HHsearch alignment for GI: 254780680 and conserved domain: cd00773

>cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain. HisRS is a homodimer. It is responsible for the attachment of histidine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent formation of the enzyme bound aminoacyl-adenylate. Class II assignment is based upon its structure and the presence of three characteristic sequence motifs. This domain is also found at the C-terminus of eukaryotic GCN2 protein kinase and at the N-terminus of the ATP phosphoribosyltransferase accessory subunit, HisZ. HisZ along with HisG catalyze the first reaction in histidine biosynthesis. HisZ is found only in a subset of bacteria and differs from HisRS in lacking a C-terminal anti-codon binding domain.
Probab=97.48  E-value=0.00066  Score=49.78  Aligned_cols=132  Identities=23%  Similarity=0.351  Sum_probs=94.3

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEHHHHHCCHHHHHHHHHCHHHHHHHHHHH----HCCEECCCCCCHHHHHHHHHCCCH
Q ss_conf             8999999999998622320320212356202788986551422476776431----000231345411454453420595
Q gi|254780680|r  172 AHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT----DGRWLIPTSEVSLTNLYSHEIIES  247 (430)
Q Consensus       172 A~Le~ALi~y~ld~~~~~~Gy~~v~~P~lv~~~~~~gtG~lp~f~~~~y~~~----d~l~Li~TaEvpL~~~~~~~~l~~  247 (430)
T Consensus         2 ~~~r~~i~~~l~~~-f~~~Gy~~I~~P~lE~~d~~~~~~-~~~~~~~~~~f~D~~g~~l~LRpD~T~~iaR~~~~~~~-~   78 (261)
T cd00773           2 AALRRYIEDTLREV-FERYGYEEIDTPVFEYTELFLRKS-GDEVSKEMYRFKDKGGRDLALRPDLTAPVARAVAENLL-S   78 (261)
T ss_pred             HHHHHHHHHHHHHH-HHHCCCEEEECCCCCCHHHHCCCC-CCCCHHCEEEEECCCCCEEEECCCCCHHHHHHHHHHHC-C
T ss_conf             68999999999999-998699786677645276752446-53102116999979999897678662799999997415-3


Q ss_pred             HHHCCEEEEEECCCCCCCCCCCCCCCCEEEEE-EEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCH
Q ss_conf             55042088532210788433554343212222-1020021212786501457898999999999984106
Q gi|254780680|r  248 KSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQH-QFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLH  316 (430)
Q Consensus       248 ~~LPik~~~~s~cfR~EaGs~GkdtrGl~RvH-QF~KVE~~~~~~pe~S~~~~e~~~~~~~~i~~~L~lp  316 (430)
T Consensus        79 ~~~p~r~~Y~g~VfR~~~~~~g-----~~rE~~Q-~G~EiiG~~----~~~ad~Eii~l~~~~l~~lg~~  138 (261)
T cd00773          79 LPLPLKLYYIGPVFRYERPQKG-----RYREFYQ-VGVEIIGSD----SPLADAEVIALAVEILEALGLK  138 (261)
T ss_pred             CCCCEEEEEECCEEEECCCCCC-----CCCCCCC-EEEEEECCC----CHHHHHHHHHHHHHHHHHCCCC
T ss_conf             7888589997318997689999-----8443221-469997289----7588999999999999976998