>pfam07106 TBPIP Tat binding protein 1(TBP-1)-interacting protein (TBPIP). This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences. TBP-1 has been demonstrated to interact with the human immunodeficiency virus type 1 (HIV-1) viral protein Tat, then modulate the essential replication process of HIV. In addition, TBP-1 has been shown to be a component of the 26S proteasome, a basic multiprotein complex that degrades ubiquitinated proteins in an ATP-dependent fashion. Human TBPIP interacts with human TBP-1 then modulates the inhibitory action of human TBP-1 on HIV-Tat-mediated transactivation.

Probab=92.99 E-value=0.94 Score=26.33 Aligned_cols=68 Identities=15% Similarity=0.220 Sum_probs=50.2 Q ss_pred CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 58899999999999999999999999999999999986449987999999999999988644466666778 Q gi|254780680|r 25 PQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVC 95 (430) Q Consensus 25 ~~id~il~Ld~~rr~l~~e~e~LraerN~lSKeIg~~k~~~~~~~~~~Lk~e~~~Lk~eik~le~~~~~le 95 (430) T Consensus 69 ~~~eel~~~d~~i~~L~~~l~~l~~~~~~l~~el~~L~s~~t~---eel~~~i~~L~~e~~~l~~kL~~l~ 136 (169) T pfam07106 69 PSDEELNKLDMEIEELREEVQLLKQDCSTLEIELKSLTSDLTT---EELQEEIQELKKEVREIEEKLESLE 136 (169) T ss_pred CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH---HHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9988998769999999999999999999999999998758999---9999999999999999999999988

HHsearch alignment for GI: 254780680 and conserved domain: pfam07106