HHsearch alignment for GI: 254780680 and conserved domain: cd00772

>cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain. ProRS is a homodimer. It is responsible for the attachment of proline to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent formation of the enzyme bound aminoacyl-adenylate. Class II assignment is based upon its structure and the presence of three characteristic sequence motifs in the core domain.
Probab=99.93  E-value=5.7e-26  Score=213.72  Aligned_cols=247  Identities=20%  Similarity=0.235  Sum_probs=222.8

Q ss_pred             CCCHHHHCCCCCHHHHHHHCCCCCEEECCHHHHHHHHHHHHHHHHHHHHCCCCEEHHHHHCCHHHHHHHHHCHH-HHHHH
Q ss_conf             12202211731000112221675301056488999999999998622320320212356202788986551422-47677
Q gi|254780680|r  141 HFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPK-FADDM  219 (430)
Q Consensus       141 H~elge~l~liDfe~a~kvsGsrF~~Lkg~~A~Le~ALi~y~ld~~~~~~Gy~~v~~P~lv~~~~~~gtG~lp~-f~~~~  219 (430)
T Consensus         6 ~~~v~~~a~l~d~-----~~~~G~~~~lP~G~~i~~ki~~~i~~e-~~~~G~qev~~P~l~p~~lw~ksgr~~~~~~~e~   79 (264)
T cd00772           6 SLEHIGKAELADQ-----GPGRGIINFLPLAKAILDKIENVLDKM-FKEHGAQNALFPFFILASFLEKEAEHDEGFSKEL   79 (264)
T ss_pred             HHHHHHHHCCEEC-----CCCCCEEEECHHHHHHHHHHHHHHHHH-HHHCCCEEEECCCCCCHHHHHHCCCHHHCCCCCE
T ss_conf             8478676354204-----898875888905999999999999999-9982994981256799899997698444378523


Q ss_pred             HHHH--------HCCEECCCCCCHHHHHHHHHCCCHHHHCCEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEEEEEEC-C
Q ss_conf             6431--------000231345411454453420595550420885322107884335543432122221020021212-7
Q gi|254780680|r  220 FCTT--------DGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI-T  290 (430)
Q Consensus       220 y~~~--------d~l~Li~TaEvpL~~~~~~~~l~~~~LPik~~~~s~cfR~EaGs~GkdtrGl~RvHQF~KVE~~~~-~  290 (430)
T Consensus        80 ~~~~~~~~~~~e~~~~L~PT~Ee~~~~~~~~~i~SyrdLPl~lyQ~~~~fR~E~----r~r~GllR~REFlmkDahsf~~  155 (264)
T cd00772          80 AVFKDAGDEELEEDFALRPTLEENIGEIAAKFIKSWKDLPQHLNQIGNKFRDEI----RPRFGFLRAREFIMKDGHSAHA  155 (264)
T ss_pred             EEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHCCCHHHCCHHHHHHHHHHHCCC----CCCCCCHHHEEEEEEEEEECCC
T ss_conf             799734874212352016778689999998640766557977876557860578----8554332320434110353259


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHC-CHHHHCCCCCHHCCCHHHEEEEEEEECC-CCCCEEEEEEECCCCCHHHHHCCCEE
Q ss_conf             865014578989999999999841-0675303780117844340241011010-04833237531021007645326847
Q gi|254780680|r  291 REEDSFTEHERMLSCAEEILKRLD-LHYRVVSLCTGDLGFSACKTYDLEVWLA-GQNLYREISSCSTCGNFQSRRMNSRY  368 (430)
Q Consensus       291 ~pe~S~~~~e~~~~~~~~i~~~L~-lpyRvv~~~sgdlg~~a~~~~DiE~w~P-~~~~y~Ev~S~Snc~D~QsrRl~iry  368 (430)
T Consensus       156 t~e~a~~~y~~~~~~Y~~if~~lg~lp~~~~~~~~g~kf~Ga~~s~ef~~~~~~G~~~~~ev~H~f~~g~~~s~~~~~~f  235 (264)
T cd00772         156 DAEEADEEFLNMLSAYAEIARDLAAIDFIEGEADEGAKFAGASKSREFEALMEDGKAKQAETGHIFGEGFARAFDLKAKF  235 (264)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCEEEEEEEEECCCCCCCEEEEEEECCCCCCEECCCCCEE
T ss_conf             99999999999999999999996698516764477885688501689999878887136446888157850122566578


Q ss_pred             ECCCCCCCCEEEEECCCHHHHHHHHHHHHHH
Q ss_conf             3389984101042004322899999999883
Q gi|254780680|r  369 RDPNSKSLKFTHTLNGSGVAVGRCLIAILEN  399 (430)
Q Consensus       369 ~~~~~~~~~~~htlNgt~~A~~R~l~ailEn  399 (430)
T Consensus       236 ~~~dg~~-~~v~m-~syGIgitRligaiIeq  264 (264)
T cd00772         236 LDKDGKE-KFFEM-GCWGIGISRFIGAIIEQ  264 (264)
T ss_pred             ECCCCCE-EEEEE-CCCCCHHHHHHHEEECC
T ss_conf             8899998-22580-36778177444405529