeLfff~~lS--PGS--~FflP~G~~iyN~Lv~fir~e-y~~rGf~EVitPniy~~~LWe~SGHwqnY~e  236 (560)
T KOG1637         162 KRDHRKIGKEQELFFFHELS--PGS--CFFLPHGTRIYNTLVDFIRAE-YRKRGFTEVITPNIYNKKLWETSGHWQNYSE  236 (560)
T ss_pred             HHHHHHHHHHHHHEEECCCC--CCC--EEECCCCCHHHHHHHHHHHHH-HHHCCCCEECCCCHHHHHHHHHCCCHHHHHH
T ss_conf             10055540222202413579--862--453148642788999999999-8753874322722121566653252555443


Q ss_pred             HHHHHH---HCCEECCCCCCHHHHHHHHHCCCHHHHCCEEEEEECCCCCCC-CCCCCCCCCEEEEEEEEEEEEEECCCCC
Q ss_conf             776431---000231345411454453420595550420885322107884-3355434321222210200212127865
Q gi|254780680|r  218 DMFCTT---DGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEA-GSAGRDTRGMLRQHQFWKCELVSITREE  293 (430)
Q Consensus       218 ~~y~~~---d~l~Li~TaEvpL~~~~~~~~l~~~~LPik~~~~s~cfR~Ea-Gs~GkdtrGl~RvHQF~KVE~~~~~~pe  293 (430)
T Consensus       237 nmF~~e~eke~~~LKPMNCPgHcLmf~~r~rS~reLPlR~aDFg~LHRnE~SGa----LsGLTRvRrFqQDDaHIFCt~~  312 (560)
T KOG1637         237 NMFKFEVEKEEFALKPMNCPGHCLMFAHRDRSYRELPLRFADFGVLHRNEASGA----LSGLTRVRRFQQDDAHIFCTPD  312 (560)
T ss_pred             HCEEEEECHHHHCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCEEEECCCCCC----CCCCCEEEEECCCCCEEEECCC
T ss_conf             101231010332258668975301336677427447842267522530545642----3221011011015715885576


Q ss_pred             CHHHHHHHHHHHHHHHHHHHCCHHHHCCCCC---HHCCCHHHEEEEEEEECC--------------------CCCC-EEE
Q ss_conf             0145789899999999998410675303780---117844340241011010--------------------0483-323
Q gi|254780680|r  294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCT---GDLGFSACKTYDLEVWLA--------------------GQNL-YRE  349 (430)
Q Consensus       294 ~S~~~~e~~~~~~~~i~~~L~lpyRvv~~~s---gdlg~~a~~~~DiE~w~P--------------------~~~~-y~E  349 (430)
T Consensus       313 Qi~~Eik~~l~fl~~vY~~fgf~f~l~-lSTRPe~~lG-------~l~~Wd~AE~~L~~al~e~g~pw~lN~GDGAFYGP  384 (560)
T KOG1637         313 QVKEEIKGCLDFLDYVYGVFGFTFKLN-LS