HHsearch alignment for GI: 254780680 and conserved domain: PRK00413

>PRK00413 thrS threonyl-tRNA synthetase; Reviewed.
Probab=99.86  E-value=5.7e-22  Score=183.99  Aligned_cols=258  Identities=22%  Similarity=0.387  Sum_probs=203.0

Q ss_pred             CCCCCCHHHHCCCCCHHHHHHHCCCCCEEECCHHHHHHHHHHHHHHHHHHHHCCCCEEHHHHHCCHHHHHHHHHCHHHHH
Q ss_conf             62112202211731000112221675301056488999999999998622320320212356202788986551422476
Q gi|254780680|r  138 SREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFAD  217 (430)
Q Consensus       138 ~k~H~elge~l~liDfe~a~kvsGsrF~~Lkg~~A~Le~ALi~y~ld~~~~~~Gy~~v~~P~lv~~~~~~gtG~lp~f~~  217 (430)
T Consensus       238 kRDHRklGkel~LF~f~~---~-~pGl~~w~P~G~~i~~~le~~~r~~~-~~~Gy~eV~TP~i~~~~Lw~~SGHw~~Y~e  312 (639)
T PRK00413        238 KRDHRKLGKELDLFSFQE---E-GPGLPFWHPKGWIIRNELEDYMRRRH-LKAGYQEVNTPHILDRSLWETSGHWDHYRE  312 (639)
T ss_pred             HCCHHHHHHHCCCEEECC---C-CCCCEEECCCHHHHHHHHHHHHHHHH-HHCCCEEEECCCCCCHHHHHHCCCHHHHCC
T ss_conf             528888877435157036---6-88764663768999999999999999-986985983641346889965474223225


Q ss_pred             HHHHH----HHCCEECCCCCCHHHHHHHHHCCCHHHHCCEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEEEEEECCCCC
Q ss_conf             77643----10002313454114544534205955504208853221078843355434321222210200212127865
Q gi|254780680|r  218 DMFCT----TDGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE  293 (430)
Q Consensus       218 ~~y~~----~d~l~Li~TaEvpL~~~~~~~~l~~~~LPik~~~~s~cfR~EaGs~GkdtrGl~RvHQF~KVE~~~~~~pe  293 (430)
T Consensus       313 ~Mf~~~~~~~~~~~lKPMNCP~H~~if~~~~~SYRdLPlR~aEfg~~~R~E~--SG-~L~GL~RvR~FtqdDaHIFc~~d  389 (639)
T PRK00413        313 NMFPTMSDDGEDYALKPMNCPGHILIFKSGLRSYRELPLRLAEFGTVHRYEK--SG-ALHGLMRVRGFTQDDAHIFCTPE  389 (639)
T ss_pred             CCCCCEECCCCEEEECCCCCCCHHHHHHCCCCCHHHCCHHHHHHHHHHCCCC--CC-CCCCEEEEEEEECCCCEEECCHH
T ss_conf             4223240152103204668700335644355355547556664113205677--87-44564233000015841324789


Q ss_pred             CHHHHHHHHHHHHHHHHHHHCCH-HHHCCCCCHHCCCHHHEEEEEEEEC--------------------CCCCCE----E
Q ss_conf             01457898999999999984106-7530378011784434024101101--------------------004833----2
Q gi|254780680|r  294 DSFTEHERMLSCAEEILKRLDLH-YRVVSLCTGDLGFSACKTYDLEVWL--------------------AGQNLY----R  348 (430)
Q Consensus       294 ~S~~~~e~~~~~~~~i~~~L~lp-yRvv~~~sgdlg~~a~~~~DiE~w~--------------------P~~~~y----~  348 (430)
T Consensus       390 Qi~~Ei~~~l~~~~~vy~~fGf~~~~-~~lStrp----ek~~g~~e~W~~Ae~~L~~al~~~g~~y~~~~GegAFYGPKI  464 (639)
T PRK00413        390 QIKDELLSVLDLILSVYKDFGLTDYY-LELSTRP----EKRVGSDELWEKATEALREALEESGLEYVENPGEGAFYGPKI  464 (639)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEE-EEEECCC----CCCCCCHHHHHHHHHHHHHHHHHCCCCEEECCCCCCEECCEE
T ss_conf             99999999999999999974998038-9996475----113588899999999999999974998087888611110166


Q ss_pred             E---------EEEECCC-CCHH-HHHCCCEEECCCCCCCC--EEE-EECCCHHHHHHHHHHHHHHCCCCCCCEECCCCCC
Q ss_conf             3---------7531021-0076-45326847338998410--104-2004322899999999883468998386582223
Q gi|254780680|r  349 E---------ISSCSTC-GNFQ-SRRMNSRYRDPNSKSLK--FTH-TLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR  414 (430)
Q Consensus       349 E---------v~S~Snc-~D~Q-srRl~iry~~~~~~~~~--~~h-tlNgt~~A~~R~l~ailEn~q~~dg~i~iP~~L~  414 (430)
T Consensus       465 D~~~~DalgR~wq~~TiQlDf~lPerF~l~Y~~~dg~~~~PVmIHRAi~GS---~ERfiaiLiEh~~---G--~~P~WLa  536 (639)
T PRK00413        465 DVQLKDAIGRTWQCGTIQLDFNLPERFDLEYIAADGEKHRPVMIHRAIFGS---IERFIGILIEHYA---G--AFPLWLA  536 (639)
T ss_pred             EEEEECCCCCEEECCHHHHHHCCHHHCCCEEECCCCCCCCEEEEEECCCCC---HHHHHHHHHHHHC---C--CCCCCCC
T ss_conf             778514468713200233222245424888998889816308999525565---8999999999808---9--8873657


Q ss_pred             CC
Q ss_conf             10
Q gi|254780680|r  415 PY  416 (430)
Q Consensus       415 py  416 (430)
T Consensus       537 P~  538 (639)
T PRK00413        537 PV  538 (639)
T ss_pred             CC
T ss_conf             61