HHsearch results for GI: 254780680 and protein with PDBid: 1b7y_A

>1b7y_A Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer, ligase; HET: FYA; 2.50A {Thermus thermophilus} SCOP: d.104.1.1 PDB: 1b70_A* 1eiy_A 1jjc_A* 1pys_A 2iy5_A* 3hfz_A* 2aly_A* 2akw_A* 2amc_A*
Probab=96.94  E-value=0.0039  Score=42.41  Aligned_cols=195  Identities=17%  Similarity=0.202  Sum_probs=112.4

Q ss_pred             HHHHHHHHHHHCCCCEEHHHHHCCHHHHHHHHHCHHH-----HHHHHHHHHC--------------CEECCCCCCHHHHH
Q ss_conf             9999986223203202123562027889865514224-----7677643100--------------02313454114544
Q gi|254780680|r  179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKF-----ADDMFCTTDG--------------RWLIPTSEVSLTNL  239 (430)
Q Consensus       179 i~y~ld~~~~~~Gy~~v~~P~lv~~~~~~gtG~lp~f-----~~~~y~~~d~--------------l~Li~TaEvpL~~~  239 (430)
                      ++-..|+. ..-||+.+.-|.+-...--+.+=+.|..     ..|.|+++++              ..|.-|---|+..-
T Consensus       107 ~~eI~dIF-~~mGF~v~~GpeIE~d~~NFdaLn~P~dHPARd~~DTFyl~~~~~~~~~~~~~~~~~~~lLRTHTS~~q~r  185 (350)
T 1b7y_A          107 ERELVEIF-RALGYQAVEGPEVESEFFNFDALNIPEHHPARDMWDTFWLTGEGFRLEGPLGEEVEGRLLLRTHTSPMQVR  185 (350)
T ss_dssp             HHHHHHHH-HTTTCEECCCCSEEEHHHHTTTTTCCSSSTTTTSSCCCBEECSSCCCBCTTSCBCCSCEEECSSSTHHHHH
T ss_pred             HHHHHHHH-HHCCCEECCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEECCCCCCCCCCCHHHHHCCCCCCCCCHHHHH
T ss_conf             99999999-73694450387535566668876799755103356438970555345787520111031504468688999


Q ss_pred             HHHHCCCHHHHCCEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCHHHH
Q ss_conf             53420595550420885322107884335543432122221020021212786501457898999999999984106753
Q gi|254780680|r  240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRV  319 (430)
Q Consensus       240 ~~~~~l~~~~LPik~~~~s~cfR~EaGs~GkdtrGl~RvHQF~KVE~~~~~~pe~S~~~~e~~~~~~~~i~~~L~lpyRv  319 (430)
                      ++    ....-|+|+.+.++|||+++=.+   |+    .++|+-+|-+++-..    --+..+....+++++.+.-+=..
T Consensus       186 ~m----~~~~pp~r~i~~GrVyR~d~~D~---tH----~p~FhQ~Egl~vd~~----it~~~Lk~~l~~~~~~~f~~~~~  250 (350)
T 1b7y_A          186 YM----VAHTPPFRIVVPGRVFRFEQTDA---TH----EAVFHQLEGLVVGEG----IAMAHLKGAIYELAQALFGPDSK  250 (350)
T ss_dssp             HH----HHCCSSEEEEEEEEEECCCCCCS---SC----CSEEEEEEEEEEETT----CCHHHHHHHHHHHHHHHSCSSCC
T ss_pred             HH----HCCCCCEEEEECCCCCCCCCCCC---CC----CCCCEEEEEEECCCC----CCHHHHHHHHHHHHHHHCCCCCE
T ss_conf             98----62499816983676546899887---55----875468899981300----22798899999999974189864


Q ss_pred             CCCCCHHCCCHHHEEEEEEEECCCCCCEEEEEEECCCCCHHHHHCCCEEE----CCCCCCCCEEEEECCCHHHHHHHHH
Q ss_conf             03780117844340241011010048332375310210076453268473----3899841010420043228999999
Q gi|254780680|r  320 VSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYR----DPNSKSLKFTHTLNGSGVAVGRCLI  394 (430)
Q Consensus       320 v~~~sgdlg~~a~~~~DiE~w~P~~~~y~Ev~S~Snc~D~QsrRl~iry~----~~~~~~~~~~htlNgt~~A~~R~l~  394 (430)
                      +..-.+=-.|+. =.+.+++|.|..++|.||.-|.-.--=.=+..+|...    ++..+    .+|--+=|+-+-|+..
T Consensus       251 ~R~rp~yFPfTe-Ps~Evdi~~~~~~~WiEi~G~Gmv~p~vl~~~g~~~~~~g~~~~~~----~~~g~AfG~GleRlaM  324 (350)
T 1b7y_A          251 VRFQPVYFPFVE-PGAQFAVWWPEGGKWLELGGAGMVHPKVFQAVDAYRERLGLPPAYR----GVTGFAFGLGVERLAM  324 (350)
T ss_dssp             EEEEECCBTTEE-EEEEEEEEETTTTEEEEEEEEEEECHHHHHHHHHHHHHTTCCCCCT----TCEEEEEEEEHHHHHH
T ss_pred             EEECCCCCCCCC-CCCEEEEEECCCCEEEEEECCCCCCHHHHHHCCCCHHHCCCCCCCC----CCEEEEEEECHHHHHH
T ss_conf             875788789888-8734999968799568980563777899975589766517885456----6759998643889999