HHsearch alignment for GI: 254780680 and conserved domain: TIGR00457

>TIGR00457 asnS asparaginyl-tRNA synthetase; InterPro: IPR004522 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases . AsparaginyltRNA synthetase (6.1.1.22 from EC) is an alpha2 dimer that belongs to class IIb. There is a striking similarity between asparaginyl-tRNA synthetases and archaeal/eukaryotic type aspartyl-tRNA synthetases (IPR004523 from INTERPRO) and a striking divergence of bacterial type aspartyl-tRNA synthetases (IPR004524 from INTERPRO). This family, AsnS, represents asparaginyl-tRNA synthetases from the three domains of life. Some species lack this enzyme and charge tRNA(asn) by misacylation with Asp, followed by transamidation of Asp to Asn.; GO: 0000166 nucleotide binding, 0004816 asparagine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006421 asparaginyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=95.67  E-value=0.016  Score=39.43  Aligned_cols=145  Identities=23%  Similarity=0.412  Sum_probs=76.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCEEHHHHHCCHHHHHHHHHCHHHHH-HHHHHH--------------HCCEECCCC
Q ss_conf             56488999999999998622320320212356202788986551422476-776431--------------000231345
Q gi|254780680|r  168 TGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFAD-DMFCTT--------------DGRWLIPTS  232 (430)
Q Consensus       168 kg~~A~Le~ALi~y~ld~~~~~~Gy~~v~~P~lv~~~~~~gtG~lp~f~~-~~y~~~--------------d~l~Li~Ta  232 (430)
T Consensus       142 ~~AvmrvR~~l~~ai~~yF-~~~gF~~V~~PilT~~d-~EGAGElF~v~TLdl~~lp~~~g~~df~~~fFgk~ayLT---  216 (495)
T TIGR00457       142 LGAVMRVRNALSQAIHEYF-QKNGFVKVSPPILTSND-CEGAGELFKVSTLDLEKLPRNDGKIDFSKDFFGKEAYLT---  216 (495)
T ss_pred             HHHHHHHHHHHHHHHHHHH-HCCCCEEECCCEEECCC-CCCCCCCCEEEEHHHHCCCCCCCCCCCCCCCCCCEEEEE---
T ss_conf             7789999999999999876-04786786886311368-888754332200324215332688876302488601233---


Q ss_pred             CCHHHHHHHHHCCCHHHHCCEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEEE-EEECCCCCCHHHHHHHHHHHH-HHHH
Q ss_conf             41145445342059555042088532210788433554343212222102002-121278650145789899999-9999
Q gi|254780680|r  233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCE-LVSITREEDSFTEHERMLSCA-EEIL  310 (430)
Q Consensus       233 EvpL~~~~~~~~l~~~~LPik~~~~s~cfR~EaGs~GkdtrGl~RvHQF~KVE-~~~~~~pe~S~~~~e~~~~~~-~~i~  310 (430)
T Consensus       217 ---VSGQL~~E~~A~A-L-~kvyTfGPTFRAEk-S~--T~R---HLsEFWMiEPE~AF~~l~d~~~~~E~~~k~~~k~VL  285 (495)
T TIGR00457       217 ---VSGQLYAEAYALA-L-SKVYTFGPTFRAEK-SN--TSR---HLSEFWMIEPEMAFANLNDLLQLIETLIKYIIKAVL  285 (495)
T ss_pred             ---ECCHHHHHHHHHH-H-CCCEECCCCEECCC-CC--CCC---CHHHHHHHHHHEEECCHHHHHHHHHHHHHHHHHHHH
T ss_conf             ---0227899999997-4-78144587400428-64--870---111221011200000133338999999999999983


Q ss_pred             HH--HCCHHHHCCCCCHH---CCCH
Q ss_conf             98--41067530378011---7844
Q gi|254780680|r  311 KR--LDLHYRVVSLCTGD---LGFS  330 (430)
Q Consensus       311 ~~--L~lpyRvv~~~sgd---lg~~  330 (430)
T Consensus       286 ~~~qellPkq--fi~~~enn~~~~L  308 (495)
T TIGR00457       286 ENQQELLPKQ--FICSQENNLLKFL  308 (495)
T ss_pred             CCHHHHCCHH--HCCCCHHHHHHHH
T ss_conf             0524504201--0377713799986