HHsearch alignment for GI: 254780680 and conserved domain: TIGR02231

>TIGR02231 TIGR02231 conserved hypothetical protein; InterPro: IPR011935 This family consists of proteins over 500 amino acids long in Caenorhabditis elegans and several bacteria (Pseudomonas aeruginosa, Nostoc sp. PCC 7120, Leptospira interrogans, etc.). The function is unknown..
Probab=92.05  E-value=1.2  Score=25.50  Aligned_cols=93  Identities=19%  Similarity=0.233  Sum_probs=61.2

Q ss_pred             HHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------------C------------------
Q ss_conf             99846989588999999999999999999999999999999999864--------------4------------------
Q gi|254780680|r   17 ALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQAIA--------------E------------------   64 (430)
Q Consensus        17 ~l~~R~~~~~id~il~Ld~~rr~l~~e~e~LraerN~lSKeIg~~k~--------------~------------------   64 (430)
T Consensus        60 ~~~~~~~~~~~~~~~~L~~~i~~~~~~~~~~~~~~~~l~~~~~~L~K~~~~~~~~~~~~~~~sg~~~~~~~~~~~~~~~f  139 (558)
T TIGR02231        60 TIRERTSRADPERLAELDKQIRELEAELRDLEDRGDALKALKSNLDKFLEDIREGLTEPIKDSGVLKRNEPDLKELKQLF  139 (558)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCEEEECCCCHHHHHHHH
T ss_conf             32114774642368999999999999998777788899985301025677774201467321523561576568999999


Q ss_pred             -CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HCCCCC
Q ss_conf             -998799999999999998864446666677888774431--002258
Q gi|254780680|r   65 -GNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLIS--CIPNVP  109 (430)
Q Consensus        65 -~~~~~~~~Lk~e~~~Lk~eik~le~~~~~le~el~~lll--~IPNi~  109 (430)
T Consensus       140 ~~~~~~~~~~~~~~r~~~~~~~el~~~~~~L~~el~~~~~~s~~~~~~  187 (558)
T TIGR02231       140 DFVGSEIERLLTEDREVERRIRELEKQLSELENELRALLTLSGKEQRS  187 (558)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEE
T ss_conf             988999999988877899999999999999999998741104786604